Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1884
Gene name
LocationContig_143:12122..14886
Strand+
Gene length (bp)2764
Transcript length (bp)2523
Coding sequence length (bp)2523
Protein length (aa) 841

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 1.0E-13 517 641
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 2.2E-12 219 290
PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain 4.0E-10 16 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09697|RGA8_SCHPO Rho-GTPase-activating protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga8 PE=1 SV=1 1 676 5.0E-164
sp|P43556|RGD2_YEAST Rho-GTPase-activating protein RGD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD2 PE=1 SV=1 1 676 3.0E-123
sp|Q9UUJ3|RGA9_SCHPO Probable Rho-GTPase-activating protein 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga9 PE=1 SV=2 3 676 5.0E-45
sp|Q8IWW6|RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens GN=ARHGAP12 PE=1 SV=1 463 644 1.0E-09
sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 463 644 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09697|RGA8_SCHPO Rho-GTPase-activating protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga8 PE=1 SV=1 1 676 5.0E-164
sp|P43556|RGD2_YEAST Rho-GTPase-activating protein RGD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD2 PE=1 SV=1 1 676 3.0E-123
sp|Q9UUJ3|RGA9_SCHPO Probable Rho-GTPase-activating protein 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga9 PE=1 SV=2 3 676 5.0E-45
sp|Q8IWW6|RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens GN=ARHGAP12 PE=1 SV=1 463 644 1.0E-09
sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 463 644 5.0E-09
sp|Q8C0D4|RHG12_MOUSE Rho GTPase-activating protein 12 OS=Mus musculus GN=Arhgap12 PE=1 SV=2 463 644 6.0E-09
sp|Q5RB40|HMHA1_PONAB Minor histocompatibility protein HA-1 OS=Pongo abelii GN=HMHA1 PE=2 SV=1 466 668 2.0E-08
sp|A7KAX9|RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens GN=ARHGAP32 PE=1 SV=1 463 715 1.0E-07
sp|Q811P8|RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus GN=Arhgap32 PE=1 SV=2 463 708 1.0E-07
sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 463 644 5.0E-07
sp|Q6ZUM4|RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens GN=ARHGAP27 PE=1 SV=3 463 648 9.0E-07
sp|Q6GPD0|RHG32_XENLA Rho GTPase-activating protein 32 OS=Xenopus laevis GN=arhgap32 PE=2 SV=1 465 708 1.0E-06
sp|O43586|PPIP1_HUMAN Proline-serine-threonine phosphatase-interacting protein 1 OS=Homo sapiens GN=PSTPIP1 PE=1 SV=1 4 158 2.0E-06
sp|A4IF90|RHG15_BOVIN Rho GTPase-activating protein 15 OS=Bos taurus GN=ARHGAP15 PE=2 SV=1 463 644 3.0E-06
sp|Q10164|RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga2 PE=1 SV=1 483 640 6.0E-06
sp|Q6PCS4|RHG29_DANRE Rho GTPase-activating protein 29 OS=Danio rerio GN=arhgap29 PE=2 SV=1 468 669 6.0E-06
sp|O14559|RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens GN=ARHGAP33 PE=1 SV=2 465 737 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0035556 intracellular signal transduction Yes
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1884
MPGFADSFWSSDYAAGLGVLFGKLQQGVLENRQVLTIARLRAEAEEAYGQRLRDIAPAADRISGGFARDDGATVR
KAYDGMRDEMQDAARSHQRIAQNIRDLVVNPFSRWCDAHEARVQSSQDELQGRIKTHDRQADAVRKLRSNYFNKC
RLVEDLEEENKLAFQDPETSPKAGQTIPEIKVQPHKEEEPDDEEIYEIGDEIYQHDQIKKIIAQMLSTIKMGETK
VPILGTYLNTSAGSDIVEYLQRNMAVTSVSYAERIGQDLISNGFLRLIGNVGSTFANSSRLFYQWRPKAFKIAGM
PEKRVPPGRTLSLPTTGSDSSDSAVVGTVSEYLANWNVLNNSHPNETPAQRLQRESREADEKYKAGVHRLDELRC
ELEQAIFLHLKFLERCELDRLKAIKTVILDFSGSLGNVIPSLQSTVDKMLLFQETVQPVGDLRYLLENYRTGSFI
PRVVVYENYYNRVDEQTFGVDLEARARADKKRVPILVTTLLTYLDHHYPDLEGDEARRGVWLVDVPLAHVHKLRA
LVNNGKPLSHDALNRFDVPTVANLLKLYLLELPDSLVSSHVYEIVRTIYTTPTADATDASRIAVLQQTLSQLRLT
NIATLDACMNHFTRLVDLTSADEAYIAALTSSLAPCMLRPRTETSLTMEEKHAVRLVRDLFTHKDAIFNELKRMS
TLSHSSSVGANRPRAVSTDESNRKALMEERNRALVEKVNASRSRATSPAPSPRGHRRDRSSGGPETRFPIQTSPT
SSGDRARSSLGSIDGRLKRSSLDVPGAESYSNSDAANGSPPASKTADDEAAAETRGRGSTKFVGGRRPAASPPPE
SAPRGVTLEDKPMDD*
Coding >Hirsu2|1884
ATGCCAGGCTTCGCTGACTCCTTCTGGTCGAGCGACTATGCCGCCGGGCTGGGCGTCCTGTTCGGCAAGCTCCAG
CAAGGCGTGCTGGAGAATCGCCAAGTTCTCACGATTGCTCGCCTACGAGCCGAAGCCGAAGAGGCCTACGGACAG
CGTCTAAGAGACATCGCTCCTGCGGCTGATAGGATCAGCGGCGGTTTCGCGAGAGACGACGGCGCTACCGTCCGC
AAAGCATATGACGGCATGCGAGACGAGATGCAAGATGCTGCCCGGAGCCATCAACGCATCGCCCAAAATATTCGC
GATCTTGTCGTCAACCCCTTTTCACGCTGGTGTGATGCCCACGAGGCCCGCGTACAGAGCTCCCAGGACGAGCTG
CAAGGTCGCATTAAGACTCACGACCGCCAAGCCGACGCCGTTCGCAAGCTTCGGTCCAACTACTTCAACAAATGC
CGCCTCGTCGAGGACCTTGAAGAGGAAAACAAGCTGGCTTTTCAGGATCCCGAAACAAGCCCCAAGGCTGGCCAA
ACCATTCCCGAAATTAAAGTCCAGCCGCACAAGGAAGAGGAACCAGACGACGAAGAGATATACGAAATCGGTGAC
GAGATCTACCAACACGACCAGATCAAGAAGATTATTGCCCAGATGCTCTCCACGATAAAGATGGGCGAAACCAAA
GTCCCCATACTAGGCACCTACCTCAACACATCGGCCGGCTCCGACATTGTCGAATATCTCCAGCGGAACATGGCG
GTCACAAGCGTGAGCTACGCCGAGCGCATTGGCCAGGATCTCATCTCCAACGGCTTCTTGCGCCTTATCGGCAAC
GTTGGCAGCACGTTTGCCAACAGCTCGCGGCTGTTCTACCAATGGCGTCCCAAGGCCTTCAAGATTGCCGGAATG
CCGGAGAAGAGGGTGCCTCCCGGCCGAACCCTGTCGCTTCCCACCACCGGATCGGACAGCAGCGATTCGGCCGTG
GTGGGAACTGTAAGCGAGTACTTGGCCAACTGGAACGTACTCAATAATTCGCATCCCAACGAAACGCCGGCTCAG
CGTCTGCAACGCGAGTCGCGCGAGGCGGATGAGAAGTATAAGGCTGGTGTCCACAGACTCGACGAGCTGCGTTGC
GAGCTGGAGCAGGCAATCTTCTTGCATCTCAAGTTCCTCGAGCGTTGCGAACTCGATAGACTGAAGGCTATCAAG
ACTGTTATTCTGGACTTCTCCGGCAGCCTCGGCAACGTCATTCCCAGCCTCCAATCCACGGTGGATAAGATGCTA
CTATTCCAAGAAACCGTACAGCCGGTGGGCGACCTGAGATACCTTCTCGAGAACTATCGCACCGGAAGCTTCATA
CCCAGAGTGGTCGTCTACGAAAACTATTACAACAGGGTCGACGAGCAGACCTTCGGCGTCGATCTGGAAGCCAGG
GCCCGAGCCGACAAGAAACGTGTACCGATCTTGGTGACAACCCTGCTGACGTACCTTGACCACCATTATCCTGAC
CTAGAGGGCGACGAGGCGCGGCGAGGCGTATGGCTCGTCGATGTGCCCCTGGCTCACGTACACAAGCTACGTGCT
CTGGTCAACAATGGCAAGCCTTTGTCCCACGACGCCTTGAATAGGTTTGATGTGCCGACGGTCGCGAACCTGCTG
AAACTATACCTTCTCGAATTGCCCGACTCGCTCGTCAGCTCCCATGTATACGAAATCGTTCGGACCATCTACACG
ACCCCTACCGCAGATGCCACGGACGCTTCACGCATTGCCGTGCTTCAACAGACGCTATCGCAGCTGCGGCTCACT
AATATTGCCACTCTGGACGCCTGCATGAATCACTTCACTCGCCTCGTCGATTTGACTTCGGCTGATGAAGCTTAC
ATCGCGGCCCTTACCTCGTCACTGGCACCGTGCATGTTGCGGCCCCGGACCGAGACGTCGCTGACGATGGAGGAG
AAGCACGCAGTCCGACTGGTCCGTGATCTTTTCACACACAAGGATGCCATCTTCAACGAGCTCAAGCGCATGTCG
ACCTTGAGCCACTCCTCGTCGGTTGGCGCCAACCGCCCGCGCGCCGTGAGCACCGACGAGAGCAACCGAAAAGCC
TTGATGGAGGAGCGCAACAGGGCTCTGGTCGAAAAGGTGAACGCATCGCGCAGCCGAGCGACGAGCCCGGCGCCC
AGCCCTCGGGGGCACCGCCGCGACCGAAGCAGCGGCGGTCCAGAAACACGGTTCCCCATCCAGACAAGCCCCACG
TCTTCAGGCGACCGCGCCCGATCCAGTCTCGGGAGCATCGACGGCCGCCTCAAGCGCTCTTCCCTCGACGTCCCG
GGTGCCGAGAGCTACAGCAATTCCGATGCCGCAAACGGCTCTCCCCCAGCATCCAAAACGGCAGATGACGAGGCC
GCGGCCGAAACACGCGGCCGAGGGAGCACCAAGTTCGTCGGCGGCAGGAGGCCCGCCGCCTCGCCGCCTCCAGAG
TCTGCTCCTCGCGGTGTGACACTGGAGGACAAGCCCATGGACGACTAG
Transcript >Hirsu2|1884
ATGCCAGGCTTCGCTGACTCCTTCTGGTCGAGCGACTATGCCGCCGGGCTGGGCGTCCTGTTCGGCAAGCTCCAG
CAAGGCGTGCTGGAGAATCGCCAAGTTCTCACGATTGCTCGCCTACGAGCCGAAGCCGAAGAGGCCTACGGACAG
CGTCTAAGAGACATCGCTCCTGCGGCTGATAGGATCAGCGGCGGTTTCGCGAGAGACGACGGCGCTACCGTCCGC
AAAGCATATGACGGCATGCGAGACGAGATGCAAGATGCTGCCCGGAGCCATCAACGCATCGCCCAAAATATTCGC
GATCTTGTCGTCAACCCCTTTTCACGCTGGTGTGATGCCCACGAGGCCCGCGTACAGAGCTCCCAGGACGAGCTG
CAAGGTCGCATTAAGACTCACGACCGCCAAGCCGACGCCGTTCGCAAGCTTCGGTCCAACTACTTCAACAAATGC
CGCCTCGTCGAGGACCTTGAAGAGGAAAACAAGCTGGCTTTTCAGGATCCCGAAACAAGCCCCAAGGCTGGCCAA
ACCATTCCCGAAATTAAAGTCCAGCCGCACAAGGAAGAGGAACCAGACGACGAAGAGATATACGAAATCGGTGAC
GAGATCTACCAACACGACCAGATCAAGAAGATTATTGCCCAGATGCTCTCCACGATAAAGATGGGCGAAACCAAA
GTCCCCATACTAGGCACCTACCTCAACACATCGGCCGGCTCCGACATTGTCGAATATCTCCAGCGGAACATGGCG
GTCACAAGCGTGAGCTACGCCGAGCGCATTGGCCAGGATCTCATCTCCAACGGCTTCTTGCGCCTTATCGGCAAC
GTTGGCAGCACGTTTGCCAACAGCTCGCGGCTGTTCTACCAATGGCGTCCCAAGGCCTTCAAGATTGCCGGAATG
CCGGAGAAGAGGGTGCCTCCCGGCCGAACCCTGTCGCTTCCCACCACCGGATCGGACAGCAGCGATTCGGCCGTG
GTGGGAACTGTAAGCGAGTACTTGGCCAACTGGAACGTACTCAATAATTCGCATCCCAACGAAACGCCGGCTCAG
CGTCTGCAACGCGAGTCGCGCGAGGCGGATGAGAAGTATAAGGCTGGTGTCCACAGACTCGACGAGCTGCGTTGC
GAGCTGGAGCAGGCAATCTTCTTGCATCTCAAGTTCCTCGAGCGTTGCGAACTCGATAGACTGAAGGCTATCAAG
ACTGTTATTCTGGACTTCTCCGGCAGCCTCGGCAACGTCATTCCCAGCCTCCAATCCACGGTGGATAAGATGCTA
CTATTCCAAGAAACCGTACAGCCGGTGGGCGACCTGAGATACCTTCTCGAGAACTATCGCACCGGAAGCTTCATA
CCCAGAGTGGTCGTCTACGAAAACTATTACAACAGGGTCGACGAGCAGACCTTCGGCGTCGATCTGGAAGCCAGG
GCCCGAGCCGACAAGAAACGTGTACCGATCTTGGTGACAACCCTGCTGACGTACCTTGACCACCATTATCCTGAC
CTAGAGGGCGACGAGGCGCGGCGAGGCGTATGGCTCGTCGATGTGCCCCTGGCTCACGTACACAAGCTACGTGCT
CTGGTCAACAATGGCAAGCCTTTGTCCCACGACGCCTTGAATAGGTTTGATGTGCCGACGGTCGCGAACCTGCTG
AAACTATACCTTCTCGAATTGCCCGACTCGCTCGTCAGCTCCCATGTATACGAAATCGTTCGGACCATCTACACG
ACCCCTACCGCAGATGCCACGGACGCTTCACGCATTGCCGTGCTTCAACAGACGCTATCGCAGCTGCGGCTCACT
AATATTGCCACTCTGGACGCCTGCATGAATCACTTCACTCGCCTCGTCGATTTGACTTCGGCTGATGAAGCTTAC
ATCGCGGCCCTTACCTCGTCACTGGCACCGTGCATGTTGCGGCCCCGGACCGAGACGTCGCTGACGATGGAGGAG
AAGCACGCAGTCCGACTGGTCCGTGATCTTTTCACACACAAGGATGCCATCTTCAACGAGCTCAAGCGCATGTCG
ACCTTGAGCCACTCCTCGTCGGTTGGCGCCAACCGCCCGCGCGCCGTGAGCACCGACGAGAGCAACCGAAAAGCC
TTGATGGAGGAGCGCAACAGGGCTCTGGTCGAAAAGGTGAACGCATCGCGCAGCCGAGCGACGAGCCCGGCGCCC
AGCCCTCGGGGGCACCGCCGCGACCGAAGCAGCGGCGGTCCAGAAACACGGTTCCCCATCCAGACAAGCCCCACG
TCTTCAGGCGACCGCGCCCGATCCAGTCTCGGGAGCATCGACGGCCGCCTCAAGCGCTCTTCCCTCGACGTCCCG
GGTGCCGAGAGCTACAGCAATTCCGATGCCGCAAACGGCTCTCCCCCAGCATCCAAAACGGCAGATGACGAGGCC
GCGGCCGAAACACGCGGCCGAGGGAGCACCAAGTTCGTCGGCGGCAGGAGGCCCGCCGCCTCGCCGCCTCCAGAG
TCTGCTCCTCGCGGTGTGACACTGGAGGACAAGCCCATGGACGACTAG
Gene >Hirsu2|1884
ATGCCAGGCTTCGCTGACTCCTTCTGGTCGAGCGACTATGCCGCCGGTGTGTCCGCTAAGATACCATGGCTCTCC
GGTCTAGTTTGAGCTCCCCGTCTCTGACATCCATGATTCGATAGGGCTGGGCGTCCTGTTCGGCAAGCTCCAGCA
AGGCGTGCTGGAGAATCGCCAAGTTCTCACGATTGCTCGCCTACGAGCCGAAGCCGAAGAGGCCTACGGACAGCG
TCTAAGAGACATCGCTCCTGCGGCTGATAGGATCAGCGGCGGTTTCGCGAGAGACGACGGCGCTACCGTCCGCAA
AGTCAGGATTATCCCCTCCAGAAACCCTTCTCATCTATGGCTTCATTTACAGCCTGCGCATACCTCTGGGCGCGG
GCGTGCATACCGAGTTACTGACGAGCCACGTCTCTCCAGGCATATGACGGCATGCGAGACGAGATGCAAGATGCT
GCCCGGAGCCATCAACGCATCGCCCAAAATATTCGCGATCTTGTCGTCAACCCCTTTTCACGCTGGTGTGATGCC
CACGAGGCCCGCGTACAGAGCTCCCAGGACGAGCTGCAAGGTCGCATTAAGACTCACGACCGCCAAGCCGACGCC
GTTCGCAAGCTTCGGTCCAACTACTTCAACAAATGCCGCCTCGTCGAGGACCTTGAAGAGGAAAACAAGCTGGCT
TTTCAGGATCCCGAAACAAGCCCCAAGGCTGGCCAAACCATTCCCGAAATTAAAGTCCAGCCGCACAAGGAAGAG
GAACCAGACGACGAAGAGATATACGAAATCGGTGACGAGATCTACCAACACGACCAGATCAAGAAGATTATTGCC
CAGATGCTCTCCACGATAAAGATGGGCGAAACCAAAGTCCCCATACTAGGCACCTACCTCAACACATCGGCCGGC
TCCGACATTGTCGAATATCTCCAGCGGAACATGGCGGTCACAAGCGTGAGCTACGCCGAGCGCATTGGCCAGGAT
CTCATCTCCAACGGCTTCTTGCGCCTTATCGGCAACGTTGGCAGCACGTTTGCCAACAGCTCGCGGCTGTTCTAC
CAATGGCGTCCCAAGGCCTTCAAGATTGCCGGAATGCCGGAGAAGAGGGTGCCTCCCGGCCGAACCCTGTCGCTT
CCCACCACCGGATCGGACAGCAGCGATTCGGCCGTGGTGGGAACTGTAAGCGAGTACTTGGCCAACTGGAACGTA
CTCAATAATTCGCATCCCAACGAAACGCCGGCTCAGCGTCTGCAACGCGAGTCGCGCGAGGCGGATGAGAAGTAT
AAGGCTGGTGTCCACAGACTCGACGAGCTGCGTTGCGAGCTGGAGCAGGCAATCTTCTTGCATCTCAAGTTCCTC
GAGCGTTGCGAACTCGATAGACTGAAGGCTATCAAGACTGTTATTCTGGACTTCTCCGGCAGCCTCGGCAACGTC
ATTCCCAGCCTCCAATCCACGGTGGATAAGATGCTACTATTCCAAGAAACCGTACAGCCGGTGGGCGACCTGAGA
TACCTTCTCGAGAACTATCGCACCGGAAGCTTCATACCCAGAGTGGTCGTCTACGAAAACTATTACAACAGGGTC
GACGAGCAGACCTTCGGCGTCGATCTGGAAGCCAGGGCCCGAGCCGACAAGAAACGTGTACCGATCTTGGTGACA
ACCCTGCTGACGTACCTTGACCACCATTATCCTGACCTAGAGGGCGACGAGGCGCGGCGAGGCGTATGGCTCGTC
GATGTGCCCCTGGCTCACGTACACAAGCTACGTGCTCTGGTCAACAATGGCAAGCCTTTGTCCCACGACGCCTTG
AATAGGTTTGATGTGCCGACGGTCGCGAACCTGCTGAAACTATACCTTCTCGAATTGCCCGGTAAGCCATTTTCA
TGCCTGTCGATGAGACTTGTGCTGTTCTGATTCCTGTGCAGACTCGCTCGTCAGCTCCCATGTATACGAAATCGT
TCGGACCATCTACACGACCCCTACCGCAGATGCCACGGACGCTTCACGCATTGCCGTGCTTCAACAGACGCTATC
GCAGCTGCGGCTCACTAATATTGCCACTCTGGACGCCTGCATGAATCACTTCACTCGCCTCGTCGATTTGACTTC
GGCTGATGAAGCTTACATCGCGGCCCTTACCTCGTCACTGGCACCGTGCATGTTGCGGCCCCGGACCGAGACGTC
GCTGACGATGGAGGAGAAGCACGCAGTCCGACTGGTCCGTGATCTTTTCACACACAAGGATGCCATCTTCAACGA
GCTCAAGCGCATGTCGACCTTGAGCCACTCCTCGTCGGTTGGCGCCAACCGCCCGCGCGCCGTGAGCACCGACGA
GAGCAACCGAAAAGCCTTGATGGAGGAGCGCAACAGGGCTCTGGTCGAAAAGGTGAACGCATCGCGCAGCCGAGC
GACGAGCCCGGCGCCCAGCCCTCGGGGGCACCGCCGCGACCGAAGCAGCGGCGGTCCAGAAACACGGTTCCCCAT
CCAGACAAGCCCCACGTCTTCAGGCGACCGCGCCCGATCCAGTCTCGGGAGCATCGACGGCCGCCTCAAGCGCTC
TTCCCTCGACGTCCCGGGTGCCGAGAGCTACAGCAATTCCGATGCCGCAAACGGCTCTCCCCCAGCATCCAAAAC
GGCAGATGACGAGGCCGCGGCCGAAACACGCGGCCGAGGGAGCACCAAGTTCGTCGGCGGCAGGAGGCCCGCCGC
CTCGCCGCCTCCAGAGTCTGCTCCTCGCGGTGTGACACTGGAGGACAAGCCCATGGACGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail