Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1928
Gene name
LocationContig_144:31489..32728
Strand-
Gene length (bp)1239
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11788 MRP-L46 39S mitochondrial ribosomal protein L46 1.7E-26 77 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36528|RM17_YEAST 54S ribosomal protein L17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL17 PE=1 SV=2 79 350 1.0E-22
sp|O94398|RM17_SCHPO 54S ribosomal protein L17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl17 PE=3 SV=1 40 351 7.0E-20
sp|Q9EQI8|RM46_MOUSE 39S ribosomal protein L46, mitochondrial OS=Mus musculus GN=Mrpl46 PE=1 SV=1 204 350 5.0E-11
sp|Q5RBU2|RM46_PONAB 39S ribosomal protein L46, mitochondrial OS=Pongo abelii GN=MRPL46 PE=2 SV=1 208 350 5.0E-11
sp|Q5RK00|RM46_RAT 39S ribosomal protein L46, mitochondrial OS=Rattus norvegicus GN=Mrpl46 PE=2 SV=1 181 350 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36528|RM17_YEAST 54S ribosomal protein L17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL17 PE=1 SV=2 79 350 1.0E-22
sp|O94398|RM17_SCHPO 54S ribosomal protein L17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl17 PE=3 SV=1 40 351 7.0E-20
sp|Q9EQI8|RM46_MOUSE 39S ribosomal protein L46, mitochondrial OS=Mus musculus GN=Mrpl46 PE=1 SV=1 204 350 5.0E-11
sp|Q5RBU2|RM46_PONAB 39S ribosomal protein L46, mitochondrial OS=Pongo abelii GN=MRPL46 PE=2 SV=1 208 350 5.0E-11
sp|Q5RK00|RM46_RAT 39S ribosomal protein L46, mitochondrial OS=Rattus norvegicus GN=Mrpl46 PE=2 SV=1 181 350 1.0E-10
sp|Q9H2W6|RM46_HUMAN 39S ribosomal protein L46, mitochondrial OS=Homo sapiens GN=MRPL46 PE=1 SV=1 208 350 2.0E-10
sp|Q3SZ22|RM46_BOVIN 39S ribosomal protein L46, mitochondrial OS=Bos taurus GN=MRPL46 PE=2 SV=1 169 350 9.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1928
MTASSRGRRAFQNAVLAAASPARVCSRCATTTTTTTTTTSYSRGFFSSPPSSSSSTGGLETASPATGGPSPPAAA
AYDVRSGLILTRAPLLTRRLHPFENAFFFYQKRLEERLNSAFVTSIYFKPDTARRMDWNIKVAERQGAVAKELGL
YHGKSARAWNDELKVGDPLSSQERLVDSLLRDGEARVSDDAELIPPENVVPVERPLPRETDADRAGDVTRLDRRL
DRTLYLVVRGRDGWGFPADSVAHDENLHEAAQRVLDQAAGVNMNTWLVGRAPVAHLVTRAVVGPDGAVHKPGRKT
FFLKGRIMAGQADLRGNPFGYSAFKWLTREELEAELAPDYYRGVRNMMGDR*
Coding >Hirsu2|1928
ATGACGGCCTCCAGCAGAGGCCGACGCGCCTTTCAGAATGCCGTACTGGCAGCAGCTTCGCCCGCAAGAGTGTGT
TCGCGGTGCGCCACGACGACGACGACGACGACGACGACGACGAGCTACAGCCGCGGCTTCTTCTCTTCCCCTCCC
TCTTCCTCCTCCTCCACCGGCGGCCTGGAGACAGCGTCGCCGGCCACCGGCGGCCCGTCGCCACCGGCGGCGGCA
GCGTACGACGTGCGGTCCGGGCTGATCCTGACGCGGGCGCCGCTGCTGACGCGGCGGCTGCACCCGTTCGAGAAC
GCCTTCTTCTTCTACCAGAAGCGGCTGGAGGAGCGGCTCAACTCGGCCTTCGTGACGAGCATCTACTTCAAGCCG
GACACGGCGCGGCGCATGGACTGGAACATCAAGGTGGCGGAGCGGCAGGGCGCGGTGGCCAAGGAACTCGGCCTG
TACCACGGCAAGAGCGCGCGCGCGTGGAACGACGAGCTCAAGGTCGGCGACCCGCTCAGCAGCCAGGAGCGGCTG
GTCGACAGCCTGCTGCGCGACGGCGAGGCCCGCGTCTCGGACGACGCCGAGCTCATCCCGCCCGAGAACGTGGTG
CCGGTCGAGCGCCCGCTGCCGCGCGAGACGGACGCCGACCGCGCCGGCGACGTCACCCGCCTCGACCGCCGCCTC
GACCGCACCCTCTACCTCGTCGTCCGCGGCCGCGACGGCTGGGGCTTCCCGGCCGACTCCGTCGCCCACGACGAG
AACCTGCACGAGGCGGCGCAGCGGGTGCTGGACCAGGCGGCCGGCGTCAACATGAACACCTGGCTCGTCGGCCGC
GCCCCCGTCGCCCACCTCGTGACGCGGGCCGTCGTCGGCCCCGACGGCGCCGTCCACAAGCCCGGCCGCAAGACC
TTCTTCCTCAAGGGCCGCATCATGGCCGGCCAGGCCGACCTGCGCGGCAACCCCTTCGGCTACTCCGCCTTCAAG
TGGCTGACGAGGGAGGAGCTGGAGGCCGAGCTGGCGCCCGACTACTACCGCGGCGTGCGCAACATGATGGGCGAC
AGGTGA
Transcript >Hirsu2|1928
ATGACGGCCTCCAGCAGAGGCCGACGCGCCTTTCAGAATGCCGTACTGGCAGCAGCTTCGCCCGCAAGAGTGTGT
TCGCGGTGCGCCACGACGACGACGACGACGACGACGACGACGAGCTACAGCCGCGGCTTCTTCTCTTCCCCTCCC
TCTTCCTCCTCCTCCACCGGCGGCCTGGAGACAGCGTCGCCGGCCACCGGCGGCCCGTCGCCACCGGCGGCGGCA
GCGTACGACGTGCGGTCCGGGCTGATCCTGACGCGGGCGCCGCTGCTGACGCGGCGGCTGCACCCGTTCGAGAAC
GCCTTCTTCTTCTACCAGAAGCGGCTGGAGGAGCGGCTCAACTCGGCCTTCGTGACGAGCATCTACTTCAAGCCG
GACACGGCGCGGCGCATGGACTGGAACATCAAGGTGGCGGAGCGGCAGGGCGCGGTGGCCAAGGAACTCGGCCTG
TACCACGGCAAGAGCGCGCGCGCGTGGAACGACGAGCTCAAGGTCGGCGACCCGCTCAGCAGCCAGGAGCGGCTG
GTCGACAGCCTGCTGCGCGACGGCGAGGCCCGCGTCTCGGACGACGCCGAGCTCATCCCGCCCGAGAACGTGGTG
CCGGTCGAGCGCCCGCTGCCGCGCGAGACGGACGCCGACCGCGCCGGCGACGTCACCCGCCTCGACCGCCGCCTC
GACCGCACCCTCTACCTCGTCGTCCGCGGCCGCGACGGCTGGGGCTTCCCGGCCGACTCCGTCGCCCACGACGAG
AACCTGCACGAGGCGGCGCAGCGGGTGCTGGACCAGGCGGCCGGCGTCAACATGAACACCTGGCTCGTCGGCCGC
GCCCCCGTCGCCCACCTCGTGACGCGGGCCGTCGTCGGCCCCGACGGCGCCGTCCACAAGCCCGGCCGCAAGACC
TTCTTCCTCAAGGGCCGCATCATGGCCGGCCAGGCCGACCTGCGCGGCAACCCCTTCGGCTACTCCGCCTTCAAG
TGGCTGACGAGGGAGGAGCTGGAGGCCGAGCTGGCGCCCGACTACTACCGCGGCGTGCGCAACATGATGGGCGAC
AGGTGA
Gene >Hirsu2|1928
ATGACGGCCTCCAGCAGAGGCCGACGCGCCTTTCAGAATGCCGTACTGGGTAGGGCGTCACGACTCCCTGGGACG
ACGAGCAGATGAGGCCGTTTCGCCGTGTCGAAGCCGCGACTGACCGGAGCCAGCAGCAGCAGCTTCGCCCGCAAG
AGTGTGTTCGCGGTGCGCCACGACGACGACGACGACGACGACGACGACGAGCTACAGCCGCGGCTTCTTCTCTTC
CCCTCCCTCTTCCTCCTCCTCCACCGGCGGCCTGGAGACAGCGTCGCCGGCCACCGGCGGCCCGTCGCCACCGGC
GGCGGCAGCGTACGACGTGCGGTCCGGGCTGATCCTGACGCGGGCGCCGCTGCTGACGCGGCGGCTGCACCCGTT
CGAGAACGCCTTCTTCTTCTACCAGAAGCGGCTGGAGGAGCGGCTCAACTCGGCCTTCGTGACGAGCATCTACTT
CAAGCCGGACACGGCGCGGCGCATGGACTGGAACATCAAGGTGGCGGAGCGGCAGGGCGCGGTGGCCAAGGAACT
CGGCCTGTACCACGGCAAGAGCGCGCGCGCGTGGAACGACGAGCTCAAGGTCGGCGACCCGCTCAGCAGCCAGGA
GCGGCTGGTCGACAGCCTGCTGCGCGACGGCGAGGCCCGCGTCTCGGACGACGCCGAGCTCATCCCGCCCGAGAA
CGTGGTGCCGGTCGAGCGCCCGCTGCCGCGCGAGACGGACGCCGACCGCGCCGGCGACGTCACCCGCCTCGACCG
CCGCCTCGACCGCACCCTCTACCTCGTCGTCCGCGGCCGCGACGGCTGGGGCTTCCCGGCCGACTCCGTCGCCCA
CGACGAGAACCTGCACGAGGTGAGAGAGACGCGAAATCCCCTTGTTCCTTGTTTTTTTTTTGTTTCTTTTTGCCA
CACCCCTACCCGCCCACAGCGCTGAACGAGAGACGACGACGGCAGGCGGCGCAGCGGGTGCTGGACCAGGCGGCC
GGCGTCAACATGAACACCTGGCTCGTCGGCCGCGCCCCCGTCGCCCACCTCGTGACGCGGGCCGTCGTCGGCCCC
GACGGCGCCGTCCACAAGCCCGGCCGCAAGACCTTCTTCCTCAAGGGCCGCATCATGGCCGGCCAGGCCGACCTG
CGCGGCAACCCCTTCGGCTACTCCGCCTTCAAGTGGCTGACGAGGGAGGAGCTGGAGGCCGAGCTGGCGCCCGAC
TACTACCGCGGCGTGCGCAACATGATGGGCGACAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail