Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1891
Gene name
LocationContig_143:30124..31345
Strand-
Gene length (bp)1221
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08242 Methyltransf_12 Methyltransferase domain 1.0E-13 136 238
PF13649 Methyltransf_25 Methyltransferase domain 1.3E-12 135 237
PF13489 Methyltransf_23 Methyltransferase domain 5.1E-11 127 285
PF08241 Methyltransf_11 Methyltransferase domain 6.6E-09 136 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08641|AB140_YEAST tRNA(Thr) (cytosine(32)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP140 PE=1 SV=3 22 331 6.0E-108
sp|Q9P7L6|METL_SCHPO Uncharacterized methyltransferase-like protein SPBC21C3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.07c PE=3 SV=2 39 333 9.0E-102
sp|Q86BS6|METL_DROME Methyltransferase-like protein OS=Drosophila melanogaster GN=metl PE=1 SV=2 32 333 5.0E-80
sp|A8KBL7|MEL2A_DANRE Methyltransferase-like protein 2-A OS=Danio rerio GN=mettl2a PE=2 SV=1 1 334 6.0E-75
sp|Q5M8E6|METL2_XENTR Methyltransferase-like protein 2 OS=Xenopus tropicalis GN=mettl2 PE=2 SV=1 38 333 5.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08641|AB140_YEAST tRNA(Thr) (cytosine(32)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP140 PE=1 SV=3 22 331 6.0E-108
sp|Q9P7L6|METL_SCHPO Uncharacterized methyltransferase-like protein SPBC21C3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.07c PE=3 SV=2 39 333 9.0E-102
sp|Q86BS6|METL_DROME Methyltransferase-like protein OS=Drosophila melanogaster GN=metl PE=1 SV=2 32 333 5.0E-80
sp|A8KBL7|MEL2A_DANRE Methyltransferase-like protein 2-A OS=Danio rerio GN=mettl2a PE=2 SV=1 1 334 6.0E-75
sp|Q5M8E6|METL2_XENTR Methyltransferase-like protein 2 OS=Xenopus tropicalis GN=mettl2 PE=2 SV=1 38 333 5.0E-68
sp|Q6P1Q9|MET2B_HUMAN Methyltransferase-like protein 2B OS=Homo sapiens GN=METTL2B PE=1 SV=3 38 333 8.0E-65
sp|Q96IZ6|MET2A_HUMAN Methyltransferase-like protein 2A OS=Homo sapiens GN=METTL2A PE=1 SV=5 38 333 5.0E-64
sp|Q8BMK1|METL2_MOUSE Methyltransferase-like protein 2 OS=Mus musculus GN=Mettl2 PE=2 SV=2 38 333 2.0E-60
sp|Q0P5B2|METL2_BOVIN Methyltransferase-like protein 2 OS=Bos taurus GN=METTL2 PE=2 SV=1 135 333 2.0E-55
sp|Q5ZHP8|METL2_CHICK Methyltransferase-like protein 2 OS=Gallus gallus GN=METTL2 PE=2 SV=1 135 333 2.0E-53
sp|Q6AXU8|METL6_RAT Methyltransferase-like protein 6 OS=Rattus norvegicus GN=Mettl6 PE=2 SV=1 78 333 1.0E-49
sp|Q8BVH9|METL6_MOUSE Methyltransferase-like protein 6 OS=Mus musculus GN=Mettl6 PE=2 SV=2 78 333 4.0E-49
sp|Q8TCB7|METL6_HUMAN Methyltransferase-like protein 6 OS=Homo sapiens GN=METTL6 PE=2 SV=2 69 333 2.0E-47
sp|Q5RDV8|METL6_PONAB Methyltransferase-like protein 6 OS=Pongo abelii GN=METTL6 PE=2 SV=1 69 333 3.0E-47
sp|Q8T199|OMT3_DICDI O-methyltransferase 3 OS=Dictyostelium discoideum GN=omt3 PE=2 SV=1 98 333 1.0E-39
sp|O74386|YNVB_SCHPO Uncharacterized methyltransferase C3H7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.11 PE=3 SV=1 75 334 2.0E-36
sp|A2AUU0|METL8_MOUSE Methyltransferase-like protein 8 OS=Mus musculus GN=Mettl8 PE=1 SV=2 39 145 2.0E-13
sp|Q9H825|METL8_HUMAN Methyltransferase-like protein 8 OS=Homo sapiens GN=METTL8 PE=2 SV=2 135 219 5.0E-12
sp|Q0P5B2|METL2_BOVIN Methyltransferase-like protein 2 OS=Bos taurus GN=METTL2 PE=2 SV=1 38 123 5.0E-11
sp|Q9H825|METL8_HUMAN Methyltransferase-like protein 8 OS=Homo sapiens GN=METTL8 PE=2 SV=2 39 125 7.0E-09
sp|Q5ZHP8|METL2_CHICK Methyltransferase-like protein 2 OS=Gallus gallus GN=METTL2 PE=2 SV=1 27 123 5.0E-08
sp|A2AUU0|METL8_MOUSE Methyltransferase-like protein 8 OS=Mus musculus GN=Mettl8 PE=1 SV=2 135 196 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1891
MAALEMKSLDEVPSDAAEVPAHRSHDPANNLKRSDPFQFGSRYLTEEDDVFEFNAWDHVETDDTYKEYAERQFEM
QRQAPVSDFDKNRFNTDPAKWWNLFYKNNASNFFKNRKWLQQEFPVLAEVTKEDHGPAVVLEIGAGAGNTAFPVL
ANNSNPHLRMHACDFSKIAVDVMRNHEAYDPKYIQADVWDVSGDSLPPGLEESSVDVAVMVFIFSALSPREWTKA
VENVHKLLKPGGLVCFRDYGRGDLAQVRFRKGRYLEENFYIRGDGTRVYFFDRDQLAGIWSGVDAANGDAAETRK
FETESLGIDRRLLVNRAKKIKMYRCWIQGRFRKI*
Coding >Hirsu2|1891
ATGGCCGCCCTCGAGATGAAAAGCCTGGACGAGGTGCCCTCAGACGCTGCAGAGGTGCCGGCTCACAGATCTCAC
GATCCCGCGAACAATTTGAAGCGGAGCGATCCGTTCCAATTTGGGAGCCGCTATCTCACCGAGGAAGATGACGTC
TTCGAGTTCAATGCCTGGGACCACGTCGAAACGGACGACACGTACAAGGAGTACGCGGAGCGCCAGTTTGAGATG
CAGCGCCAGGCTCCCGTGTCTGATTTCGACAAGAACAGGTTCAACACAGACCCTGCGAAGTGGTGGAATTTGTTC
TACAAGAACAATGCCTCAAATTTCTTTAAGAATCGAAAATGGCTGCAGCAGGAGTTTCCAGTCCTGGCTGAGGTG
ACCAAGGAAGATCACGGGCCTGCTGTGGTGTTGGAGATCGGTGCTGGCGCCGGCAACACGGCGTTTCCAGTGCTG
GCCAACAACAGTAACCCGCACTTGAGGATGCACGCCTGCGACTTCTCCAAAATCGCCGTAGATGTCATGCGGAAC
CATGAAGCGTACGATCCCAAGTATATCCAAGCCGACGTGTGGGACGTCTCGGGAGACTCTCTGCCCCCCGGGCTG
GAGGAAAGCTCTGTAGATGTTGCCGTCATGGTCTTCATATTCTCTGCGTTGTCGCCTCGAGAGTGGACCAAGGCC
GTCGAGAATGTGCACAAGCTTCTCAAGCCAGGTGGCCTGGTCTGCTTCCGTGACTATGGGAGAGGAGACCTAGCG
CAAGTCCGTTTTCGCAAGGGACGGTATCTGGAGGAGAACTTCTACATTCGGGGCGACGGCACCCGCGTCTACTTC
TTCGACCGGGACCAGCTGGCTGGCATTTGGTCCGGAGTGGATGCTGCCAATGGCGACGCCGCCGAGACGCGCAAG
TTTGAGACTGAGAGCCTAGGCATTGACCGACGGCTTCTCGTCAACCGGGCCAAGAAGATTAAGATGTACCGCTGC
TGGATACAAGGGCGTTTTAGAAAGATATAG
Transcript >Hirsu2|1891
ATGGCCGCCCTCGAGATGAAAAGCCTGGACGAGGTGCCCTCAGACGCTGCAGAGGTGCCGGCTCACAGATCTCAC
GATCCCGCGAACAATTTGAAGCGGAGCGATCCGTTCCAATTTGGGAGCCGCTATCTCACCGAGGAAGATGACGTC
TTCGAGTTCAATGCCTGGGACCACGTCGAAACGGACGACACGTACAAGGAGTACGCGGAGCGCCAGTTTGAGATG
CAGCGCCAGGCTCCCGTGTCTGATTTCGACAAGAACAGGTTCAACACAGACCCTGCGAAGTGGTGGAATTTGTTC
TACAAGAACAATGCCTCAAATTTCTTTAAGAATCGAAAATGGCTGCAGCAGGAGTTTCCAGTCCTGGCTGAGGTG
ACCAAGGAAGATCACGGGCCTGCTGTGGTGTTGGAGATCGGTGCTGGCGCCGGCAACACGGCGTTTCCAGTGCTG
GCCAACAACAGTAACCCGCACTTGAGGATGCACGCCTGCGACTTCTCCAAAATCGCCGTAGATGTCATGCGGAAC
CATGAAGCGTACGATCCCAAGTATATCCAAGCCGACGTGTGGGACGTCTCGGGAGACTCTCTGCCCCCCGGGCTG
GAGGAAAGCTCTGTAGATGTTGCCGTCATGGTCTTCATATTCTCTGCGTTGTCGCCTCGAGAGTGGACCAAGGCC
GTCGAGAATGTGCACAAGCTTCTCAAGCCAGGTGGCCTGGTCTGCTTCCGTGACTATGGGAGAGGAGACCTAGCG
CAAGTCCGTTTTCGCAAGGGACGGTATCTGGAGGAGAACTTCTACATTCGGGGCGACGGCACCCGCGTCTACTTC
TTCGACCGGGACCAGCTGGCTGGCATTTGGTCCGGAGTGGATGCTGCCAATGGCGACGCCGCCGAGACGCGCAAG
TTTGAGACTGAGAGCCTAGGCATTGACCGACGGCTTCTCGTCAACCGGGCCAAGAAGATTAAGATGTACCGCTGC
TGGATACAAGGGCGTTTTAGAAAGATATAG
Gene >Hirsu2|1891
ATGGCCGCCCTCGAGATGAAAAGCCTGGACGAGGTGCCCTCAGACGCTGCAGAGGTGCCGGCTCACAGATCTCAC
GATCCCGCGAACAATTTGAAGCGGAGCGATCCGTTCCAATTTGGGAGCCGCTATCTCACCGAGGAAGATGACGTC
TTCGAGTTCAATGCCTGGGACCACGTCGAAACGGACGACACGTACAAGGAGTACGCGGAGCGCCAGTTTGAGATG
CAGCGCCAGGCTCCCGTGTCTGATTTCGACAAGAGTAAGCGAGCCTCTCTACATACCGTTCTGCCTCACATTCCA
GCGGCGCCGCCATGTCATGATGATTACCCTTCCAAATGCATAGTTCATCTGAATTTTCATGATGAAAACCATACC
TTCACAAGTCTTTCGCTCCCATCTGATCAAAGTTCTCTTGCCTATCGCTTTACTGTCAGCCACCTGTTTGTGCAA
CGAGAAGCTAACGCGCAAAACAAAGACAGGTTCAACACAGACCCTGCGAAGTGGTGGAATTTGTTCTACAAGAAC
AATGCCTCAAATTTCTTTAAGAATCGAAAATGGCTGCAGCAGGAGTTTCCAGTCCTGGCTGAGGTGACCAAGGAA
GATCACGGGCCTGCTGTGGTGTTGGAGATCGGTGCTGGCGCCGGCAACACGGCGTTTCCAGTGCTGGCCAACAAC
AGTAACCCGCACTTGAGGATGCACGCCTGCGACTTCTCCAAAATCGCCGTAGATGTCATGCGGAACCATGAAGCG
TACGATCCCAAGTATATCCAAGCCGACGTGTGGGACGTCTCGGGAGACTCTCTGCCCCCCGGGCTGGAGGAAAGC
TCTGTAGATGTTGCCGTCATGGTCTTCATATTCTCTGCGTTGTCGCCTCGAGAGTGGACCAAGGCCGTCGAGAAT
GTGCACAAGCTTCTCAAGCCAGGTGGCCTGGTCTGCTTCCGTGACTATGGGAGAGGAGACCTAGCGCAAGTCCGT
TTTCGCAAGGGACGGTATCTGGAGGAGAACTTCTACATTCGGGGCGACGGCACCCGCGTCTACTTCTTCGACCGG
GACCAGCTGGCTGGCATTTGGTCCGGAGTGGATGCTGCCAATGGCGACGCCGCCGAGACGCGCAAGTTTGAGACT
GAGAGCCTAGGCATTGACCGACGGCTTCTCGTCAACCGGGCCAAGAAGATTAAGATGTACCGCTGCTGGATACAA
GGGCGTTTTAGAAAGATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail