Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1886
Gene name
LocationContig_143:21258..22252
Strand+
Gene length (bp)994
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10277 Frag1 Frag1/DRAM/Sfk1 family 1.5E-42 9 224

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U1|SFK1_SCHPO Protein sfk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sfk1 PE=3 SV=1 3 245 6.0E-14
sp|P35735|SFK1_YEAST Protein SFK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFK1 PE=1 SV=1 11 230 4.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 62 81 19
3 101 123 22
4 133 150 17
5 171 190 19
6 205 227 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1886
MALWSFFSYWMLPVFSSLVWFGMLLGMLLHWVIDTNTRHYPEMSEHAHIAYISNVGAHELKPLFIAGSTVTAVFL
DLSFVAERWLRHNGRLVPNTSIGEKILASLTILCALIGTLGLILLTILDTWRHHHLHGGFLVVFIVGYLLSAVFI
CWEYQRLGIKNRQHRVLRASFWVKLTFVIVEVALVIVFIANSARHEPNVAAVFEWIVAFIFTFYILSFVIDLYPA
IRTKEYSSRFEKPGDVEEAATPAPAGSGPTLHQGEYPVVDRNAANF*
Coding >Hirsu2|1886
ATGGCGCTTTGGAGCTTCTTTTCCTACTGGATGTTGCCCGTCTTCTCCAGCCTCGTCTGGTTCGGCATGCTGCTC
GGCATGCTGCTCCACTGGGTCATCGACACCAACACCCGCCATTACCCGGAAATGTCGGAACACGCCCACATCGCC
TACATCAGCAACGTCGGCGCCCACGAGCTCAAGCCACTCTTCATCGCCGGCTCCACCGTCACCGCCGTCTTCCTC
GACCTGTCCTTCGTCGCCGAGCGCTGGCTCCGCCACAACGGCCGCCTCGTCCCCAACACCTCCATCGGCGAGAAG
ATCCTCGCCAGCCTGACCATCTTGTGCGCCCTCATCGGCACCCTGGGGCTCATTCTCCTCACCATCCTCGACACC
TGGCGCCACCATCACCTGCACGGCGGCTTCCTCGTCGTCTTCATTGTCGGCTACCTGCTCTCCGCCGTCTTCATC
TGCTGGGAGTACCAACGTCTCGGCATCAAAAACCGCCAACACCGTGTCCTCCGCGCTTCATTCTGGGTCAAGCTC
ACCTTCGTCATCGTCGAGGTGGCTCTTGTCATCGTCTTCATCGCCAACTCGGCGCGTCACGAGCCCAACGTCGCC
GCCGTCTTCGAGTGGATCGTCGCCTTCATCTTCACCTTCTACATCCTCTCCTTCGTCATCGATCTCTACCCGGCC
ATCCGCACCAAGGAGTACAGCTCCCGCTTCGAGAAGCCCGGTGACGTTGAAGAGGCCGCCACACCCGCTCCCGCC
GGCAGCGGCCCCACTCTCCACCAAGGCGAATATCCCGTTGTGGACAGGAATGCCGCCAACTTCTGA
Transcript >Hirsu2|1886
ATGGCGCTTTGGAGCTTCTTTTCCTACTGGATGTTGCCCGTCTTCTCCAGCCTCGTCTGGTTCGGCATGCTGCTC
GGCATGCTGCTCCACTGGGTCATCGACACCAACACCCGCCATTACCCGGAAATGTCGGAACACGCCCACATCGCC
TACATCAGCAACGTCGGCGCCCACGAGCTCAAGCCACTCTTCATCGCCGGCTCCACCGTCACCGCCGTCTTCCTC
GACCTGTCCTTCGTCGCCGAGCGCTGGCTCCGCCACAACGGCCGCCTCGTCCCCAACACCTCCATCGGCGAGAAG
ATCCTCGCCAGCCTGACCATCTTGTGCGCCCTCATCGGCACCCTGGGGCTCATTCTCCTCACCATCCTCGACACC
TGGCGCCACCATCACCTGCACGGCGGCTTCCTCGTCGTCTTCATTGTCGGCTACCTGCTCTCCGCCGTCTTCATC
TGCTGGGAGTACCAACGTCTCGGCATCAAAAACCGCCAACACCGTGTCCTCCGCGCTTCATTCTGGGTCAAGCTC
ACCTTCGTCATCGTCGAGGTGGCTCTTGTCATCGTCTTCATCGCCAACTCGGCGCGTCACGAGCCCAACGTCGCC
GCCGTCTTCGAGTGGATCGTCGCCTTCATCTTCACCTTCTACATCCTCTCCTTCGTCATCGATCTCTACCCGGCC
ATCCGCACCAAGGAGTACAGCTCCCGCTTCGAGAAGCCCGGTGACGTTGAAGAGGCCGCCACACCCGCTCCCGCC
GGCAGCGGCCCCACTCTCCACCAAGGCGAATATCCCGTTGTGGACAGGAATGCCGCCAACTTCTGA
Gene >Hirsu2|1886
ATGGCGCTTTGGAGCTTCTTTTCCTACTGGGTACGCTGCTCCCCCCTTCCCTCCCCCCCTGCCTCGGGGGTGCCG
CCGGCCCGGTGCTCTCTTGACTGACACCTGACGTGGCGCCGCAGATGTTGCCCGTCTTCTCCAGCCTCGTCTGGT
TCGGCATGCTGCTCGGCATGCTGCTCCACTGGGTCATCGACACCAACACCCGCCATTACCCGGAAATGTCGGAAC
ACGCCCACATCGCCTACATCAGCAACGTCGGCGCCCACGAGCTCAAGCCACTCTTCATCGCCGGCTCCACCGTCA
CCGCCGTCTTCCTCGACCTGTCCTTCGTCGCCGAGCGCTGGCTCCGCCACAACGGCCGCCTCGTCCCCAACACCT
CCATCGGCGAGAAGATCCTCGCCAGCCTGACCATCTTGTGCGCCCTCATCGGCACCCTGGGGCTCATTCTCCTCA
CCATCCTCGACACCTGGCGCCACCATCACCTGCACGGCGGCTTCCTCGTCGTCTTCATTGTCGGCTACCTGCTCT
CCGCCGTCTTCATCTGCTGGGAGTACCAACGTCTCGGCATCAGTATGTGCTTGGGGATACAACCTCCTGTCTTGC
TTGGACTCTGTATCCGTATCACGAGCCCGGTCTGCTAACATTGAGCCCCTGCCCAGAAAACCGCCAACACCGTGT
CCTCCGCGCTTCATTCTGGGTCAAGCTCACCTTCGTCATCGTCGAGGTGGCTCTTGTCATCGTCTTCATCGCCAA
CTCGGCGCGTCACGAGCCCAACGTCGCCGCCGTCTTCGAGTGGATCGTCGCCTTCATCTTCACCTTCTACATCCT
CTCCTTCGTCATCGATCTCTACCCGGCCATCCGCACCAAGGAGTACAGCTCCCGCTTCGAGAAGCCCGGTGACGT
TGAAGAGGCCGCCACACCCGCTCCCGCCGGCAGCGGCCCCACTCTCCACCAAGGCGAATATCCCGTTGTGGACAG
GAATGCCGCCAACTTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail