Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1904
Gene name
LocationContig_1436:437..1023
Strand-
Gene length (bp)586
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain 1.4E-17 8 95

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P13663|DHAS_YEAST Aspartate-semialdehyde dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOM2 PE=1 SV=1 7 95 2.0E-30
sp|P78780|DHAS_SCHPO Probable aspartate-semialdehyde dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.06c PE=1 SV=2 7 95 7.0E-29
sp|Q57658|DHAS_METJA Aspartate-semialdehyde dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=asd PE=1 SV=1 8 92 4.0E-23
sp|O26890|DHAS_METTH Aspartate-semialdehyde dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=asd PE=3 SV=1 8 92 2.0E-19
sp|Q75FC8|DHAS_LEPIC Aspartate-semialdehyde dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=asd PE=3 SV=1 8 95 6.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P13663|DHAS_YEAST Aspartate-semialdehyde dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOM2 PE=1 SV=1 7 95 2.0E-30
sp|P78780|DHAS_SCHPO Probable aspartate-semialdehyde dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.06c PE=1 SV=2 7 95 7.0E-29
sp|Q57658|DHAS_METJA Aspartate-semialdehyde dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=asd PE=1 SV=1 8 92 4.0E-23
sp|O26890|DHAS_METTH Aspartate-semialdehyde dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=asd PE=3 SV=1 8 92 2.0E-19
sp|Q75FC8|DHAS_LEPIC Aspartate-semialdehyde dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=asd PE=3 SV=1 8 95 6.0E-17
sp|P41394|DHAS_LEPIN Aspartate-semialdehyde dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=asd PE=3 SV=2 8 95 9.0E-17
sp|O28766|DHAS_ARCFU Aspartate-semialdehyde dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=asd PE=3 SV=1 9 95 3.0E-14
sp|Q96YK1|MCR_SULTO Malonyl-CoA reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=mcr PE=1 SV=1 6 95 3.0E-11
sp|A4YEN2|MCR_METS5 Malonyl CoA reductase (NADP) OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_0709 PE=1 SV=1 6 95 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Yes
GO:0036094 small molecule binding No
GO:0016491 oxidoreductase activity No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1904
MAQHPTKKCGVLGCTGSVGQRFILLLAQHPFLELQAVGASARSAGKPYREAVRWKQARPMGDAVADMVVRECRAA
EFGDCDVVFSGLDSDVAGDIGSTTGATRWCRWWCRPSTWRTWA*
Coding >Hirsu2|1904
ATGGCCCAACACCCCACCAAGAAATGCGGGGTGCTCGGCTGCACCGGGTCCGTCGGGCAGCGCTTCATCCTGCTG
CTGGCGCAGCACCCGTTCCTGGAGCTGCAGGCGGTGGGCGCGTCGGCGCGGTCGGCCGGCAAGCCGTACCGCGAG
GCGGTGCGGTGGAAGCAGGCGCGGCCGATGGGCGACGCGGTCGCGGACATGGTGGTGCGCGAGTGCCGGGCGGCC
GAGTTTGGCGACTGCGACGTCGTCTTCAGCGGGCTCGACTCGGACGTGGCCGGCGACATCGGTTCAACCACCGGC
GCGACCCGCTGGTGCCGCTGGTGGTGCCGACCGTCAACCTGGCGCACCTGGGCCTGA
Transcript >Hirsu2|1904
ATGGCCCAACACCCCACCAAGAAATGCGGGGTGCTCGGCTGCACCGGGTCCGTCGGGCAGCGCTTCATCCTGCTG
CTGGCGCAGCACCCGTTCCTGGAGCTGCAGGCGGTGGGCGCGTCGGCGCGGTCGGCCGGCAAGCCGTACCGCGAG
GCGGTGCGGTGGAAGCAGGCGCGGCCGATGGGCGACGCGGTCGCGGACATGGTGGTGCGCGAGTGCCGGGCGGCC
GAGTTTGGCGACTGCGACGTCGTCTTCAGCGGGCTCGACTCGGACGTGGCCGGCGACATCGGTTCAACCACCGGC
GCGACCCGCTGGTGCCGCTGGTGGTGCCGACCGTCAACCTGGCGCACCTGGGCCTGA
Gene >Hirsu2|1904
ATGGCCCAACACCCCACCAAGAAATGCGGTAGGTCGTCTCCGAGAGACCGCTCCGTCCCCGTCCCTCCGCCTCTC
TCGTCCCCGGCTGACGGCGGGATCCGGGCAGGGGTGCTCGGCTGCACCGGGTCCGTCGGGCAGCGCTTCATCCTG
CTGCTGGCGCAGCACCCGTTCCTGGAGCTGCAGGCGGTGGGCGCGTCGGCGCGGTCGGCCGGCAAGCCGTACCGC
GAGGCGGTGCGGTGGAAGCAGGCGCGGCCGATGGGCGACGCGGTCGCGGACATGGTGGTGCGCGAGTGCCGGGCG
GCCGAGTTTGGCGACTGCGACGTCGTCTTCAGCGGGCTCGACTCGGACGTGGCCGGCGACATCGGTTCGTGCGCC
CTCCCGTCGTTCTCTCTCGTTAACGCCGCTTTTTCTTTCATCGTGTATGTGTGTGTGTGTGTGTGGCTGACGACG
ATGATGATGGGACGGCTTCCAGAACTGGAGTTCCTCCAGGCTGAGATACCCGTCTTCTCCAACGCCAAGAACCAC
CGGCGCGACCCGCTGGTGCCGCTGGTGGTGCCGACCGTCAACCTGGCGCACCTGGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail