Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1905
Gene name
LocationContig_1436:1695..2994
Strand-
Gene length (bp)1299
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 1.4E-17 19 76
PF04193 PQ-loop PQ loop repeat 5.1E-21 216 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 16 303 2.0E-47
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 34 302 8.0E-44
sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans GN=laat-1 PE=1 SV=2 17 302 3.0E-39
sp|Q10482|STM1_SCHPO Seven transmembrane protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stm1 PE=1 SV=1 19 302 3.0E-35
sp|Q06328|YPQ2_YEAST Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ2 PE=1 SV=1 18 311 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 16 303 2.0E-47
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 34 302 8.0E-44
sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans GN=laat-1 PE=1 SV=2 17 302 3.0E-39
sp|Q10482|STM1_SCHPO Seven transmembrane protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stm1 PE=1 SV=1 19 302 3.0E-35
sp|Q06328|YPQ2_YEAST Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ2 PE=1 SV=1 18 311 2.0E-26
sp|Q5ZJX0|LAAT1_CHICK Lysosomal amino acid transporter 1 homolog OS=Gallus gallus GN=PQLC2 PE=2 SV=1 20 305 8.0E-19
sp|Q6ZP29|LAAT1_HUMAN Lysosomal amino acid transporter 1 homolog OS=Homo sapiens GN=PQLC2 PE=1 SV=1 24 302 2.0E-15
sp|B0BMY1|LAAT1_RAT Lysosomal amino acid transporter 1 homolog OS=Rattus norvegicus GN=Pqlc2 PE=1 SV=1 202 302 4.0E-10
sp|Q8C4N4|LAAT1_MOUSE Lysosomal amino acid transporter 1 homolog OS=Mus musculus GN=Pqlc2 PE=2 SV=1 24 302 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 50 72 22
3 77 99 22
4 170 192 22
5 212 234 22
6 246 268 22
7 278 297 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1905
MASFTAAAAAGPLPLAQALSGIFGSISLTAWICLLLPQLWANYKAKSADGLSITFLIVWSLGDVTNLSGALLTDL
APSAVALAVYFCILDVTLISQCLYYNTINARRRAVAEASSEDSPLLARRQSTSSGPDGARGSPAEHEETAARLAR
KNAAAGDEAAIDGGSWKHNALSLLAVYAIGFAGWFVSYMAGAWGSETPKVPDAADERSHSRVVAGLVLGYASAAC
YLCARIPQIVKNYREKSCEGLSLLFFMLSLTGNLTYGVSLIAYSQGKDYLLKALPWLLGSLGTIVEDATIFVQFR
LYAGGLRTEALG*
Coding >Hirsu2|1905
ATGGCTTCCTTCACCGCCGCCGCCGCCGCCGGGCCGTTGCCTCTGGCCCAGGCCCTGTCGGGCATCTTTGGCAGC
ATCAGTCTGACGGCCTGGATCTGCCTGCTGCTCCCCCAGCTGTGGGCCAACTACAAGGCCAAGAGCGCCGACGGC
CTCAGCATCACCTTTCTCATTGTCTGGTCCTTGGGAGACGTGACAAATCTGTCAGGTGCCCTCCTGACAGACCTG
GCGCCGAGTGCCGTCGCCCTGGCCGTCTACTTCTGCATCCTGGACGTGACGCTCATCAGCCAGTGCCTGTACTAC
AACACCATCAATGCGCGCCGGAGAGCCGTGGCCGAGGCGAGCTCGGAGGACTCGCCGCTCCTCGCGCGGCGGCAG
AGCACCTCGTCCGGCCCGGACGGCGCCCGGGGGAGCCCGGCCGAGCACGAAGAGACGGCGGCGCGGCTTGCCCGC
AAGAATGCCGCGGCCGGCGACGAGGCCGCCATCGACGGCGGTTCGTGGAAACACAACGCCCTGAGCCTGTTGGCC
GTCTACGCCATCGGCTTCGCCGGCTGGTTCGTCTCCTACATGGCCGGCGCCTGGGGCAGCGAGACGCCCAAGGTC
CCCGACGCGGCGGACGAGAGGAGCCACTCGCGCGTCGTTGCCGGCCTCGTTCTCGGCTACGCCAGCGCGGCCTGT
TACCTCTGCGCTCGGATACCTCAGATTGTCAAGAACTACCGGGAGAAGTCTTGCGAAGGCCTGTCGCTTCTCTTC
TTCATGCTGTCTCTGACCGGCAACCTGACGTATGGCGTGAGCCTGATCGCCTATTCGCAGGGAAAGGACTATCTG
CTGAAGGCGCTCCCCTGGCTCCTGGGGTCGCTCGGCACGATTGTGGAGGACGCCACGATATTCGTCCAGTTCCGG
CTCTACGCTGGCGGGCTCCGCACGGAAGCACTCGGCTGA
Transcript >Hirsu2|1905
ATGGCTTCCTTCACCGCCGCCGCCGCCGCCGGGCCGTTGCCTCTGGCCCAGGCCCTGTCGGGCATCTTTGGCAGC
ATCAGTCTGACGGCCTGGATCTGCCTGCTGCTCCCCCAGCTGTGGGCCAACTACAAGGCCAAGAGCGCCGACGGC
CTCAGCATCACCTTTCTCATTGTCTGGTCCTTGGGAGACGTGACAAATCTGTCAGGTGCCCTCCTGACAGACCTG
GCGCCGAGTGCCGTCGCCCTGGCCGTCTACTTCTGCATCCTGGACGTGACGCTCATCAGCCAGTGCCTGTACTAC
AACACCATCAATGCGCGCCGGAGAGCCGTGGCCGAGGCGAGCTCGGAGGACTCGCCGCTCCTCGCGCGGCGGCAG
AGCACCTCGTCCGGCCCGGACGGCGCCCGGGGGAGCCCGGCCGAGCACGAAGAGACGGCGGCGCGGCTTGCCCGC
AAGAATGCCGCGGCCGGCGACGAGGCCGCCATCGACGGCGGTTCGTGGAAACACAACGCCCTGAGCCTGTTGGCC
GTCTACGCCATCGGCTTCGCCGGCTGGTTCGTCTCCTACATGGCCGGCGCCTGGGGCAGCGAGACGCCCAAGGTC
CCCGACGCGGCGGACGAGAGGAGCCACTCGCGCGTCGTTGCCGGCCTCGTTCTCGGCTACGCCAGCGCGGCCTGT
TACCTCTGCGCTCGGATACCTCAGATTGTCAAGAACTACCGGGAGAAGTCTTGCGAAGGCCTGTCGCTTCTCTTC
TTCATGCTGTCTCTGACCGGCAACCTGACGTATGGCGTGAGCCTGATCGCCTATTCGCAGGGAAAGGACTATCTG
CTGAAGGCGCTCCCCTGGCTCCTGGGGTCGCTCGGCACGATTGTGGAGGACGCCACGATATTCGTCCAGTTCCGG
CTCTACGCTGGCGGGCTCCGCACGGAAGCACTCGGCTGA
Gene >Hirsu2|1905
ATGGCTTCCTTCACCGCCGCCGCCGCCGCCGGGCCGTTGCCTCTGGCCCAGGCCCTGTCGGGCATCTTTGGCAGC
ATCAGTCTGACGGCCTGGATCTGCCTGCTGGTCGGGCGGCCCCTGATCTCCTCCATATCTGTCCGAGTCGATCCC
TTACTGACTCTGTTTCGCAGCTCCCCCAGCTGTGGGCCAACTACAAGGCCAAGAGCGCCGACGGCCTCAGCATCA
CCTTTCTCATTGTCTGGTCCTTGGGAGACGTGACAAATCTGTCAGGTATGGCGTGCGCGTGTCCTCGTCGTTCGG
CTTCCCCCCTCTCCCACCCCGGCCGAGTCCTCAATGCCTTGGCTATCGCGCCCACGTGCATTACTCATGCCGGCG
GCAGCCTGGCACGGATCATCCAGGCTGTGCCAAAAAAAAAAAAAAATGCTGACCCCGGCGCAGGTGCCCTCCTGA
CAGACCTGGCGCCGAGTGCCGTCGCCCTGGCCGTCTACTTCTGCATCCTGGACGTGACGCTCATCAGCCAGTGCC
TGTACTACAACACCATCAATGCGCGCCGGAGAGCCGTGGCCGAGGCGAGCTCGGAGGACTCGCCGCTCCTCGCGC
GGCGGCAGAGCACCTCGTCCGGCCCGGACGGCGCCCGGGGGAGCCCGGCCGAGCACGAAGAGACGGCGGCGCGGC
TTGCCCGCAAGAATGCCGCGGCCGGCGACGAGGCCGCCATCGACGGCGGTTCGTGGAAACACAACGCCCTGAGCC
TGTTGGCCGTCTACGCCATCGGCTTCGCCGGCTGGTTCGTCTCCTACATGGCCGGCGCCTGGGGCAGCGAGACGC
CCAAGGTCCCCGACGCGGCGGACGAGAGGAGCCACTCGCGCGTCGTTGCCGGCCTCGTTCTCGGCTACGCCAGCG
CGGCCTGTTACCTCTGGTGCGCGTCCTCCTCCGCTTCCTAACGCGCGCGGCGGACTGACTGACGCGTCCCTTTGC
AGCGCTCGGATACCTCAGATTGTCAAGAACTACCGGGAGAAGTCTTGCGAAGGTGAGGCGCGCCGACGTGGGGGA
GCTTGGCGCCGTCGCGACACGCTGGTTCTGACGTGACTCGCAGGCCTGTCGCTTCTCTTCTTCATGCTGTCTCTG
ACCGGCAACCTGACGTATGGCGTGAGCCTGATCGCCTATTCGCAGGGAAAGGACTATCTGCTGAAGGCGCTCCCC
TGGCTCCTGGGGTCGCTCGGCACGATTGTGGAGGACGCCACGATATTCGTCCAGTTCCGGCTCTACGCTGGCGGG
CTCCGCACGGAAGCACTCGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail