Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1934
Gene name
LocationContig_1442:50..869
Strand+
Gene length (bp)819
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11051 Mannosyl_trans3 Mannosyltransferase putative 5.5E-26 7 187

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q59VL7|MNN15_CANAL Putative alpha-1,3-mannosyltransferase MNN15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN15 PE=2 SV=1 7 204 9.0E-16
sp|P40549|MNT3_YEAST Alpha-1,3-mannosyltransferase MNT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNT3 PE=1 SV=1 14 203 2.0E-15
sp|Q59YS7|MNN14_CANAL Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN14 PE=2 SV=1 11 199 3.0E-14
sp|P53059|MNT2_YEAST Alpha-1,3-mannosyltransferase MNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNT2 PE=1 SV=1 8 205 1.0E-10
sp|P39106|MNN1_YEAST Alpha-1,3-mannosyltransferase MNN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN1 PE=1 SV=1 6 198 4.0E-10

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0016757 transferase activity, transferring glycosyl groups Yes
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0036211 protein modification process No
GO:0044260 cellular macromolecule metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044267 cellular protein metabolic process No
GO:0070085 glycosylation No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:0043413 macromolecule glycosylation No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0043412 macromolecule modification No
GO:0019538 protein metabolic process No
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1934
MKAAGGGWAVKPFAALASRFEQVVALDADVVFLQRPEALFAHAAFAATGAYLFHDRLIWQHERPERMAWYRDQIK
EPSASVRASPVWTDEWAEECDSGVVVLDKARPEVLLGLLHAAWQNTGPVRDEVSYQLTWGDKETWWLGLELVGAA
YRFEAGYAGVVGWDRDDRPDDAGADAHVCGNTIAHPDPDGRLLWYNGGLPRNKKVDMDAYVLPDRYLAAGSWVKL
DWNALSCMAGPEPTNLTDSELAILQQSIDGARRIDELFKDIQIGAAA*
Coding >Hirsu2|1934
ATGAAGGCGGCGGGCGGCGGGTGGGCCGTCAAGCCGTTCGCGGCGCTGGCCTCGCGCTTCGAGCAGGTGGTGGCG
CTCGACGCCGACGTCGTCTTCCTGCAGCGGCCCGAGGCGCTGTTCGCCCACGCCGCCTTCGCCGCCACGGGCGCC
TACCTCTTCCACGACCGGCTGATCTGGCAGCACGAGCGGCCGGAGCGGATGGCCTGGTACCGCGACCAGATCAAG
GAGCCGTCGGCCTCGGTCCGGGCCTCGCCCGTCTGGACCGACGAGTGGGCCGAGGAGTGCGACTCGGGCGTCGTC
GTGCTGGACAAGGCCCGGCCCGAGGTCCTGCTCGGCCTGCTGCACGCCGCCTGGCAGAACACGGGCCCCGTCCGC
GACGAGGTCTCCTACCAGCTGACCTGGGGCGACAAGGAGACCTGGTGGCTCGGCCTCGAGCTCGTCGGCGCCGCC
TACCGCTTCGAGGCCGGCTATGCCGGCGTCGTCGGCTGGGACCGCGACGACAGGCCCGACGACGCCGGCGCCGAC
GCCCACGTCTGCGGCAACACCATCGCCCACCCGGACCCGGACGGCCGCCTGCTCTGGTACAACGGCGGCCTGCCG
CGCAACAAGAAGGTCGACATGGACGCCTACGTCCTGCCGGACAGGTACCTCGCCGCCGGCAGCTGGGTCAAGCTC
GACTGGAACGCCCTGAGCTGCATGGCCGGCCCCGAGCCGACAAACCTGACCGACTCCGAGCTCGCCATCCTGCAG
CAGAGCATCGACGGCGCCCGCCGCATCGACGAGCTATTCAAGGATATCCAGATCGGAGCAGCGGCGTGA
Transcript >Hirsu2|1934
ATGAAGGCGGCGGGCGGCGGGTGGGCCGTCAAGCCGTTCGCGGCGCTGGCCTCGCGCTTCGAGCAGGTGGTGGCG
CTCGACGCCGACGTCGTCTTCCTGCAGCGGCCCGAGGCGCTGTTCGCCCACGCCGCCTTCGCCGCCACGGGCGCC
TACCTCTTCCACGACCGGCTGATCTGGCAGCACGAGCGGCCGGAGCGGATGGCCTGGTACCGCGACCAGATCAAG
GAGCCGTCGGCCTCGGTCCGGGCCTCGCCCGTCTGGACCGACGAGTGGGCCGAGGAGTGCGACTCGGGCGTCGTC
GTGCTGGACAAGGCCCGGCCCGAGGTCCTGCTCGGCCTGCTGCACGCCGCCTGGCAGAACACGGGCCCCGTCCGC
GACGAGGTCTCCTACCAGCTGACCTGGGGCGACAAGGAGACCTGGTGGCTCGGCCTCGAGCTCGTCGGCGCCGCC
TACCGCTTCGAGGCCGGCTATGCCGGCGTCGTCGGCTGGGACCGCGACGACAGGCCCGACGACGCCGGCGCCGAC
GCCCACGTCTGCGGCAACACCATCGCCCACCCGGACCCGGACGGCCGCCTGCTCTGGTACAACGGCGGCCTGCCG
CGCAACAAGAAGGTCGACATGGACGCCTACGTCCTGCCGGACAGGTACCTCGCCGCCGGCAGCTGGGTCAAGCTC
GACTGGAACGCCCTGAGCTGCATGGCCGGCCCCGAGCCGACAAACCTGACCGACTCCGAGCTCGCCATCCTGCAG
CAGAGCATCGACGGCGCCCGCCGCATCGACGAGCTATTCAAGGATATCCAGATCGGAGCAGCGGCGTGA
Gene >Hirsu2|1934
ATGAAGGCGGCGGGCGGCGGGTGGGCCGTCAAGCCGTTCGCGGCGCTGGCCTCGCGCTTCGAGCAGGTGGTGGCG
CTCGACGCCGACGTCGTCTTCCTGCAGCGGCCCGAGGCGCTGTTCGCCCACGCCGCCTTCGCCGCCACGGGCGCC
TACCTCTTCCACGACCGGCTGATCTGGCAGCACGAGCGGCCGGAGCGGATGGCCTGGTACCGCGACCAGATCAAG
GAGCCGTCGGCCTCGGTCCGGGCCTCGCCCGTCTGGACCGACGAGTGGGCCGAGGAGTGCGACTCGGGCGTCGTC
GTGCTGGACAAGGCCCGGCCCGAGGTCCTGCTCGGCCTGCTGCACGCCGCCTGGCAGAACACGGGCCCCGTCCGC
GACGAGGTCTCCTACCAGCTGACCTGGGGCGACAAGGAGACCTGGTGGCTCGGCCTCGAGCTCGTCGGCGCCGCC
TACCGCTTCGAGGCCGGCTATGCCGGCGTCGTCGGCTGGGACCGCGACGACAGGCCCGACGACGCCGGCGCCGAC
GCCCACGTCTGCGGCAACACCATCGCCCACCCGGACCCGGACGGCCGCCTGCTCTGGTACAACGGCGGCCTGCCG
CGCAACAAGAAGGTCGACATGGACGCCTACGTCCTGCCGGACAGGTACCTCGCCGCCGGCAGCTGGGTCAAGCTC
GACTGGAACGCCCTGAGCTGCATGGCCGGCCCCGAGCCGACAAACCTGACCGACTCCGAGCTCGCCATCCTGCAG
CAGAGCATCGACGGCGCCCGCCGCATCGACGAGCTATTCAAGGATATCCAGATCGGAGCAGCGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail