Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1923
Gene name
LocationContig_144:11637..12819
Strand-
Gene length (bp)1182
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK17|PLCX1_ARTBC PI-PLC X domain-containing protein 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04618 PE=1 SV=1 47 351 2.0E-52
sp|D4AUX6|A8043_ARTBC Uncharacterized secreted protein ARB_08043 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_08043 PE=1 SV=1 46 340 1.0E-43

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular|Cell membrane 0.1297 0.0403 0.7511 0.597 0.122 0.0066 0.3169 0.2359 0.2913 0.0051

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999686

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4954
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4289
Ophiocordyceps australis map64 (Brazil) OphauB2|5188
Ophiocordyceps camponoti-floridani Ophcf2|06536
Ophiocordyceps camponoti-rufipedis Ophun1|5668
Ophiocordyceps kimflemingae Ophio5|3216
Ophiocordyceps subramaniannii Hirsu2|1923 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1923
MIFFPAVAALAAVASVAGAAPQAPAATSAPTSAPAPGASAGAGSGPCNNSPQLCERAYNKITYMGAHDSSFLRDK
STGNSPAGNQFKNATVALDAGIRLLQTQLHKVKSAQPPTAALRLCHSSCGILDAGPLEKWLAAVREWMVRNPNEV
VTLILVNSDSVPAQEIAGAFDRSGMTDLTYKPAAPGATANWPTLGSMISQGGRFVSFVTNVEYTPQFPYLLPQFN
YIFETAFEVTQLDGFNCTLNRPQGIGQAPQALAANYMGLVNHFKYQTLGSDFIKNLAKTVGINSQVMVPDVDRAG
TVNSAGQAAAGNLGLHVQQCRGEWKQQPNFVLVDFWDVANPLEAADSLNGVNAAVGRKAVPAGMTAAATLSVAPP
AASTALCLAAAVLLLRLL*
Coding >Hirsu2|1923
ATGATCTTCTTCCCCGCCGTGGCGGCGCTGGCAGCCGTCGCCAGCGTCGCCGGCGCCGCCCCCCAGGCGCCAGCA
GCGACCTCTGCTCCGACCTCTGCTCCGGCCCCCGGCGCCAGTGCCGGCGCCGGGTCCGGCCCCTGCAACAACTCG
CCGCAGCTGTGCGAGCGGGCCTACAACAAAATCACCTACATGGGCGCCCACGACAGCTCGTTCCTGCGCGACAAG
AGCACGGGCAACTCGCCGGCCGGCAACCAGTTCAAGAACGCGACGGTGGCGCTCGACGCCGGCATCCGGCTGCTG
CAGACGCAGCTGCACAAGGTCAAGTCGGCGCAGCCGCCGACGGCCGCCCTGCGCCTCTGCCACTCGTCGTGCGGC
ATCCTCGACGCCGGGCCGCTGGAGAAGTGGCTGGCGGCGGTGCGCGAGTGGATGGTGCGCAACCCCAACGAGGTG
GTGACGCTGATCCTCGTCAACTCGGACAGCGTGCCGGCGCAGGAGATCGCCGGCGCCTTCGACCGGTCCGGCATG
ACGGACCTGACCTACAAGCCGGCGGCGCCGGGGGCGACGGCCAACTGGCCGACGCTGGGGTCCATGATCAGCCAG
GGCGGGCGGTTCGTCAGCTTCGTGACCAACGTCGAATACACGCCGCAGTTCCCGTACCTGCTGCCGCAGTTCAAT
TACATCTTCGAGACGGCCTTTGAGGTGACGCAGCTCGACGGCTTCAACTGCACGCTCAACCGGCCGCAGGGCATC
GGCCAGGCCCCGCAGGCGCTGGCGGCCAACTACATGGGCCTGGTCAACCATTTCAAGTACCAGACGCTCGGCTCC
GACTTCATTAAGAACCTGGCCAAGACGGTCGGCATCAACTCGCAGGTCATGGTGCCGGACGTGGACCGGGCCGGC
ACCGTCAACAGCGCCGGCCAGGCCGCGGCCGGCAACCTGGGCCTGCACGTGCAGCAGTGCCGCGGCGAGTGGAAG
CAGCAGCCCAACTTCGTCCTCGTCGACTTCTGGGACGTGGCCAACCCGCTCGAGGCGGCCGACAGCCTCAACGGC
GTCAACGCCGCCGTCGGCCGCAAGGCCGTCCCCGCCGGCATGACCGCCGCCGCCACCTTGTCCGTCGCCCCGCCC
GCTGCCTCGACGGCCCTTTGCCTGGCGGCTGCCGTGCTGCTGCTGCGGCTGCTGTGA
Transcript >Hirsu2|1923
ATGATCTTCTTCCCCGCCGTGGCGGCGCTGGCAGCCGTCGCCAGCGTCGCCGGCGCCGCCCCCCAGGCGCCAGCA
GCGACCTCTGCTCCGACCTCTGCTCCGGCCCCCGGCGCCAGTGCCGGCGCCGGGTCCGGCCCCTGCAACAACTCG
CCGCAGCTGTGCGAGCGGGCCTACAACAAAATCACCTACATGGGCGCCCACGACAGCTCGTTCCTGCGCGACAAG
AGCACGGGCAACTCGCCGGCCGGCAACCAGTTCAAGAACGCGACGGTGGCGCTCGACGCCGGCATCCGGCTGCTG
CAGACGCAGCTGCACAAGGTCAAGTCGGCGCAGCCGCCGACGGCCGCCCTGCGCCTCTGCCACTCGTCGTGCGGC
ATCCTCGACGCCGGGCCGCTGGAGAAGTGGCTGGCGGCGGTGCGCGAGTGGATGGTGCGCAACCCCAACGAGGTG
GTGACGCTGATCCTCGTCAACTCGGACAGCGTGCCGGCGCAGGAGATCGCCGGCGCCTTCGACCGGTCCGGCATG
ACGGACCTGACCTACAAGCCGGCGGCGCCGGGGGCGACGGCCAACTGGCCGACGCTGGGGTCCATGATCAGCCAG
GGCGGGCGGTTCGTCAGCTTCGTGACCAACGTCGAATACACGCCGCAGTTCCCGTACCTGCTGCCGCAGTTCAAT
TACATCTTCGAGACGGCCTTTGAGGTGACGCAGCTCGACGGCTTCAACTGCACGCTCAACCGGCCGCAGGGCATC
GGCCAGGCCCCGCAGGCGCTGGCGGCCAACTACATGGGCCTGGTCAACCATTTCAAGTACCAGACGCTCGGCTCC
GACTTCATTAAGAACCTGGCCAAGACGGTCGGCATCAACTCGCAGGTCATGGTGCCGGACGTGGACCGGGCCGGC
ACCGTCAACAGCGCCGGCCAGGCCGCGGCCGGCAACCTGGGCCTGCACGTGCAGCAGTGCCGCGGCGAGTGGAAG
CAGCAGCCCAACTTCGTCCTCGTCGACTTCTGGGACGTGGCCAACCCGCTCGAGGCGGCCGACAGCCTCAACGGC
GTCAACGCCGCCGTCGGCCGCAAGGCCGTCCCCGCCGGCATGACCGCCGCCGCCACCTTGTCCGTCGCCCCGCCC
GCTGCCTCGACGGCCCTTTGCCTGGCGGCTGCCGTGCTGCTGCTGCGGCTGCTGTGA
Gene >Hirsu2|1923
ATGATCTTCTTCCCCGCCGTGGCGGCGCTGGCAGCCGTCGCCAGCGTCGCCGGCGCCGCCCCCCAGGCGCCAGCA
GCGACCTCTGCTCCGACCTCTGCTCCGGCCCCCGGCGCCAGTGCCGGCGCCGGGTCCGGCCCCTGCAACAACTCG
CCGCAGCTGTGCGAGCGGGCCTACAACAAAATCACCTACATGGGCGCCCACGACAGCTCGTTCCTGCGCGACAAG
AGCACGGGCAACTCGCCGGCCGGCAACCAGTTCAAGAACGCGACGGTGGCGCTCGACGCCGGCATCCGGCTGCTG
CAGACGCAGCTGCACAAGGTCAAGTCGGCGCAGCCGCCGACGGCCGCCCTGCGCCTCTGCCACTCGTCGTGCGGC
ATCCTCGACGCCGGGCCGCTGGAGAAGTGGCTGGCGGCGGTGCGCGAGTGGATGGTGCGCAACCCCAACGAGGTG
GTGACGCTGATCCTCGTCAACTCGGACAGCGTGCCGGCGCAGGAGATCGCCGGCGCCTTCGACCGGTCCGGCATG
ACGGACCTGACCTACAAGCCGGCGGCGCCGGGGGCGACGGCCAACTGGCCGACGCTGGGGTCCATGATCAGCCAG
GGCGGGCGGTTCGTCAGCTTCGTGACCAACGTCGAATACACGCCGCAGTTCCCGTACCTGCTGCCGCAGTTCAAT
TACATCTTCGAGACGGCCTTTGAGGTGACGCAGCTCGACGGCTTCAACTGCACGCTCAACCGGCCGCAGGGCATC
GGCCAGGCCCCGCAGGCGCTGGCGGCCAACTACATGGGCCTGGTCAACCATTTCAAGTACCAGACGCTCGGCTCC
GACTTCATTAAGAACCTGGCCAAGACGGTCGGCATCAACTCGCAGGTCATGGTGCCGGACGTGGACCGGGCCGGC
ACCGTCAACAGCGCCGGCCAGGCCGCGGCCGGCAACCTGGGCCTGCACGTGCAGCAGTGCCGCGGCGAGTGGAAG
CAGCAGCCCAACTTCGTCCTCGTCGACTTCTGGGACGTGGCCAACCCGCTCGAGGCGGCCGACAGCCTCAACGGC
GTCAACGCCGCCGTCGGCCGCAAGGCCGTCCCCGCCGGCATGACCGCCGCCGCCACCTTGTCCGTCGCCCCGCCC
GCTGCCTCGACGGCCCTTTGCCTGGCGGCTGCCGTGCTGCTGCTGCGGCTGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail