Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1899
Gene name
LocationContig_1433:2776..4390
Strand+
Gene length (bp)1614
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00344 SecY SecY translocase 3.8E-71 76 457
PF10559 Plug_translocon Plug domain of Sec61p 9.5E-16 41 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870W0|SC61A_NEUCR Protein transport protein SEC61 subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec-61 PE=3 SV=1 1 476 0.0E+00
sp|P78979|SC61A_YARLI Protein transport protein SEC61 subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC61 PE=3 SV=2 1 465 0.0E+00
sp|Q96TW8|SC61A_WICAO Protein transport protein SEC61 subunit alpha OS=Wickerhamomyces anomalus GN=SEC61 PE=3 SV=1 1 465 0.0E+00
sp|Q9P8E3|SC61A_CANAL Protein transport protein SEC61 subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC61 PE=3 SV=2 1 465 0.0E+00
sp|Q6BN08|SC61A_DEBHA Protein transport protein SEC61 subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC61 PE=3 SV=1 1 465 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870W0|SC61A_NEUCR Protein transport protein SEC61 subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec-61 PE=3 SV=1 1 476 0.0E+00
sp|P78979|SC61A_YARLI Protein transport protein SEC61 subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC61 PE=3 SV=2 1 465 0.0E+00
sp|Q96TW8|SC61A_WICAO Protein transport protein SEC61 subunit alpha OS=Wickerhamomyces anomalus GN=SEC61 PE=3 SV=1 1 465 0.0E+00
sp|Q9P8E3|SC61A_CANAL Protein transport protein SEC61 subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC61 PE=3 SV=2 1 465 0.0E+00
sp|Q6BN08|SC61A_DEBHA Protein transport protein SEC61 subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC61 PE=3 SV=1 1 465 0.0E+00
sp|Q6CPY9|SC61A_KLULA Protein transport protein SEC61 subunit alpha OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC61 PE=3 SV=1 5 476 0.0E+00
sp|Q54XK2|SC61A_DICDI Protein transport protein Sec61 subunit alpha OS=Dictyostelium discoideum GN=sec61a PE=3 SV=1 4 469 0.0E+00
sp|Q752H7|SC61A_ASHGO Protein transport protein SEC61 subunit alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC61 PE=3 SV=1 5 476 0.0E+00
sp|P61621|S61A1_RAT Protein transport protein Sec61 subunit alpha isoform 1 OS=Rattus norvegicus GN=Sec61a1 PE=2 SV=2 3 475 0.0E+00
sp|Q5R5L5|S61A1_PONAB Protein transport protein Sec61 subunit alpha isoform 1 OS=Pongo abelii GN=SEC61A1 PE=2 SV=3 3 475 0.0E+00
sp|P61620|S61A1_MOUSE Protein transport protein Sec61 subunit alpha isoform 1 OS=Mus musculus GN=Sec61a1 PE=1 SV=2 3 475 0.0E+00
sp|P61619|S61A1_HUMAN Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens GN=SEC61A1 PE=1 SV=2 3 475 0.0E+00
sp|Q6FRY3|SC61A_CANGA Protein transport protein SEC61 subunit alpha OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC61 PE=3 SV=1 3 476 0.0E+00
sp|Q90ZM2|S61A1_DANRE Protein transport protein Sec61 subunit alpha-like 1 OS=Danio rerio GN=sec61al1 PE=2 SV=3 3 475 0.0E+00
sp|Q90YL4|S61A2_DANRE Protein transport protein Sec61 subunit alpha-like 2 OS=Danio rerio GN=sec61al2 PE=2 SV=3 3 475 0.0E+00
sp|P38377|S61A1_CANLF Protein transport protein Sec61 subunit alpha isoform 1 OS=Canis lupus familiaris GN=SEC61A1 PE=1 SV=3 3 475 0.0E+00
sp|Q7T278|SC61A_HARAN Protein transport protein Sec61 subunit alpha OS=Harpagifer antarcticus GN=sec61a PE=2 SV=3 4 475 0.0E+00
sp|Q7T277|SC61A_DISMA Protein transport protein Sec61 subunit alpha OS=Dissostichus mawsoni GN=sec61a PE=2 SV=3 4 475 0.0E+00
sp|Q8AY36|SC61A_PAGBO Protein transport protein Sec61 subunit alpha OS=Pagothenia borchgrevinki GN=sec61a PE=2 SV=3 4 475 0.0E+00
sp|Q8AY35|SC61A_NOTAN Protein transport protein Sec61 subunit alpha OS=Notothenia angustata GN=sec61a PE=2 SV=3 4 475 0.0E+00
sp|Q98SN8|S61A2_ONCMY Protein transport protein Sec61 subunit alpha isoform B OS=Oncorhynchus mykiss GN=sec61ab PE=2 SV=3 4 475 0.0E+00
sp|Q8AY31|SC61A_BOVVA Protein transport protein Sec61 subunit alpha OS=Bovichtus variegatus GN=sec61a PE=2 SV=3 4 475 0.0E+00
sp|Q5EA68|S61A1_BOVIN Protein transport protein Sec61 subunit alpha isoform 1 OS=Bos taurus GN=SEC61A1 PE=2 SV=3 4 475 0.0E+00
sp|P32915|SC61A_YEAST Protein transport protein SEC61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC61 PE=1 SV=1 1 468 0.0E+00
sp|Q9JLR1|S61A2_MOUSE Protein transport protein Sec61 subunit alpha isoform 2 OS=Mus musculus GN=Sec61a2 PE=2 SV=3 4 473 0.0E+00
sp|Q9H9S3|S61A2_HUMAN Protein transport protein Sec61 subunit alpha isoform 2 OS=Homo sapiens GN=SEC61A2 PE=2 SV=3 4 473 0.0E+00
sp|Q2KHX4|S61A2_BOVIN Protein transport protein Sec61 subunit alpha isoform 2 OS=Bos taurus GN=SEC61A2 PE=2 SV=3 4 473 0.0E+00
sp|Q8AY32|SC61A_GADOC Protein transport protein Sec61 subunit alpha OS=Gadus ogac GN=sec61a PE=2 SV=3 4 475 0.0E+00
sp|Q98SN9|S61A1_ONCMY Protein transport protein Sec61 subunit alpha isoform A OS=Oncorhynchus mykiss GN=sec61aa PE=2 SV=3 4 475 0.0E+00
sp|Q8AY34|SC61A_HEMAM Protein transport protein Sec61 subunit alpha OS=Hemitripterus americanus GN=sec61a PE=2 SV=3 4 475 0.0E+00
sp|Q5NVM7|S61A2_PONAB Protein transport protein Sec61 subunit alpha isoform 2 OS=Pongo abelii GN=SEC61A2 PE=2 SV=1 4 473 0.0E+00
sp|Q8AY33|SC61A_BORSA Protein transport protein Sec61 subunit alpha OS=Boreogadus saida GN=sec61a PE=2 SV=3 4 473 0.0E+00
sp|Q25147|SC61A_HALRO Protein transport protein Sec61 subunit alpha OS=Halocynthia roretzi PE=2 SV=1 4 470 0.0E+00
sp|P79088|SC61A_SCHPO Protein transport protein sec61 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec61 PE=2 SV=1 1 470 0.0E+00
sp|P38379|SC61A_PYRSA Protein transport protein Sec61 subunit alpha OS=Pyrenomonas salina PE=2 SV=1 2 459 0.0E+00
sp|O42965|YGMH_SCHPO Uncharacterized protein C19G7.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19G7.17 PE=4 SV=2 1 460 2.0E-89
sp|Q8U019|SECY_PYRFU Protein translocase subunit SecY OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=secY PE=1 SV=1 8 464 2.0E-85
sp|Q9V1V8|SECY_PYRAB Protein translocase subunit SecY OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=secY PE=3 SV=1 8 464 3.0E-82
sp|O59442|SECY_PYRHO Protein translocase subunit SecY OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=secY PE=3 SV=1 8 464 5.0E-81
sp|P38353|SSH1_YEAST Sec sixty-one protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSH1 PE=1 SV=1 1 469 1.0E-77
sp|O26134|SECY_METTH Protein translocase subunit SecY OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=secY PE=3 SV=1 11 464 3.0E-77
sp|Q60175|SECY_METJA Protein translocase subunit SecY OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=secY PE=1 SV=2 12 464 3.0E-76
sp|P28541|SECY_METVA Protein translocase subunit SecY OS=Methanococcus vannielii GN=secY PE=3 SV=1 10 464 9.0E-71
sp|Q9YDD0|SECY_AERPE Protein translocase subunit SecY OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=secY PE=3 SV=2 18 468 4.0E-66
sp|Q9UX84|SECY_SULSO Protein translocase subunit SecY OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=secY PE=3 SV=1 4 467 1.0E-65
sp|O28377|SECY_ARCFU Protein translocase subunit SecY OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=secY PE=3 SV=1 10 464 4.0E-65
sp|P49978|SECY_SULAC Protein translocase subunit SecY OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=secY PE=3 SV=1 6 467 7.0E-64
sp|P28542|SECY_HALMA Protein translocase subunit SecY OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=secY PE=3 SV=2 8 464 5.0E-56
sp|Q9HPB1|SECY_HALSA Protein translocase subunit SecY OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=secY PE=3 SV=1 8 464 3.0E-54
sp|Q977V3|SECY_HALVD Protein translocase subunit SecY OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=secY PE=3 SV=2 8 464 4.0E-53
[Show less]

GO

GO Term Description Terminal node
GO:0015031 protein transport Yes
GO:0016020 membrane Yes
GO:0008104 protein localization No
GO:0042886 amide transport No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0071705 nitrogen compound transport No
GO:0006810 transport No
GO:0015833 peptide transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0045184 establishment of protein localization No
GO:0033036 macromolecule localization No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 76 98 22
3 119 141 22
4 145 167 22
5 174 195 21
6 241 263 22
7 416 435 19
8 439 461 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1899
MSSLRFLDLVKPFVPFLPEVQQPETKIPFNQKMMWTALTLLIFLVMSQMPLYGIVSSDNSDPLYWLRMVIASNRG
TLMELGITPIISSGMVFQLLAGTHMIDVNLDLKSDRELYQTAQKLFAFILSAGTATVYVFTGLYGPPSDLGAGIV
FLLILQLVVAGMIVILLDELLQKGYGLGSGISLFIATNICESIMWKAFSPTTINTGRGPEFEGAVIALFHLLMTW
PNKQRALQEAFYRQNLPNIMNLLATIVVFVAVIYLQGFRVEIPVKSSRQRGARGSYPVRLFYTSNMPIMLQSALS
SNVFLISQMLYSRFSENLLVRLFGVWDAKDGSSQLHAISGLAYYMSPPLNFKESLLDPIHTVAYIAYMLGACALF
SKTWIEVSGSSPRDVAKQLKDQGLVMAGHRDQSMYKELKRIIPTAAAFGGACIGALSVASDLMGALGSGTGTLLA
VTIIYGYFEIAAKEGDLSGMKGMIMG*
Coding >Hirsu2|1899
ATGAGTTCCCTACGCTTCCTCGACCTCGTCAAGCCCTTCGTGCCGTTCCTCCCCGAGGTCCAGCAGCCAGAGACC
AAGATTCCCTTCAACCAGAAGATGATGTGGACGGCCCTGACGCTGCTCATCTTCCTCGTCATGAGCCAGATGCCC
CTCTACGGCATCGTGTCGTCCGACAACTCGGACCCGCTCTACTGGTTGCGCATGGTGATAGCCAGTAACCGCGGC
ACGCTCATGGAGTTGGGCATCACCCCCATCATCTCGTCCGGCATGGTCTTCCAGCTGCTCGCCGGCACCCACATG
ATCGACGTCAACCTCGACCTCAAGTCGGACCGCGAGCTCTACCAGACGGCCCAGAAGCTGTTCGCCTTCATCCTC
TCGGCCGGCACCGCCACCGTCTACGTCTTCACCGGCCTCTACGGCCCGCCCTCGGACCTTGGCGCCGGCATCGTC
TTCCTCCTCATCCTGCAGCTCGTCGTCGCCGGCATGATCGTCATCCTGCTCGACGAGCTGCTGCAGAAGGGCTAC
GGCCTCGGCAGCGGCATCTCGCTCTTCATCGCCACCAACATCTGCGAGTCCATCATGTGGAAGGCCTTCTCGCCC
ACCACCATCAACACCGGCCGCGGCCCCGAGTTCGAGGGCGCCGTCATCGCCCTCTTCCACCTGCTCATGACCTGG
CCCAACAAACAGCGCGCCCTGCAGGAGGCCTTCTACAGGCAGAACCTGCCCAACATCATGAACCTGCTCGCCACC
ATCGTCGTCTTCGTCGCCGTCATCTACCTGCAGGGCTTCCGCGTCGAGATCCCGGTCAAGTCGTCGCGCCAGCGC
GGCGCCCGCGGCTCCTACCCCGTCCGCCTCTTCTACACCTCCAACATGCCCATCATGCTGCAGTCTGCCCTGTCG
TCCAACGTCTTCCTCATCAGCCAGATGCTCTACTCGCGCTTCTCCGAGAACCTCCTGGTCCGCCTCTTCGGCGTC
TGGGATGCCAAGGACGGCTCCTCGCAGCTGCACGCCATCTCGGGCCTCGCCTACTACATGTCGCCCCCGCTCAAC
TTCAAGGAGTCGCTCCTCGACCCCATCCACACCGTCGCCTACATCGCCTACATGCTCGGTGCCTGCGCCCTCTTC
TCCAAGACCTGGATCGAGGTGTCGGGATCGAGCCCGCGCGACGTCGCCAAGCAGCTCAAGGATCAGGGCCTCGTC
ATGGCCGGCCACCGCGACCAGAGCATGTACAAGGAACTCAAGCGCATCATCCCCACCGCCGCCGCCTTCGGCGGT
GCCTGCATCGGCGCCCTCTCCGTCGCCAGCGACCTCATGGGCGCCCTGGGCTCCGGCACCGGTACTCTCCTCGCC
GTCACTATCATCTACGGTTACTTCGAAATTGCCGCCAAGGAGGGAGATCTGTCCGGCATGAAGGGCATGATCATG
GGCTAG
Transcript >Hirsu2|1899
ATGAGTTCCCTACGCTTCCTCGACCTCGTCAAGCCCTTCGTGCCGTTCCTCCCCGAGGTCCAGCAGCCAGAGACC
AAGATTCCCTTCAACCAGAAGATGATGTGGACGGCCCTGACGCTGCTCATCTTCCTCGTCATGAGCCAGATGCCC
CTCTACGGCATCGTGTCGTCCGACAACTCGGACCCGCTCTACTGGTTGCGCATGGTGATAGCCAGTAACCGCGGC
ACGCTCATGGAGTTGGGCATCACCCCCATCATCTCGTCCGGCATGGTCTTCCAGCTGCTCGCCGGCACCCACATG
ATCGACGTCAACCTCGACCTCAAGTCGGACCGCGAGCTCTACCAGACGGCCCAGAAGCTGTTCGCCTTCATCCTC
TCGGCCGGCACCGCCACCGTCTACGTCTTCACCGGCCTCTACGGCCCGCCCTCGGACCTTGGCGCCGGCATCGTC
TTCCTCCTCATCCTGCAGCTCGTCGTCGCCGGCATGATCGTCATCCTGCTCGACGAGCTGCTGCAGAAGGGCTAC
GGCCTCGGCAGCGGCATCTCGCTCTTCATCGCCACCAACATCTGCGAGTCCATCATGTGGAAGGCCTTCTCGCCC
ACCACCATCAACACCGGCCGCGGCCCCGAGTTCGAGGGCGCCGTCATCGCCCTCTTCCACCTGCTCATGACCTGG
CCCAACAAACAGCGCGCCCTGCAGGAGGCCTTCTACAGGCAGAACCTGCCCAACATCATGAACCTGCTCGCCACC
ATCGTCGTCTTCGTCGCCGTCATCTACCTGCAGGGCTTCCGCGTCGAGATCCCGGTCAAGTCGTCGCGCCAGCGC
GGCGCCCGCGGCTCCTACCCCGTCCGCCTCTTCTACACCTCCAACATGCCCATCATGCTGCAGTCTGCCCTGTCG
TCCAACGTCTTCCTCATCAGCCAGATGCTCTACTCGCGCTTCTCCGAGAACCTCCTGGTCCGCCTCTTCGGCGTC
TGGGATGCCAAGGACGGCTCCTCGCAGCTGCACGCCATCTCGGGCCTCGCCTACTACATGTCGCCCCCGCTCAAC
TTCAAGGAGTCGCTCCTCGACCCCATCCACACCGTCGCCTACATCGCCTACATGCTCGGTGCCTGCGCCCTCTTC
TCCAAGACCTGGATCGAGGTGTCGGGATCGAGCCCGCGCGACGTCGCCAAGCAGCTCAAGGATCAGGGCCTCGTC
ATGGCCGGCCACCGCGACCAGAGCATGTACAAGGAACTCAAGCGCATCATCCCCACCGCCGCCGCCTTCGGCGGT
GCCTGCATCGGCGCCCTCTCCGTCGCCAGCGACCTCATGGGCGCCCTGGGCTCCGGCACCGGTACTCTCCTCGCC
GTCACTATCATCTACGGTTACTTCGAAATTGCCGCCAAGGAGGGAGATCTGTCCGGCATGAAGGGCATGATCATG
GGCTAG
Gene >Hirsu2|1899
ATGAGTTCCCGTGAGTCTCTGCCCCCTCGCGCGTGCCTGCGACGGCGAAAATGCTGACGAGCCGGGCGCCCGCCA
GTACGCTTCCTCGACCTCGTCAAGCCCTTCGTGCCGTTCCTCCCCGAGGTCCAGCAGCCAGAGACCAAGATTCCC
TTCAACCAGAAGATGATGTGGACGGCCCTGACGCTGCTCATCTTCCTCGTCATGAGCCAGATGCCCCTCTACGGC
ATCGTGTCGTCCGACAACTCGGACCCGCTCTACTGGTTGCGCATGGTGATAGCCAGTAACCGCGGCACGCTCATG
GAGTTGGGCATCACCCCCATCATCTCGTCCGGCATGGTCTTCCAGCTGCTCGCCGGCACCCACATGATCGACGTC
AACCTCGACCTCAAGTCGGACCGCGAGCTCTACCAGACGGCCCAGAAGCTGTTCGCCTTCATCCTCTCGGCCGGC
ACCGCCACCGTCTACGTCTTCACCGGCCTCTACGGCCCGCCCTCGGACCTTGGCGCCGGCATCGTCTTCCTCCTC
ATCCTGCAGCTCGTCGTCGCCGGCATGATCGTCATCCTGCTCGACGAGCTGCTGCAGAAGGGCTACGGCCTCGGC
AGCGGCATCTCGCTCTTCATCGCCACCAACATCTGCGAGTCCATCATGTGGAAGGCCTTCTCGCCCACCACCATC
AACACCGGCCGCGGCCCCGAGTTCGAGGGCGCCGTCATCGCCCTCTTCCACCTGCTCATGACCTGGCCCAACAAA
CAGCGCGCCCTGCAGGAGGCCTTCTACAGGCAGAACCTGCCCAACATCATGAACCTGCTCGCCACCATCGTCGTC
TTCGTCGCCGTCATCTACCTGCAGGGCTTCCGCGTCGAGATCCCGGTCAAGTCGTCGCGCCAGCGCGGCGCCCGC
GGCTCCTACCCCGTCCGCCTCTTCTACACCTCCAACATGCCCATCATGCTGCAGTCTGCCCTGTCGTCCAACGTC
TTCCTCATCAGCCAGATGCTCTACTCGCGCTTCTCCGAGAACCTCCTGGTCCGCCTCTTCGGCGTCTGGGATGCC
AAGGACGGCTCCTCGCAGCTGCACGCCATCTCGGGCCTCGCCTACTACATGTCGCCCCCGCTCAACTTCAAGGAG
TCGCTCCTCGACCCCATCCACACCGTCGCCTACATCGCCTACATGCTCGGTGCCTGCGCCCTCTTCTCCAAGACC
TGGATCGAGGTGTCGGGATCGAGCCCGCGCGACGTCGCCAAGCAGCTCAAGGATCAGGGCCTCGTCATGGCCGGC
CACCGCGACCAGAGCATGTACAAGGAACTCAAGCGCATCATCCCCACCGCCGCCGCCTTCGGCGGTGCCTGCATC
GGCGCCCTCTCCGTCGCCAGCGACCTCATGGGCGCCCTGGGCTCCGGCACCGGTACTCTCCTCGCCGTCACGTGA
GTCATTACTGACGTTTTTATTTTTTTTAACTTCTGCCCCCCTTGCCCTTTTGATTGCGGACAATCTGTTCGCTCA
ATGCGGCTCCTCGTTGCTGACTTGAACAAACTCGACAGTATCATCTACGGTTACTTCGAAATTGCCGCCAAGGAG
GGAGATCTGTCCGGCATGAAGGGCATGATCATGGGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail