Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1923
Gene name
LocationContig_144:11637..12819
Strand-
Gene length (bp)1182
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK17|PLCX1_ARTBC PI-PLC X domain-containing protein 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04618 PE=1 SV=1 47 351 2.0E-52
sp|D4AUX6|A8043_ARTBC Uncharacterized secreted protein ARB_08043 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_08043 PE=1 SV=1 46 340 1.0E-43

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1923
MIFFPAVAALAAVASVAGAAPQAPAATSAPTSAPAPGASAGAGSGPCNNSPQLCERAYNKITYMGAHDSSFLRDK
STGNSPAGNQFKNATVALDAGIRLLQTQLHKVKSAQPPTAALRLCHSSCGILDAGPLEKWLAAVREWMVRNPNEV
VTLILVNSDSVPAQEIAGAFDRSGMTDLTYKPAAPGATANWPTLGSMISQGGRFVSFVTNVEYTPQFPYLLPQFN
YIFETAFEVTQLDGFNCTLNRPQGIGQAPQALAANYMGLVNHFKYQTLGSDFIKNLAKTVGINSQVMVPDVDRAG
TVNSAGQAAAGNLGLHVQQCRGEWKQQPNFVLVDFWDVANPLEAADSLNGVNAAVGRKAVPAGMTAAATLSVAPP
AASTALCLAAAVLLLRLL*
Coding >Hirsu2|1923
ATGATCTTCTTCCCCGCCGTGGCGGCGCTGGCAGCCGTCGCCAGCGTCGCCGGCGCCGCCCCCCAGGCGCCAGCA
GCGACCTCTGCTCCGACCTCTGCTCCGGCCCCCGGCGCCAGTGCCGGCGCCGGGTCCGGCCCCTGCAACAACTCG
CCGCAGCTGTGCGAGCGGGCCTACAACAAAATCACCTACATGGGCGCCCACGACAGCTCGTTCCTGCGCGACAAG
AGCACGGGCAACTCGCCGGCCGGCAACCAGTTCAAGAACGCGACGGTGGCGCTCGACGCCGGCATCCGGCTGCTG
CAGACGCAGCTGCACAAGGTCAAGTCGGCGCAGCCGCCGACGGCCGCCCTGCGCCTCTGCCACTCGTCGTGCGGC
ATCCTCGACGCCGGGCCGCTGGAGAAGTGGCTGGCGGCGGTGCGCGAGTGGATGGTGCGCAACCCCAACGAGGTG
GTGACGCTGATCCTCGTCAACTCGGACAGCGTGCCGGCGCAGGAGATCGCCGGCGCCTTCGACCGGTCCGGCATG
ACGGACCTGACCTACAAGCCGGCGGCGCCGGGGGCGACGGCCAACTGGCCGACGCTGGGGTCCATGATCAGCCAG
GGCGGGCGGTTCGTCAGCTTCGTGACCAACGTCGAATACACGCCGCAGTTCCCGTACCTGCTGCCGCAGTTCAAT
TACATCTTCGAGACGGCCTTTGAGGTGACGCAGCTCGACGGCTTCAACTGCACGCTCAACCGGCCGCAGGGCATC
GGCCAGGCCCCGCAGGCGCTGGCGGCCAACTACATGGGCCTGGTCAACCATTTCAAGTACCAGACGCTCGGCTCC
GACTTCATTAAGAACCTGGCCAAGACGGTCGGCATCAACTCGCAGGTCATGGTGCCGGACGTGGACCGGGCCGGC
ACCGTCAACAGCGCCGGCCAGGCCGCGGCCGGCAACCTGGGCCTGCACGTGCAGCAGTGCCGCGGCGAGTGGAAG
CAGCAGCCCAACTTCGTCCTCGTCGACTTCTGGGACGTGGCCAACCCGCTCGAGGCGGCCGACAGCCTCAACGGC
GTCAACGCCGCCGTCGGCCGCAAGGCCGTCCCCGCCGGCATGACCGCCGCCGCCACCTTGTCCGTCGCCCCGCCC
GCTGCCTCGACGGCCCTTTGCCTGGCGGCTGCCGTGCTGCTGCTGCGGCTGCTGTGA
Transcript >Hirsu2|1923
ATGATCTTCTTCCCCGCCGTGGCGGCGCTGGCAGCCGTCGCCAGCGTCGCCGGCGCCGCCCCCCAGGCGCCAGCA
GCGACCTCTGCTCCGACCTCTGCTCCGGCCCCCGGCGCCAGTGCCGGCGCCGGGTCCGGCCCCTGCAACAACTCG
CCGCAGCTGTGCGAGCGGGCCTACAACAAAATCACCTACATGGGCGCCCACGACAGCTCGTTCCTGCGCGACAAG
AGCACGGGCAACTCGCCGGCCGGCAACCAGTTCAAGAACGCGACGGTGGCGCTCGACGCCGGCATCCGGCTGCTG
CAGACGCAGCTGCACAAGGTCAAGTCGGCGCAGCCGCCGACGGCCGCCCTGCGCCTCTGCCACTCGTCGTGCGGC
ATCCTCGACGCCGGGCCGCTGGAGAAGTGGCTGGCGGCGGTGCGCGAGTGGATGGTGCGCAACCCCAACGAGGTG
GTGACGCTGATCCTCGTCAACTCGGACAGCGTGCCGGCGCAGGAGATCGCCGGCGCCTTCGACCGGTCCGGCATG
ACGGACCTGACCTACAAGCCGGCGGCGCCGGGGGCGACGGCCAACTGGCCGACGCTGGGGTCCATGATCAGCCAG
GGCGGGCGGTTCGTCAGCTTCGTGACCAACGTCGAATACACGCCGCAGTTCCCGTACCTGCTGCCGCAGTTCAAT
TACATCTTCGAGACGGCCTTTGAGGTGACGCAGCTCGACGGCTTCAACTGCACGCTCAACCGGCCGCAGGGCATC
GGCCAGGCCCCGCAGGCGCTGGCGGCCAACTACATGGGCCTGGTCAACCATTTCAAGTACCAGACGCTCGGCTCC
GACTTCATTAAGAACCTGGCCAAGACGGTCGGCATCAACTCGCAGGTCATGGTGCCGGACGTGGACCGGGCCGGC
ACCGTCAACAGCGCCGGCCAGGCCGCGGCCGGCAACCTGGGCCTGCACGTGCAGCAGTGCCGCGGCGAGTGGAAG
CAGCAGCCCAACTTCGTCCTCGTCGACTTCTGGGACGTGGCCAACCCGCTCGAGGCGGCCGACAGCCTCAACGGC
GTCAACGCCGCCGTCGGCCGCAAGGCCGTCCCCGCCGGCATGACCGCCGCCGCCACCTTGTCCGTCGCCCCGCCC
GCTGCCTCGACGGCCCTTTGCCTGGCGGCTGCCGTGCTGCTGCTGCGGCTGCTGTGA
Gene >Hirsu2|1923
ATGATCTTCTTCCCCGCCGTGGCGGCGCTGGCAGCCGTCGCCAGCGTCGCCGGCGCCGCCCCCCAGGCGCCAGCA
GCGACCTCTGCTCCGACCTCTGCTCCGGCCCCCGGCGCCAGTGCCGGCGCCGGGTCCGGCCCCTGCAACAACTCG
CCGCAGCTGTGCGAGCGGGCCTACAACAAAATCACCTACATGGGCGCCCACGACAGCTCGTTCCTGCGCGACAAG
AGCACGGGCAACTCGCCGGCCGGCAACCAGTTCAAGAACGCGACGGTGGCGCTCGACGCCGGCATCCGGCTGCTG
CAGACGCAGCTGCACAAGGTCAAGTCGGCGCAGCCGCCGACGGCCGCCCTGCGCCTCTGCCACTCGTCGTGCGGC
ATCCTCGACGCCGGGCCGCTGGAGAAGTGGCTGGCGGCGGTGCGCGAGTGGATGGTGCGCAACCCCAACGAGGTG
GTGACGCTGATCCTCGTCAACTCGGACAGCGTGCCGGCGCAGGAGATCGCCGGCGCCTTCGACCGGTCCGGCATG
ACGGACCTGACCTACAAGCCGGCGGCGCCGGGGGCGACGGCCAACTGGCCGACGCTGGGGTCCATGATCAGCCAG
GGCGGGCGGTTCGTCAGCTTCGTGACCAACGTCGAATACACGCCGCAGTTCCCGTACCTGCTGCCGCAGTTCAAT
TACATCTTCGAGACGGCCTTTGAGGTGACGCAGCTCGACGGCTTCAACTGCACGCTCAACCGGCCGCAGGGCATC
GGCCAGGCCCCGCAGGCGCTGGCGGCCAACTACATGGGCCTGGTCAACCATTTCAAGTACCAGACGCTCGGCTCC
GACTTCATTAAGAACCTGGCCAAGACGGTCGGCATCAACTCGCAGGTCATGGTGCCGGACGTGGACCGGGCCGGC
ACCGTCAACAGCGCCGGCCAGGCCGCGGCCGGCAACCTGGGCCTGCACGTGCAGCAGTGCCGCGGCGAGTGGAAG
CAGCAGCCCAACTTCGTCCTCGTCGACTTCTGGGACGTGGCCAACCCGCTCGAGGCGGCCGACAGCCTCAACGGC
GTCAACGCCGCCGTCGGCCGCAAGGCCGTCCCCGCCGGCATGACCGCCGCCGCCACCTTGTCCGTCGCCCCGCCC
GCTGCCTCGACGGCCCTTTGCCTGGCGGCTGCCGTGCTGCTGCTGCGGCTGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail