Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1890
Gene name
LocationContig_143:28883..30012
Strand+
Gene length (bp)1129
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13350 Y_phosphatase3 Tyrosine phosphatase family 5.6E-44 6 290

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q05918|IPHP_NOSCO Tyrosine-protein phosphatase OS=Nostoc commune GN=iphP PE=1 SV=1 164 291 6.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 121 138 17
2 145 164 19
3 198 220 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1890
MDRSVQLQQVPNFRDVGQTVNGFLGRKLVREGVLFRSAYPDGASPQDKIILRDELGIRTIIDLRSETEQLRQAGA
LQAGTQAPTPWYQWKSERPRPPRIRGIDYREIRITGRSFERHVVRQLAWLDFFKVIFFFVFGYRLRATRIIVREV
LVPIGLLGIGTVALDNSSADIYEALKLLTSPRSTPALVHCTLGKDRTGLICALILIILGVPMSAIEYDYFQTDAA
LFSSRAKTLAELHDAGFTEEWASTAKNMITGIVDHLSIEYGGVDAYLDQIGFHESDRAKLRDRLLQ*
Coding >Hirsu2|1890
ATGGATCGATCCGTCCAGCTTCAGCAGGTTCCCAACTTCCGAGACGTGGGCCAGACGGTGAACGGGTTTCTCGGT
CGCAAATTGGTCCGCGAGGGCGTCCTTTTCCGCTCCGCTTACCCCGATGGCGCCAGTCCGCAGGACAAGATCATT
CTCAGAGACGAGCTGGGCATCAGGACCATCATAGACTTGCGGTCAGAGACGGAACAGCTCCGCCAGGCTGGCGCA
CTACAAGCAGGCACCCAAGCTCCAACTCCGTGGTATCAGTGGAAGAGTGAGCGGCCACGCCCTCCGCGCATTCGG
GGGATAGACTACCGAGAGATACGCATTACCGGCCGCTCGTTTGAGCGCCATGTCGTGAGACAGCTGGCTTGGTTG
GACTTCTTCAAGGTCATCTTCTTCTTCGTATTTGGCTACCGCCTGCGGGCCACGCGCATCATCGTCCGCGAAGTC
CTTGTCCCCATAGGCTTGCTCGGCATAGGAACTGTTGCCCTCGACAACTCCAGCGCCGACATCTACGAAGCCCTG
AAGCTGCTCACAAGCCCGCGCTCGACGCCTGCCTTGGTCCATTGCACGCTCGGAAAAGACAGAACAGGGCTCATC
TGCGCTCTGATCCTCATCATTCTTGGCGTGCCAATGTCGGCCATTGAGTACGACTACTTCCAGACAGACGCTGCT
CTCTTCTCAAGCCGGGCGAAAACGCTGGCCGAGCTGCACGACGCAGGCTTCACCGAGGAGTGGGCTTCCACAGCC
AAGAACATGATCACGGGCATAGTGGATCATCTGTCTATCGAGTACGGCGGCGTGGATGCATACCTCGATCAGATT
GGCTTCCACGAATCGGACCGGGCTAAGCTCCGCGACAGGCTTCTGCAATGA
Transcript >Hirsu2|1890
ATGGATCGATCCGTCCAGCTTCAGCAGGTTCCCAACTTCCGAGACGTGGGCCAGACGGTGAACGGGTTTCTCGGT
CGCAAATTGGTCCGCGAGGGCGTCCTTTTCCGCTCCGCTTACCCCGATGGCGCCAGTCCGCAGGACAAGATCATT
CTCAGAGACGAGCTGGGCATCAGGACCATCATAGACTTGCGGTCAGAGACGGAACAGCTCCGCCAGGCTGGCGCA
CTACAAGCAGGCACCCAAGCTCCAACTCCGTGGTATCAGTGGAAGAGTGAGCGGCCACGCCCTCCGCGCATTCGG
GGGATAGACTACCGAGAGATACGCATTACCGGCCGCTCGTTTGAGCGCCATGTCGTGAGACAGCTGGCTTGGTTG
GACTTCTTCAAGGTCATCTTCTTCTTCGTATTTGGCTACCGCCTGCGGGCCACGCGCATCATCGTCCGCGAAGTC
CTTGTCCCCATAGGCTTGCTCGGCATAGGAACTGTTGCCCTCGACAACTCCAGCGCCGACATCTACGAAGCCCTG
AAGCTGCTCACAAGCCCGCGCTCGACGCCTGCCTTGGTCCATTGCACGCTCGGAAAAGACAGAACAGGGCTCATC
TGCGCTCTGATCCTCATCATTCTTGGCGTGCCAATGTCGGCCATTGAGTACGACTACTTCCAGACAGACGCTGCT
CTCTTCTCAAGCCGGGCGAAAACGCTGGCCGAGCTGCACGACGCAGGCTTCACCGAGGAGTGGGCTTCCACAGCC
AAGAACATGATCACGGGCATAGTGGATCATCTGTCTATCGAGTACGGCGGCGTGGATGCATACCTCGATCAGATT
GGCTTCCACGAATCGGACCGGGCTAAGCTCCGCGACAGGCTTCTGCAATGA
Gene >Hirsu2|1890
ATGGATCGATCCGTCCAGCTTCAGCAGGTTCCCAACTTCCGAGACGTGGGCCAGACGGTGAACGGGTTTCTCGGT
CGCAAATTGGTCCGCGAGGGCGTCCTTTTCCGCTCCGCTTACCCCGGTGGGTCGCCTCTCGACGCTGAAGAACAG
GCTCTGGATCGGGCATTCGTTCACTGACGCCGACGTGGATAGATGGCGCCAGTCCGCAGGACAAGATCATTCTCA
GAGACGAGCTGGGCATCAGGACCATCATAGACTTGCGGTCAGAGTAAGCTCCCTCCCGACGCCGAGCAGGCCGTG
AGCTCATGGATGGCATTCAGGACGGAACAGCTCCGCCAGGCTGGCGCACTACAAGCAGGCACCCAAGCTCCAACT
CCGTGGTATCAGTGGAAGAGTGAGCGGCCACGCCCTCCGCGCATTCGGGGGATAGACTACCGAGAGATACGCATT
ACCGGCCGCTCGTTTGAGCGCCATGTCGTGAGACAGCTGGCTTGGTTGGACTTCTTGTGAGTCTCGCTTCGTGAT
CCATGCCCGGCCGGCGCTGATGAAGAATCCGCCCCCCGGCTGAAAGCAAGGTCATCTTCTTCTTCGTATTTGGCT
ACCGCCTGCGGGCCACGCGCATCATCGTCCGCGAAGTCCTTGTCCCCATAGGCTTGCTCGGCATAGGAACTGTTG
CCCTCGACAACTCCAGCGCCGACATCTACGAAGCCCTGAAGCTGCTCACAAGCCCGCGCTCGACGCCTGCCTTGG
TCCATTGCACGCTCGGAAAAGACAGAACAGGTACCCAGCCAAGAGAAAACCCTTGGCGCGATGCCGTCGTCTCAC
CGGCTAATGAAACTCGTGAGGGCTCATCTGCGCTCTGATCCTCATCATTCTTGGCGTGCCAATGTCGGCCATTGA
GTACGACTACTTCCAGACAGACGCTGCTCTCTTCTCAAGCCGGGCGAAAACGCTGGCCGAGCTGCACGACGCAGG
CTTCACCGAGGAGTGGGCTTCCACAGCCAAGAACATGATCACGGGCATAGTGGATCATCTGTCTATCGAGTACGG
CGGCGTGGATGCATACCTCGATCAGATTGGCTTCCACGAATCGGACCGGGCTAAGCTCCGCGACAGGCTTCTGCA
ATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail