Protein ID | Hirsu2|1883 |
Gene name | |
Location | Contig_143:9092..9587 |
Strand | + |
Gene length (bp) | 495 |
Transcript length (bp) | 360 |
Coding sequence length (bp) | 360 |
Protein length (aa) | 120 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00416 | Ribosomal_S13 | Ribosomal protein S13/S18 | 8.3E-13 | 4 | 105 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O59772|SWS2_SCHPO | 37S ribosomal protein subunit sws2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sws2 PE=3 SV=1 | 1 | 118 | 5.0E-21 |
sp|P53937|SWS2_YEAST | 37S ribosomal protein SWS2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWS2 PE=1 SV=1 | 1 | 118 | 2.0E-20 |
sp|C4K796|RS13_HAMD5 | 30S ribosomal protein S13 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-17 |
sp|Q5WZJ0|RS13_LEGPL | 30S ribosomal protein S13 OS=Legionella pneumophila (strain Lens) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-16 |
sp|Q5ZYM1|RS13_LEGPH | 30S ribosomal protein S13 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-16 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O59772|SWS2_SCHPO | 37S ribosomal protein subunit sws2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sws2 PE=3 SV=1 | 1 | 118 | 5.0E-21 |
sp|P53937|SWS2_YEAST | 37S ribosomal protein SWS2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWS2 PE=1 SV=1 | 1 | 118 | 2.0E-20 |
sp|C4K796|RS13_HAMD5 | 30S ribosomal protein S13 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-17 |
sp|Q5WZJ0|RS13_LEGPL | 30S ribosomal protein S13 OS=Legionella pneumophila (strain Lens) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-16 |
sp|Q5ZYM1|RS13_LEGPH | 30S ribosomal protein S13 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-16 |
sp|A5IHP4|RS13_LEGPC | 30S ribosomal protein S13 OS=Legionella pneumophila (strain Corby) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-16 |
sp|Q5X837|RS13_LEGPA | 30S ribosomal protein S13 OS=Legionella pneumophila (strain Paris) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-16 |
sp|Q65QX7|RS13_MANSM | 30S ribosomal protein S13 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-16 |
sp|Q8Z1X6|RS13_SALTI | 30S ribosomal protein S13 OS=Salmonella typhi GN=rpsM PE=3 SV=3 | 1 | 104 | 1.0E-15 |
sp|Q8ZLM1|RS13_SALTY | 30S ribosomal protein S13 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsM PE=3 SV=3 | 1 | 104 | 1.0E-15 |
sp|Q5PK07|RS13_SALPA | 30S ribosomal protein S13 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-15 |
sp|B4RT50|RS13_ALTMD | 30S ribosomal protein S13 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-15 |
sp|Q9CL51|RS13_PASMU | 30S ribosomal protein S13 OS=Pasteurella multocida (strain Pm70) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-15 |
sp|Q2S934|RS13_HAHCH | 30S ribosomal protein S13 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-15 |
sp|Q7MYH2|RS13_PHOLL | 30S ribosomal protein S13 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-15 |
sp|Q87SZ2|RS13_VIBPA | 30S ribosomal protein S13 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-15 |
sp|A1TYL9|RS13_MARHV | 30S ribosomal protein S13 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-15 |
sp|C4L7V2|RS13_TOLAT | 30S ribosomal protein S13 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsM PE=3 SV=1 | 1 | 106 | 4.0E-15 |
sp|Q3YWW1|RS13_SHISS | 30S ribosomal protein S13 OS=Shigella sonnei (strain Ss046) GN=rpsM PE=3 SV=1 | 1 | 106 | 4.0E-15 |
sp|P0A7T2|RS13_SHIFL | 30S ribosomal protein S13 OS=Shigella flexneri GN=rpsM PE=3 SV=2 | 1 | 106 | 4.0E-15 |
sp|Q0T004|RS13_SHIF8 | 30S ribosomal protein S13 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsM PE=3 SV=1 | 1 | 106 | 4.0E-15 |
sp|Q32B53|RS13_SHIDS | 30S ribosomal protein S13 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsM PE=3 SV=1 | 1 | 106 | 4.0E-15 |
sp|Q31VX8|RS13_SHIBS | 30S ribosomal protein S13 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsM PE=3 SV=1 | 1 | 106 | 4.0E-15 |
sp|Q1R633|RS13_ECOUT | 30S ribosomal protein S13 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsM PE=3 SV=1 | 1 | 106 | 4.0E-15 |
sp|P0A7S9|RS13_ECOLI | 30S ribosomal protein S13 OS=Escherichia coli (strain K12) GN=rpsM PE=1 SV=2 | 1 | 106 | 4.0E-15 |
sp|P0A7T0|RS13_ECOL6 | 30S ribosomal protein S13 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsM PE=3 SV=2 | 1 | 106 | 4.0E-15 |
sp|Q0TCG3|RS13_ECOL5 | 30S ribosomal protein S13 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsM PE=3 SV=1 | 1 | 106 | 4.0E-15 |
sp|A1AGI9|RS13_ECOK1 | 30S ribosomal protein S13 OS=Escherichia coli O1:K1 / APEC GN=rpsM PE=3 SV=1 | 1 | 106 | 4.0E-15 |
sp|P0A7T1|RS13_ECO57 | 30S ribosomal protein S13 OS=Escherichia coli O157:H7 GN=rpsM PE=3 SV=2 | 1 | 106 | 4.0E-15 |
sp|C5BF29|RS13_EDWI9 | 30S ribosomal protein S13 OS=Edwardsiella ictaluri (strain 93-146) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-15 |
sp|Q9KP05|RS13_VIBCH | 30S ribosomal protein S13 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-15 |
sp|Q0AIH4|RS13_NITEC | 30S ribosomal protein S13 OS=Nitrosomonas eutropha (strain C91) GN=rpsM PE=3 SV=1 | 1 | 105 | 5.0E-15 |
sp|C1DAU0|RS13_LARHH | 30S ribosomal protein S13 OS=Laribacter hongkongensis (strain HLHK9) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-15 |
sp|A4IZR2|RS13_FRATW | 30S ribosomal protein S13 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-15 |
sp|Q5NHU6|RS13_FRATT | 30S ribosomal protein S13 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-15 |
sp|Q0BNQ6|RS13_FRATO | 30S ribosomal protein S13 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-15 |
sp|A0Q4K5|RS13_FRATN | 30S ribosomal protein S13 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-15 |
sp|B2SDW3|RS13_FRATM | 30S ribosomal protein S13 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-15 |
sp|Q2A5E8|RS13_FRATH | 30S ribosomal protein S13 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-15 |
sp|A7N9U6|RS13_FRATF | 30S ribosomal protein S13 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-15 |
sp|Q14J98|RS13_FRAT1 | 30S ribosomal protein S13 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-15 |
sp|Q7MPG7|RS13_VIBVY | 30S ribosomal protein S13 OS=Vibrio vulnificus (strain YJ016) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-15 |
sp|Q8DE61|RS13_VIBVU | 30S ribosomal protein S13 OS=Vibrio vulnificus (strain CMCP6) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-15 |
sp|Q1H4L4|RS13_METFK | 30S ribosomal protein S13 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-15 |
sp|Q2NQP4|RS13_SODGM | 30S ribosomal protein S13 OS=Sodalis glossinidius (strain morsitans) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-15 |
sp|Q488Z1|RS13_COLP3 | 30S ribosomal protein S13 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsM PE=3 SV=1 | 1 | 105 | 8.0E-15 |
sp|Q9PJN2|RS13_CHLMU | 30S ribosomal protein S13 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-15 |
sp|Q0I140|RS13_HAES1 | 30S ribosomal protein S13 OS=Haemophilus somnus (strain 129Pt) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-15 |
sp|Q9Z7S6|RS13_CHLPN | 30S ribosomal protein S13 OS=Chlamydia pneumoniae GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-15 |
sp|B1JAJ0|RS13_PSEPW | 30S ribosomal protein S13 OS=Pseudomonas putida (strain W619) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-14 |
sp|Q5L701|RS13_CHLAB | 30S ribosomal protein S13 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-14 |
sp|A1S240|RS13_SHEAM | 30S ribosomal protein S13 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-14 |
sp|Q9HWF7|RS13_PSEAE | 30S ribosomal protein S13 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-14 |
sp|Q02T58|RS13_PSEAB | 30S ribosomal protein S13 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-14 |
sp|B7V665|RS13_PSEA8 | 30S ribosomal protein S13 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-14 |
sp|P59755|RS13_NITEU | 30S ribosomal protein S13 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-14 |
sp|Q252X2|RS13_CHLFF | 30S ribosomal protein S13 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-14 |
sp|P59752|RS13_CHLCV | 30S ribosomal protein S13 OS=Chlamydophila caviae (strain GPIC) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-14 |
sp|Q3SLM7|RS13_THIDA | 30S ribosomal protein S13 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-14 |
sp|Q88QL3|RS13_PSEPK | 30S ribosomal protein S13 OS=Pseudomonas putida (strain KT2440) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-14 |
sp|B0KK88|RS13_PSEPG | 30S ribosomal protein S13 OS=Pseudomonas putida (strain GB-1) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-14 |
sp|A5VXR9|RS13_PSEP1 | 30S ribosomal protein S13 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-14 |
sp|Q1IFU4|RS13_PSEE4 | 30S ribosomal protein S13 OS=Pseudomonas entomophila (strain L48) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-14 |
sp|Q605D4|RS13_METCA | 30S ribosomal protein S13 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-14 |
sp|Q3K609|RS13_PSEPF | 30S ribosomal protein S13 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-14 |
sp|A4XZ68|RS13_PSEMY | 30S ribosomal protein S13 OS=Pseudomonas mendocina (strain ymp) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-14 |
sp|A8GKH6|RS13_SERP5 | 30S ribosomal protein S13 OS=Serratia proteamaculans (strain 568) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-14 |
sp|A2SLD4|RS13_METPP | 30S ribosomal protein S13 OS=Methylibium petroleiphilum (strain PM1) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-14 |
sp|A6UZL0|RS13_PSEA7 | 30S ribosomal protein S13 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-14 |
sp|Q6CZZ2|RS13_PECAS | 30S ribosomal protein S13 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-14 |
sp|C4ZBU3|RS13_EUBR3 | 30S ribosomal protein S13 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-14 |
sp|P0CE04|RS13_CHLTR | 30S ribosomal protein S13 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-14 |
sp|Q3KLI8|RS13_CHLTA | 30S ribosomal protein S13 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-14 |
sp|A3Q9A4|RS13_SHELP | 30S ribosomal protein S13 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-14 |
sp|C6DFS6|RS13_PECCP | 30S ribosomal protein S13 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-14 |
sp|B0BCE8|RS13_CHLTB | 30S ribosomal protein S13 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-14 |
sp|B0B883|RS13_CHLT2 | 30S ribosomal protein S13 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-14 |
sp|Q2JL76|RS13_SYNJB | 30S ribosomal protein S13 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-14 |
sp|B3PK59|RS13_CELJU | 30S ribosomal protein S13 OS=Cellvibrio japonicus (strain Ueda107) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-14 |
sp|Q057C6|RS13_BUCCC | 30S ribosomal protein S13 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-14 |
sp|C1DKN5|RS13_AZOVD | 30S ribosomal protein S13 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-14 |
sp|B8GV36|RS13_THISH | 30S ribosomal protein S13 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-14 |
sp|B9KZW3|RS13_THERP | 30S ribosomal protein S13 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-14 |
sp|B0U0W8|RS13_FRAP2 | 30S ribosomal protein S13 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-14 |
sp|B8CNF5|RS13_SHEPW | 30S ribosomal protein S13 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-14 |
sp|A8GYZ7|RS13_SHEPA | 30S ribosomal protein S13 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-14 |
sp|B0TLZ1|RS13_SHEHH | 30S ribosomal protein S13 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-14 |
sp|P44380|RS13_HAEIN | 30S ribosomal protein S13 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsM PE=3 SV=2 | 1 | 104 | 3.0E-14 |
sp|A1JS04|RS13_YERE8 | 30S ribosomal protein S13 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-14 |
sp|Q8DML1|RS13_THEEB | 30S ribosomal protein S13 OS=Thermosynechococcus elongatus (strain BP-1) GN=rpsM PE=3 SV=1 | 1 | 100 | 4.0E-14 |
sp|B1Y8B4|RS13_LEPCP | 30S ribosomal protein S13 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsM PE=3 SV=1 | 1 | 106 | 4.0E-14 |
sp|Q1LTB6|RS13_BAUCH | 30S ribosomal protein S13 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-14 |
sp|B4U769|RS13_HYDS0 | 30S ribosomal protein S13 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-14 |
sp|Q6YQZ7|RS13_ONYPE | 30S ribosomal protein S13 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-14 |
sp|A1KB04|RS13_AZOSB | 30S ribosomal protein S13 OS=Azoarcus sp. (strain BH72) GN=rpsM PE=3 SV=1 | 1 | 106 | 5.0E-14 |
sp|Q5E892|RS13_VIBF1 | 30S ribosomal protein S13 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsM PE=3 SV=1 | 1 | 106 | 5.0E-14 |
sp|A5UHV2|RS13_HAEIG | 30S ribosomal protein S13 OS=Haemophilus influenzae (strain PittGG) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-14 |
sp|A5UDS5|RS13_HAEIE | 30S ribosomal protein S13 OS=Haemophilus influenzae (strain PittEE) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-14 |
sp|Q4QMA0|RS13_HAEI8 | 30S ribosomal protein S13 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-14 |
sp|B1VAC3|RS13_PHYAS | 30S ribosomal protein S13 OS=Phytoplasma australiense GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-14 |
sp|Q7VKF5|RS13_HAEDU | 30S ribosomal protein S13 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-14 |
sp|Q4K554|RS13_PSEF5 | 30S ribosomal protein S13 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-14 |
sp|Q31IW1|RS13_THICR | 30S ribosomal protein S13 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsM PE=3 SV=1 | 1 | 103 | 7.0E-14 |
sp|C3K2V4|RS13_PSEFS | 30S ribosomal protein S13 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-14 |
sp|Q0VSI1|RS13_ALCBS | 30S ribosomal protein S13 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-14 |
sp|B0RZT3|RS13_FINM2 | 30S ribosomal protein S13 OS=Finegoldia magna (strain ATCC 29328) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-14 |
sp|Q7VQC6|RS13_BLOFL | 30S ribosomal protein S13 OS=Blochmannia floridanus GN=rpsM PE=3 SV=1 | 1 | 105 | 8.0E-14 |
sp|A4SSY4|RS13_AERS4 | 30S ribosomal protein S13 OS=Aeromonas salmonicida (strain A449) GN=rpsM PE=3 SV=1 | 1 | 104 | 9.0E-14 |
sp|A0KF42|RS13_AERHH | 30S ribosomal protein S13 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsM PE=3 SV=1 | 1 | 104 | 9.0E-14 |
sp|B8HMS6|RS13_CYAP4 | 30S ribosomal protein S13 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rpsM PE=3 SV=1 | 1 | 100 | 9.0E-14 |
sp|Q6LV94|RS13_PHOPR | 30S ribosomal protein S13 OS=Photobacterium profundum GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-13 |
sp|O66486|RS13_AQUAE | 30S ribosomal protein S13 OS=Aquifex aeolicus (strain VF5) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-13 |
sp|Q5GWV6|RS13_XANOR | 30S ribosomal protein S13 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsM PE=3 SV=2 | 1 | 104 | 1.0E-13 |
sp|B2SQT1|RS13_XANOP | 30S ribosomal protein S13 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-13 |
sp|Q2P006|RS13_XANOM | 30S ribosomal protein S13 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-13 |
sp|B0RU61|RS13_XANCB | 30S ribosomal protein S13 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-13 |
sp|Q4URG0|RS13_XANC8 | 30S ribosomal protein S13 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-13 |
sp|Q3BWW2|RS13_XANC5 | 30S ribosomal protein S13 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-13 |
sp|Q8NKX3|RS13_XANAC | 30S ribosomal protein S13 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-13 |
sp|Q8D1Z0|RS13_WIGBR | 30S ribosomal protein S13 OS=Wigglesworthia glossinidia brevipalpis GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-13 |
sp|Q5QXV5|RS13_IDILO | 30S ribosomal protein S13 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-13 |
sp|Q5FM67|RS13_LACAC | 30S ribosomal protein S13 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-13 |
sp|B2FQK5|RS13_STRMK | 30S ribosomal protein S13 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-13 |
sp|Q2NIX9|RS13_AYWBP | 30S ribosomal protein S13 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-13 |
sp|B4SLH2|RS13_STRM5 | 30S ribosomal protein S13 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-13 |
sp|B1JIY3|RS13_YERPY | 30S ribosomal protein S13 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q664U3|RS13_YERPS | 30S ribosomal protein S13 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|A4TH12|RS13_YERPP | 30S ribosomal protein S13 OS=Yersinia pestis (strain Pestoides F) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q1CCW5|RS13_YERPN | 30S ribosomal protein S13 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|A9R915|RS13_YERPG | 30S ribosomal protein S13 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q8ZJ90|RS13_YERPE | 30S ribosomal protein S13 OS=Yersinia pestis GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|B2K515|RS13_YERPB | 30S ribosomal protein S13 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q1C2W8|RS13_YERPA | 30S ribosomal protein S13 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|A7FNL3|RS13_YERP3 | 30S ribosomal protein S13 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q4ZMR5|RS13_PSEU2 | 30S ribosomal protein S13 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q889U9|RS13_PSESM | 30S ribosomal protein S13 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q48D58|RS13_PSE14 | 30S ribosomal protein S13 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|P26872|RT13_MARPO | Ribosomal protein S13, mitochondrial OS=Marchantia polymorpha GN=RPS13 PE=3 SV=2 | 1 | 116 | 2.0E-13 |
sp|Q7NQH4|RS13_CHRVO | 30S ribosomal protein S13 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q089N2|RS13_SHEFN | 30S ribosomal protein S13 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|A9B434|RS13_HERA2 | 30S ribosomal protein S13 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q2JUJ3|RS13_SYNJA | 30S ribosomal protein S13 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q0I083|RS13_SHESR | 30S ribosomal protein S13 OS=Shewanella sp. (strain MR-7) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q0HNR5|RS13_SHESM | 30S ribosomal protein S13 OS=Shewanella sp. (strain MR-4) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|A0KRP6|RS13_SHESA | 30S ribosomal protein S13 OS=Shewanella sp. (strain ANA-3) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|Q8EK48|RS13_SHEON | 30S ribosomal protein S13 OS=Shewanella oneidensis (strain MR-1) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-13 |
sp|A9KJG9|RS13_CLOPH | 30S ribosomal protein S13 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-13 |
sp|B0K5R8|RS13_THEPX | 30S ribosomal protein S13 OS=Thermoanaerobacter sp. (strain X514) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-13 |
sp|B0KCM5|RS13_THEP3 | 30S ribosomal protein S13 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-13 |
sp|B9L6U0|RS13_NAUPA | 30S ribosomal protein S13 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-13 |
sp|A1SXW5|RS13_PSYIN | 30S ribosomal protein S13 OS=Psychromonas ingrahamii (strain 37) GN=rpsM1 PE=3 SV=1 | 1 | 104 | 3.0E-13 |
sp|Q1R0F3|RS13_CHRSD | 30S ribosomal protein S13 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-13 |
sp|Q47J80|RS13_DECAR | 30S ribosomal protein S13 OS=Dechloromonas aromatica (strain RCB) GN=rpsM PE=3 SV=1 | 1 | 106 | 3.0E-13 |
sp|A4VHQ2|RS13_PSEU5 | 30S ribosomal protein S13 OS=Pseudomonas stutzeri (strain A1501) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-13 |
sp|A1W330|RS13_ACISJ | 30S ribosomal protein S13 OS=Acidovorax sp. (strain JS42) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-13 |
sp|B9MBV9|RS13_ACIET | 30S ribosomal protein S13 OS=Acidovorax ebreus (strain TPSY) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-13 |
sp|A8G1C8|RS13_SHESH | 30S ribosomal protein S13 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-13 |
sp|B8D0T4|RS13_HALOH | 30S ribosomal protein S13 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-13 |
sp|B2GDU5|RS13_LACF3 | 30S ribosomal protein S13 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-13 |
sp|B5Y963|RS13_COPPD | 30S ribosomal protein S13 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rpsM PE=3 SV=1 | 1 | 103 | 5.0E-13 |
sp|Q8R7X9|RS13_CALS4 | 30S ribosomal protein S13 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-13 |
sp|Q04BZ1|RS13_LACDB | 30S ribosomal protein S13 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-13 |
sp|Q1GBJ4|RS13_LACDA | 30S ribosomal protein S13 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-13 |
sp|B1GZA7|RS13_UNCTG | 30S ribosomal protein S13 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rpsM PE=3 SV=1 | 1 | 105 | 5.0E-13 |
sp|A1VJ37|RS13_POLNA | 30S ribosomal protein S13 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-13 |
sp|A1RED6|RS13_SHESW | 30S ribosomal protein S13 OS=Shewanella sp. (strain W3-18-1) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-13 |
sp|A4YBW1|RS13_SHEPC | 30S ribosomal protein S13 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-13 |
sp|A8YXM8|RS13_LACH4 | 30S ribosomal protein S13 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsM PE=3 SV=1 | 1 | 105 | 6.0E-13 |
sp|Q3IJK6|RS13_PSEHT | 30S ribosomal protein S13 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsM PE=3 SV=1 | 1 | 105 | 6.0E-13 |
sp|Q5P310|RS13_AROAE | 30S ribosomal protein S13 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsM PE=3 SV=1 | 1 | 105 | 6.0E-13 |
sp|Q12ST7|RS13_SHEDO | 30S ribosomal protein S13 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-13 |
sp|Q493I7|RS13_BLOPB | 30S ribosomal protein S13 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsM PE=3 SV=1 | 1 | 105 | 8.0E-13 |
sp|A5EX97|RS13_DICNV | 30S ribosomal protein S13 OS=Dichelobacter nodosus (strain VCS1703A) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-13 |
sp|Q2YAX5|RS13_NITMU | 30S ribosomal protein S13 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsM PE=3 SV=1 | 1 | 106 | 9.0E-13 |
sp|A3N379|RS13_ACTP2 | 30S ribosomal protein S13 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsM PE=3 SV=1 | 1 | 104 | 9.0E-13 |
sp|B1KMW1|RS13_SHEWM | 30S ribosomal protein S13 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsM PE=3 SV=1 | 1 | 104 | 9.0E-13 |
sp|Q4G349|RR13_EMIHU | 30S ribosomal protein S13, chloroplastic OS=Emiliania huxleyi GN=rps13 PE=3 SV=1 | 1 | 105 | 1.0E-12 |
sp|Q9Z3F0|RS13_XANCP | 30S ribosomal protein S13 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsM PE=3 SV=3 | 1 | 104 | 1.0E-12 |
sp|B2VK74|RS13_ERWT9 | 30S ribosomal protein S13 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-12 |
sp|Q21M36|RS13_SACD2 | 30S ribosomal protein S13 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-12 |
sp|Q0SQH0|RS13_CLOPS | 30S ribosomal protein S13 OS=Clostridium perfringens (strain SM101 / Type A) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-12 |
sp|Q8XHU8|RS13_CLOPE | 30S ribosomal protein S13 OS=Clostridium perfringens (strain 13 / Type A) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-12 |
sp|Q0TMS2|RS13_CLOP1 | 30S ribosomal protein S13 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-12 |
sp|A6TEV1|RS13_KLEP7 | 30S ribosomal protein S13 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-12 |
sp|B5XNB4|RS13_KLEP3 | 30S ribosomal protein S13 OS=Klebsiella pneumoniae (strain 342) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-12 |
sp|Q3J8T5|RS13_NITOC | 30S ribosomal protein S13 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpsM PE=3 SV=1 | 1 | 118 | 1.0E-12 |
sp|C5BQ83|RS13_TERTT | 30S ribosomal protein S13 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-12 |
sp|B8I805|RS13_CLOCE | 30S ribosomal protein S13 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-12 |
sp|Q9S0R1|RS13_SHEVD | 30S ribosomal protein S13 OS=Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|A6W370|RS13_MARMS | 30S ribosomal protein S13 OS=Marinomonas sp. (strain MWYL1) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-12 |
sp|A9KWC3|RS13_SHEB9 | 30S ribosomal protein S13 OS=Shewanella baltica (strain OS195) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|A6WHV0|RS13_SHEB8 | 30S ribosomal protein S13 OS=Shewanella baltica (strain OS185) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|A3DA50|RS13_SHEB5 | 30S ribosomal protein S13 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|B8EBI3|RS13_SHEB2 | 30S ribosomal protein S13 OS=Shewanella baltica (strain OS223) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|A1TJT9|RS13_ACIAC | 30S ribosomal protein S13 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|A5N4S2|RS13_CLOK5 | 30S ribosomal protein S13 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|B9DYD4|RS13_CLOK1 | 30S ribosomal protein S13 OS=Clostridium kluyveri (strain NBRC 12016) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|A9BRX2|RS13_DELAS | 30S ribosomal protein S13 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|B2ITN3|RS13_NOSP7 | 30S ribosomal protein S13 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpsM PE=3 SV=1 | 1 | 100 | 2.0E-12 |
sp|A1WK95|RS13_VEREI | 30S ribosomal protein S13 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|Q3Z956|RS13_DEHM1 | 30S ribosomal protein S13 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-12 |
sp|Q3MF99|RS13_ANAVT | 30S ribosomal protein S13 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsM PE=3 SV=1 | 1 | 100 | 2.0E-12 |
sp|A1ALW4|RS13_PELPD | 30S ribosomal protein S13 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-12 |
sp|Q5FU05|RS13_GLUOX | 30S ribosomal protein S13 OS=Gluconobacter oxydans (strain 621H) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-12 |
sp|Q8YPK1|RS13_NOSS1 | 30S ribosomal protein S13 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsM PE=3 SV=1 | 1 | 100 | 3.0E-12 |
sp|B3R7E6|RS13_CUPTR | 30S ribosomal protein S13 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-12 |
sp|Q1LI60|RS13_CUPMC | 30S ribosomal protein S13 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-12 |
sp|Q8EUD6|RS13_MYCPE | 30S ribosomal protein S13 OS=Mycoplasma penetrans (strain HF-2) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-12 |
sp|Q5NQ42|RS13_ZYMMO | 30S ribosomal protein S13 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsM PE=3 SV=2 | 1 | 104 | 3.0E-12 |
sp|Q46WG6|RS13_CUPPJ | 30S ribosomal protein S13 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsM PE=3 SV=1 | 1 | 105 | 4.0E-12 |
sp|Q0K642|RS13_CUPNH | 30S ribosomal protein S13 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsM PE=3 SV=1 | 1 | 105 | 4.0E-12 |
sp|Q74L66|RS13_LACJO | 30S ribosomal protein S13 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsM PE=3 SV=1 | 1 | 105 | 4.0E-12 |
sp|Q046A2|RS13_LACGA | 30S ribosomal protein S13 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsM PE=3 SV=1 | 1 | 105 | 4.0E-12 |
sp|B3E854|RS13_GEOLS | 30S ribosomal protein S13 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsM PE=3 SV=1 | 1 | 105 | 4.0E-12 |
sp|Q0ANS2|RS13_MARMM | 30S ribosomal protein S13 OS=Maricaulis maris (strain MCS10) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-12 |
sp|Q9PE55|RS13_XYLFA | 30S ribosomal protein S13 OS=Xylella fastidiosa (strain 9a5c) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-12 |
sp|A1B050|RS13_PARDP | 30S ribosomal protein S13 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsM PE=3 SV=2 | 1 | 104 | 5.0E-12 |
sp|Q7NFF2|RS13_GLOVI | 30S ribosomal protein S13 OS=Gloeobacter violaceus (strain PCC 7421) GN=rpsM PE=3 SV=1 | 1 | 100 | 5.0E-12 |
sp|Q1AU53|RS13_RUBXD | 30S ribosomal protein S13 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-12 |
sp|A5CXI6|RS13_VESOH | 30S ribosomal protein S13 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-12 |
sp|A5GVY1|RS13_SYNR3 | 30S ribosomal protein S13 OS=Synechococcus sp. (strain RCC307) GN=rpsM PE=3 SV=1 | 1 | 100 | 6.0E-12 |
sp|Q3ZZP9|RS13_DEHMC | 30S ribosomal protein S13 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-12 |
sp|A5FRW9|RS13_DEHMB | 30S ribosomal protein S13 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-12 |
sp|A8AZK1|RS13_STRGC | 30S ribosomal protein S13 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-12 |
sp|Q67JW8|RS13_SYMTH | 30S ribosomal protein S13 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-12 |
sp|Q0ABF3|RS13_ALKEH | 30S ribosomal protein S13 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-12 |
sp|B2G8V4|RS13_LACRJ | 30S ribosomal protein S13 OS=Lactobacillus reuteri (strain JCM 1112) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-12 |
sp|A5VLI1|RS13_LACRD | 30S ribosomal protein S13 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-12 |
sp|A3DJJ8|RS13_CLOTH | 30S ribosomal protein S13 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-12 |
sp|Q6F1W9|RS13_MESFL | 30S ribosomal protein S13 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-12 |
sp|Q0BUM8|RS13_GRABC | 30S ribosomal protein S13 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsM PE=3 SV=2 | 1 | 104 | 7.0E-12 |
sp|A4JAR3|RS13_BURVG | 30S ribosomal protein S13 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-12 |
sp|Q0BJ23|RS13_BURCM | 30S ribosomal protein S13 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-12 |
sp|B1YRQ2|RS13_BURA4 | 30S ribosomal protein S13 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-12 |
sp|P59754|RS13_ENTFA | 30S ribosomal protein S13 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsM PE=3 SV=1 | 1 | 103 | 8.0E-12 |
sp|Q39XY2|RS13_GEOMG | 30S ribosomal protein S13 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsM PE=3 SV=1 | 1 | 105 | 8.0E-12 |
sp|Q2L248|RS13_BORA1 | 30S ribosomal protein S13 OS=Bordetella avium (strain 197N) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-12 |
sp|P66391|RS13_STRA5 | 30S ribosomal protein S13 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpsM PE=3 SV=1 | 1 | 106 | 9.0E-12 |
sp|P66390|RS13_STRA3 | 30S ribosomal protein S13 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpsM PE=3 SV=1 | 1 | 106 | 9.0E-12 |
sp|Q3K3U6|RS13_STRA1 | 30S ribosomal protein S13 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpsM PE=3 SV=1 | 1 | 106 | 9.0E-12 |
sp|Q15X51|RS13_PSEA6 | 30S ribosomal protein S13 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsM PE=3 SV=1 | 1 | 104 | 9.0E-12 |
sp|Q3A9U1|RS13_CARHZ | 30S ribosomal protein S13 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsM PE=3 SV=1 | 1 | 104 | 9.0E-12 |
sp|Q7V9Y3|RS13_PROMA | 30S ribosomal protein S13 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpsM PE=3 SV=1 | 1 | 100 | 1.0E-11 |
sp|B0UHU7|RS13_METS4 | 30S ribosomal protein S13 OS=Methylobacterium sp. (strain 4-46) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-11 |
sp|A4J136|RS13_DESRM | 30S ribosomal protein S13 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-11 |
sp|A9ADL6|RS13_BURM1 | 30S ribosomal protein S13 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-11 |
sp|B4E5E3|RS13_BURCJ | 30S ribosomal protein S13 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-11 |
sp|A7IPP8|RS13_XANP2 | 30S ribosomal protein S13 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-11 |
sp|Q39KE4|RS13_BURL3 | 30S ribosomal protein S13 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-11 |
sp|A0K3P8|RS13_BURCH | 30S ribosomal protein S13 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-11 |
sp|B1JU45|RS13_BURCC | 30S ribosomal protein S13 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-11 |
sp|Q1BRX1|RS13_BURCA | 30S ribosomal protein S13 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-11 |
sp|C4LKZ4|RS13_CORK4 | 30S ribosomal protein S13 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|Q9RSJ9|RS13_DEIRA | 30S ribosomal protein S13 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|A6T3I1|RS13_JANMA | 30S ribosomal protein S13 OS=Janthinobacterium sp. (strain Marseille) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|B8IT33|RS13_METNO | 30S ribosomal protein S13 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|Q6ME44|RS13_PARUW | 30S ribosomal protein S13 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-11 |
sp|Q3A6M3|RS13_PELCD | 30S ribosomal protein S13 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|Q97EK3|RS13_CLOAB | 30S ribosomal protein S13 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-11 |
sp|B2JI42|RS13_BURP8 | 30S ribosomal protein S13 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|B0V6U4|RS13_ACIBY | 30S ribosomal protein S13 OS=Acinetobacter baumannii (strain AYE) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-11 |
sp|A3M962|RS13_ACIBT | 30S ribosomal protein S13 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-11 |
sp|B0VQU0|RS13_ACIBS | 30S ribosomal protein S13 OS=Acinetobacter baumannii (strain SDF) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-11 |
sp|B2HZ86|RS13_ACIBC | 30S ribosomal protein S13 OS=Acinetobacter baumannii (strain ACICU) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-11 |
sp|B7IA17|RS13_ACIB5 | 30S ribosomal protein S13 OS=Acinetobacter baumannii (strain AB0057) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-11 |
sp|B7GW24|RS13_ACIB3 | 30S ribosomal protein S13 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-11 |
sp|Q12G80|RS13_POLSJ | 30S ribosomal protein S13 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|A7HM27|RS13_FERNB | 30S ribosomal protein S13 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|B4UBC3|RS13_ANASK | 30S ribosomal protein S13 OS=Anaeromyxobacter sp. (strain K) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|Q2IJ63|RS13_ANADE | 30S ribosomal protein S13 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|Q21QP6|RS13_RHOFT | 30S ribosomal protein S13 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|C5CQ78|RS13_VARPS | 30S ribosomal protein S13 OS=Variovorax paradoxus (strain S110) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-11 |
sp|B0TC82|RS13_HELMI | 30S ribosomal protein S13 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-11 |
sp|Q1GK06|RS13_RUEST | 30S ribosomal protein S13 OS=Ruegeria sp. (strain TM1040) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-11 |
sp|B2IF93|RS13_BEII9 | 30S ribosomal protein S13 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-11 |
sp|B3EUJ9|RS13_AMOA5 | 30S ribosomal protein S13 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-11 |
sp|A5D5E5|RS13_PELTS | 30S ribosomal protein S13 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-11 |
sp|B8J884|RS13_ANAD2 | 30S ribosomal protein S13 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-11 |
sp|Q2RFS3|RS13_MOOTA | 30S ribosomal protein S13 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-11 |
sp|B2UEJ6|RS13_RALPJ | 30S ribosomal protein S13 OS=Ralstonia pickettii (strain 12J) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-11 |
sp|A9IHS0|RS13_BORPD | 30S ribosomal protein S13 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-11 |
sp|B8E1F7|RS13_DICTD | 30S ribosomal protein S13 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-11 |
sp|Q250K7|RS13_DESHY | 30S ribosomal protein S13 OS=Desulfitobacterium hafniense (strain Y51) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-11 |
sp|B8G1Z1|RS13_DESHD | 30S ribosomal protein S13 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-11 |
sp|B9M6F5|RS13_GEODF | 30S ribosomal protein S13 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-11 |
sp|A9W4R8|RS13_METEP | 30S ribosomal protein S13 OS=Methylobacterium extorquens (strain PA1) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-11 |
sp|B7L0S8|RS13_METC4 | 30S ribosomal protein S13 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-11 |
sp|Q6AP46|RS13_DESPS | 30S ribosomal protein S13 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpsM PE=3 SV=1 | 1 | 105 | 4.0E-11 |
sp|Q89A87|RS13_BUCBP | 30S ribosomal protein S13 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-11 |
sp|A7HBP2|RS13_ANADF | 30S ribosomal protein S13 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-11 |
sp|B3WAJ4|RS13_LACCB | 30S ribosomal protein S13 OS=Lactobacillus casei (strain BL23) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-11 |
sp|Q035A7|RS13_LACC3 | 30S ribosomal protein S13 OS=Lactobacillus casei (strain ATCC 334) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-11 |
sp|A4G9R6|RS13_HERAR | 30S ribosomal protein S13 OS=Herminiimonas arsenicoxydans GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-11 |
sp|Q87E61|RS13_XYLFT | 30S ribosomal protein S13 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-11 |
sp|B2I8J0|RS13_XYLF2 | 30S ribosomal protein S13 OS=Xylella fastidiosa (strain M23) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-11 |
sp|Q110C9|RS13_TRIEI | 30S ribosomal protein S13 OS=Trichodesmium erythraeum (strain IMS101) GN=rpsM PE=3 SV=1 | 1 | 100 | 4.0E-11 |
sp|C1CXD7|RS13_DEIDV | 30S ribosomal protein S13 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-11 |
sp|B8EIT3|RS13_METSB | 30S ribosomal protein S13 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-11 |
sp|Q63Q34|RS13_BURPS | 30S ribosomal protein S13 OS=Burkholderia pseudomallei (strain K96243) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|A3NEF6|RS13_BURP6 | 30S ribosomal protein S13 OS=Burkholderia pseudomallei (strain 668) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|Q3JMT6|RS13_BURP1 | 30S ribosomal protein S13 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|A3P090|RS13_BURP0 | 30S ribosomal protein S13 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|A1V880|RS13_BURMS | 30S ribosomal protein S13 OS=Burkholderia mallei (strain SAVP1) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|Q62GM8|RS13_BURMA | 30S ribosomal protein S13 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|A2S7J9|RS13_BURM9 | 30S ribosomal protein S13 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|A3MRX7|RS13_BURM7 | 30S ribosomal protein S13 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|Q8XV35|RS13_RALSO | 30S ribosomal protein S13 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsM PE=3 SV=1 | 1 | 105 | 5.0E-11 |
sp|Q2SU50|RS13_BURTA | 30S ribosomal protein S13 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|B5YDW7|RS13_DICT6 | 30S ribosomal protein S13 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|B0U5M0|RS13_XYLFM | 30S ribosomal protein S13 OS=Xylella fastidiosa (strain M12) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|Q18CI0|RS13_PEPD6 | 30S ribosomal protein S13 OS=Peptoclostridium difficile (strain 630) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-11 |
sp|B1Z771|RS13_METPB | 30S ribosomal protein S13 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-11 |
sp|B9DSX4|RS13_STRU0 | 30S ribosomal protein S13 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|Q6F7T4|RS13_ACIAD | 30S ribosomal protein S13 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsM PE=3 SV=1 | 1 | 105 | 6.0E-11 |
sp|B2TIK1|RS13_CLOBB | 30S ribosomal protein S13 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpsM PE=3 SV=1 | 1 | 105 | 6.0E-11 |
sp|B2UYD6|RS13_CLOBA | 30S ribosomal protein S13 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpsM PE=3 SV=1 | 1 | 105 | 6.0E-11 |
sp|B6IRS8|RS13_RHOCS | 30S ribosomal protein S13 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-11 |
sp|B5XJ60|RS13_STRPZ | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|P0DE69|RS13_STRPQ | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|Q48VS5|RS13_STRPM | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|A2RC38|RS13_STRPG | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|Q1J8Y9|RS13_STRPF | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|Q1JJ37|RS13_STRPD | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|Q1JNZ3|RS13_STRPC | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|Q1JE35|RS13_STRPB | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|P66396|RS13_STRP8 | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|Q5XEB1|RS13_STRP6 | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|P0DE68|RS13_STRP3 | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|P66394|RS13_STRP1 | 30S ribosomal protein S13 OS=Streptococcus pyogenes serotype M1 GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|B9KLB3|RS13_RHOSK | 30S ribosomal protein S13 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|Q3J5Q0|RS13_RHOS4 | 30S ribosomal protein S13 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|A3PGN3|RS13_RHOS1 | 30S ribosomal protein S13 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-11 |
sp|B7K226|RS13_CYAP8 | 30S ribosomal protein S13 OS=Cyanothece sp. (strain PCC 8801) GN=rpsM PE=3 SV=1 | 1 | 100 | 6.0E-11 |
sp|P46747|RT13_PROWI | Ribosomal protein S13, mitochondrial OS=Prototheca wickerhamii GN=RPS13 PE=3 SV=1 | 1 | 102 | 6.0E-11 |
sp|A1KRJ6|RS13_NEIMF | 30S ribosomal protein S13 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-11 |
sp|P66386|RS13_NEIMB | 30S ribosomal protein S13 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-11 |
sp|P66385|RS13_NEIMA | 30S ribosomal protein S13 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-11 |
sp|A9M3U3|RS13_NEIM0 | 30S ribosomal protein S13 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-11 |
sp|Q5F5U9|RS13_NEIG1 | 30S ribosomal protein S13 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-11 |
sp|Q1IX96|RS13_DEIGD | 30S ribosomal protein S13 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-11 |
sp|Q7VTA8|RS13_BORPE | 30S ribosomal protein S13 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-11 |
sp|Q7W2D2|RS13_BORPA | 30S ribosomal protein S13 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-11 |
sp|Q7WRA0|RS13_BORBR | 30S ribosomal protein S13 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-11 |
sp|A9BCM6|RS13_PROM4 | 30S ribosomal protein S13 OS=Prochlorococcus marinus (strain MIT 9211) GN=rpsM PE=3 SV=1 | 1 | 100 | 7.0E-11 |
sp|B0C432|RS13_ACAM1 | 30S ribosomal protein S13 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsM PE=3 SV=1 | 1 | 100 | 7.0E-11 |
sp|A4VSH6|RS13_STRSY | 30S ribosomal protein S13 OS=Streptococcus suis (strain 05ZYH33) GN=rpsM PE=3 SV=1 | 1 | 106 | 7.0E-11 |
sp|A4VYR6|RS13_STRS2 | 30S ribosomal protein S13 OS=Streptococcus suis (strain 98HAH33) GN=rpsM PE=3 SV=1 | 1 | 106 | 7.0E-11 |
sp|Q11HS4|RS13_CHESB | 30S ribosomal protein S13 OS=Chelativorans sp. (strain BNC1) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-11 |
sp|Q03PY1|RS13_LACBA | 30S ribosomal protein S13 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-11 |
sp|Q8UE39|RS13_AGRFC | 30S ribosomal protein S13 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsM PE=3 SV=2 | 1 | 104 | 8.0E-11 |
sp|P66382|RS13_BRUSU | 30S ribosomal protein S13 OS=Brucella suis biovar 1 (strain 1330) GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-11 |
sp|B0CH09|RS13_BRUSI | 30S ribosomal protein S13 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-11 |
sp|A5VQY4|RS13_BRUO2 | 30S ribosomal protein S13 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-11 |
sp|P66381|RS13_BRUME | 30S ribosomal protein S13 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-11 |
sp|C0RJH8|RS13_BRUMB | 30S ribosomal protein S13 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-11 |
sp|A9M5M7|RS13_BRUC2 | 30S ribosomal protein S13 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-11 |
sp|Q57CT0|RS13_BRUAB | 30S ribosomal protein S13 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-11 |
sp|Q2YRT8|RS13_BRUA2 | 30S ribosomal protein S13 OS=Brucella abortus (strain 2308) GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-11 |
sp|B2S657|RS13_BRUA1 | 30S ribosomal protein S13 OS=Brucella abortus (strain S19) GN=rpsM PE=3 SV=1 | 1 | 106 | 8.0E-11 |
sp|A5ELK5|RS13_BRASB | 30S ribosomal protein S13 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsM PE=3 SV=1 | 1 | 104 | 9.0E-11 |
sp|Q13TJ3|RS13_BURXL | 30S ribosomal protein S13 OS=Burkholderia xenovorans (strain LB400) GN=rpsM PE=3 SV=1 | 1 | 104 | 9.0E-11 |
sp|Q38UT5|RS13_LACSS | 30S ribosomal protein S13 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsM PE=3 SV=1 | 1 | 103 | 9.0E-11 |
sp|A0L5Z5|RS13_MAGMM | 30S ribosomal protein S13 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsM PE=3 SV=1 | 1 | 104 | 9.0E-11 |
sp|B5EM96|RS13_ACIF5 | 30S ribosomal protein S13 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsM PE=3 SV=1 | 1 | 105 | 9.0E-11 |
sp|B7J4A1|RS13_ACIF2 | 30S ribosomal protein S13 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsM PE=3 SV=1 | 1 | 105 | 9.0E-11 |
sp|A4YSL4|RS13_BRASO | 30S ribosomal protein S13 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsM PE=3 SV=1 | 1 | 104 | 9.0E-11 |
sp|A0LIL4|RS13_SYNFM | 30S ribosomal protein S13 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-10 |
sp|A9H3J7|RS13_GLUDA | 30S ribosomal protein S13 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-10 |
sp|C1CIC1|RS13_STRZP | 30S ribosomal protein S13 OS=Streptococcus pneumoniae (strain P1031) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-10 |
sp|C1CC30|RS13_STRZJ | 30S ribosomal protein S13 OS=Streptococcus pneumoniae (strain JJA) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-10 |
sp|P66393|RS13_STRR6 | 30S ribosomal protein S13 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-10 |
sp|B2IS65|RS13_STRPS | 30S ribosomal protein S13 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-10 |
sp|P66392|RS13_STRPN | 30S ribosomal protein S13 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-10 |
sp|B8ZKQ3|RS13_STRPJ | 30S ribosomal protein S13 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-10 |
sp|B1I8M2|RS13_STRPI | 30S ribosomal protein S13 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-10 |
sp|C1CAN6|RS13_STRP7 | 30S ribosomal protein S13 OS=Streptococcus pneumoniae (strain 70585) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-10 |
sp|Q04ML3|RS13_STRP2 | 30S ribosomal protein S13 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-10 |
sp|B1WQT3|RS13_CYAA5 | 30S ribosomal protein S13 OS=Cyanothece sp. (strain ATCC 51142) GN=rpsM PE=3 SV=1 | 1 | 100 | 1.0E-10 |
sp|Q1MIB9|RS13_RHIL3 | 30S ribosomal protein S13 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-10 |
sp|B2T728|RS13_BURPP | 30S ribosomal protein S13 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-10 |
sp|Q7V525|RS13_PROMM | 30S ribosomal protein S13 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsM PE=3 SV=1 | 1 | 100 | 1.0E-10 |
sp|A6LPT7|RS13_CLOB8 | 30S ribosomal protein S13 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-10 |
sp|A2CC49|RS13_PROM3 | 30S ribosomal protein S13 OS=Prochlorococcus marinus (strain MIT 9303) GN=rpsM PE=3 SV=1 | 1 | 100 | 1.0E-10 |
sp|A1WVA0|RS13_HALHL | 30S ribosomal protein S13 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-10 |
sp|A8G741|RS13_PROM2 | 30S ribosomal protein S13 OS=Prochlorococcus marinus (strain MIT 9215) GN=rpsM PE=3 SV=1 | 1 | 100 | 2.0E-10 |
sp|A3PF27|RS13_PROM0 | 30S ribosomal protein S13 OS=Prochlorococcus marinus (strain MIT 9301) GN=rpsM PE=3 SV=1 | 1 | 100 | 2.0E-10 |
sp|A5FZU3|RS13_ACICJ | 30S ribosomal protein S13 OS=Acidiphilium cryptum (strain JF-5) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|A6X0E0|RS13_OCHA4 | 30S ribosomal protein S13 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|A1AVM2|RS13_RUTMC | 30S ribosomal protein S13 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|Q73HA7|RS13_WOLPM | 30S ribosomal protein S13 OS=Wolbachia pipientis wMel GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|Q2RQY2|RS13_RHORT | 30S ribosomal protein S13 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|B8IYL4|RS13_DESDA | 30S ribosomal protein S13 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-10 |
sp|A2BTB7|RS13_PROMS | 30S ribosomal protein S13 OS=Prochlorococcus marinus (strain AS9601) GN=rpsM PE=3 SV=1 | 1 | 100 | 2.0E-10 |
sp|Q749B0|RS13_GEOSL | 30S ribosomal protein S13 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-10 |
sp|C0ME29|RS13_STRS7 | 30S ribosomal protein S13 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|B4U524|RS13_STREM | 30S ribosomal protein S13 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|C0M7C5|RS13_STRE4 | 30S ribosomal protein S13 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|Q3SSU4|RS13_NITWN | 30S ribosomal protein S13 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|Q50297|RS13_MYCPN | 30S ribosomal protein S13 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|Q890Q7|RS13_CLOTE | 30S ribosomal protein S13 OS=Clostridium tetani (strain Massachusetts / E88) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|B0JY40|RS13_MICAN | 30S ribosomal protein S13 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsM PE=3 SV=1 | 1 | 100 | 2.0E-10 |
sp|O24708|RS13_SYNP6 | 30S ribosomal protein S13 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsM PE=3 SV=1 | 1 | 100 | 2.0E-10 |
sp|Q31L28|RS13_SYNE7 | 30S ribosomal protein S13 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsM PE=3 SV=1 | 1 | 100 | 2.0E-10 |
sp|Q3AMQ1|RS13_SYNSC | 30S ribosomal protein S13 OS=Synechococcus sp. (strain CC9605) GN=rpsM PE=3 SV=1 | 1 | 100 | 2.0E-10 |
sp|A9IVZ8|RS13_BART1 | 30S ribosomal protein S13 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|A4WVI6|RS13_RHOS5 | 30S ribosomal protein S13 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|B9JVQ9|RS13_AGRVS | 30S ribosomal protein S13 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|Q5HSJ9|RS13_CAMJR | 30S ribosomal protein S13 OS=Campylobacter jejuni (strain RM1221) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|Q9PM83|RS13_CAMJE | 30S ribosomal protein S13 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|A7H5U2|RS13_CAMJD | 30S ribosomal protein S13 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|A8FNQ4|RS13_CAMJ8 | 30S ribosomal protein S13 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|Q8K971|RS13_BUCAP | 30S ribosomal protein S13 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsM PE=3 SV=1 | 1 | 105 | 2.0E-10 |
sp|Q03IH5|RS13_STRTD | 30S ribosomal protein S13 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|Q5M2D7|RS13_STRT2 | 30S ribosomal protein S13 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|Q5LXT5|RS13_STRT1 | 30S ribosomal protein S13 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|Q318K5|RS13_PROM9 | 30S ribosomal protein S13 OS=Prochlorococcus marinus (strain MIT 9312) GN=rpsM PE=3 SV=1 | 1 | 100 | 2.0E-10 |
sp|Q0BYD6|RS13_HYPNA | 30S ribosomal protein S13 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|Q9A8T1|RS13_CAUCR | 30S ribosomal protein S13 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|B8H4F6|RS13_CAUCN | 30S ribosomal protein S13 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsM PE=3 SV=1 | 1 | 104 | 2.0E-10 |
sp|Q8DS35|RS13_STRMU | 30S ribosomal protein S13 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsM PE=3 SV=1 | 1 | 106 | 2.0E-10 |
sp|A5GAU3|RS13_GEOUR | 30S ribosomal protein S13 OS=Geobacter uraniireducens (strain Rf4) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-10 |
sp|A1W1J4|RS13_CAMJJ | 30S ribosomal protein S13 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-10 |
sp|P47421|RS13_MYCGE | 30S ribosomal protein S13 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsM PE=3 SV=2 | 1 | 105 | 3.0E-10 |
sp|B0T2E4|RS13_CAUSK | 30S ribosomal protein S13 OS=Caulobacter sp. (strain K31) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-10 |
sp|A7HZX4|RS13_CAMHC | 30S ribosomal protein S13 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-10 |
sp|A3CK88|RS13_STRSV | 30S ribosomal protein S13 OS=Streptococcus sanguinis (strain SK36) GN=rpsM PE=3 SV=1 | 1 | 106 | 3.0E-10 |
sp|A6Q1K1|RS13_NITSB | 30S ribosomal protein S13 OS=Nitratiruptor sp. (strain SB155-2) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-10 |
sp|A1VE93|RS13_DESVV | 30S ribosomal protein S13 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-10 |
sp|Q72CF7|RS13_DESVH | 30S ribosomal protein S13 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsM PE=3 SV=1 | 1 | 105 | 3.0E-10 |
sp|C4Z2V4|RS13_EUBE2 | 30S ribosomal protein S13 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-10 |
sp|A0QSL5|RS13_MYCS2 | 30S ribosomal protein S13 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsM PE=1 SV=1 | 1 | 104 | 3.0E-10 |
sp|O50632|RS13_BACHD | 30S ribosomal protein S13 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsM PE=3 SV=1 | 1 | 106 | 3.0E-10 |
sp|B1I1M4|RS13_DESAP | 30S ribosomal protein S13 OS=Desulforudis audaxviator (strain MP104C) GN=rpsM PE=3 SV=1 | 1 | 104 | 3.0E-10 |
sp|A6TWF6|RS13_ALKMQ | 30S ribosomal protein S13 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-10 |
sp|Q0ID26|RS13_SYNS3 | 30S ribosomal protein S13 OS=Synechococcus sp. (strain CC9311) GN=rpsM PE=3 SV=1 | 1 | 100 | 4.0E-10 |
sp|B3PWU3|RS13_RHIE6 | 30S ribosomal protein S13 OS=Rhizobium etli (strain CIAT 652) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-10 |
sp|Q6FZE4|RS13_BARQU | 30S ribosomal protein S13 OS=Bartonella quintana (strain Toulouse) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-10 |
sp|Q46IT0|RS13_PROMT | 30S ribosomal protein S13 OS=Prochlorococcus marinus (strain NATL2A) GN=rpsM PE=3 SV=1 | 1 | 100 | 4.0E-10 |
sp|Q2K9J4|RS13_RHIEC | 30S ribosomal protein S13 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsM PE=3 SV=1 | 1 | 104 | 4.0E-10 |
sp|Q88XW2|RS13_LACPL | 30S ribosomal protein S13 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-10 |
sp|Q6G2Y7|RS13_BARHE | 30S ribosomal protein S13 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-10 |
sp|A4SUY3|RS13_POLSQ | 30S ribosomal protein S13 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-10 |
sp|Q5GSW5|RS13_WOLTR | 30S ribosomal protein S13 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpsM PE=3 SV=1 | 1 | 105 | 5.0E-10 |
sp|B1LWQ2|RS13_METRJ | 30S ribosomal protein S13 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-10 |
sp|B5ZZ55|RS13_RHILW | 30S ribosomal protein S13 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-10 |
sp|Q2SRH7|RS13_MYCCT | 30S ribosomal protein S13 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpsM PE=3 SV=1 | 1 | 104 | 5.0E-10 |
sp|Q03EE0|RS13_PEDPA | 30S ribosomal protein S13 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-10 |
sp|B9JDV0|RS13_AGRRK | 30S ribosomal protein S13 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpsM PE=3 SV=1 | 1 | 104 | 6.0E-10 |
sp|B5YG25|RS13_THEYD | 30S ribosomal protein S13 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsM PE=3 SV=1 | 1 | 106 | 6.0E-10 |
sp|A2C4X9|RS13_PROM1 | 30S ribosomal protein S13 OS=Prochlorococcus marinus (strain NATL1A) GN=rpsM PE=3 SV=1 | 1 | 100 | 6.0E-10 |
sp|Q4FUD4|RS13_PSYA2 | 30S ribosomal protein S13 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsM PE=3 SV=1 | 1 | 103 | 6.0E-10 |
sp|B7KI09|RS13_CYAP7 | 30S ribosomal protein S13 OS=Cyanothece sp. (strain PCC 7424) GN=rpsM PE=3 SV=1 | 1 | 100 | 6.0E-10 |
sp|A5WCL1|RS13_PSYWF | 30S ribosomal protein S13 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsM PE=3 SV=1 | 1 | 105 | 7.0E-10 |
sp|A9FGC9|RS13_SORC5 | 30S ribosomal protein S13 OS=Sorangium cellulosum (strain So ce56) GN=rpsM PE=3 SV=1 | 1 | 104 | 7.0E-10 |
sp|B7GJ92|RS13_ANOFW | 30S ribosomal protein S13 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsM PE=3 SV=1 | 1 | 103 | 7.0E-10 |
sp|A9NAZ2|RS13_COXBR | 30S ribosomal protein S13 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsM PE=3 SV=1 | 4 | 104 | 7.0E-10 |
sp|A9KD09|RS13_COXBN | 30S ribosomal protein S13 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsM PE=3 SV=1 | 4 | 104 | 7.0E-10 |
sp|B6J241|RS13_COXB2 | 30S ribosomal protein S13 OS=Coxiella burnetii (strain CbuG_Q212) GN=rpsM PE=3 SV=1 | 4 | 104 | 7.0E-10 |
sp|B6J5F4|RS13_COXB1 | 30S ribosomal protein S13 OS=Coxiella burnetii (strain CbuK_Q154) GN=rpsM PE=3 SV=1 | 4 | 104 | 7.0E-10 |
sp|A5GIS4|RS13_SYNPW | 30S ribosomal protein S13 OS=Synechococcus sp. (strain WH7803) GN=rpsM PE=3 SV=1 | 1 | 100 | 8.0E-10 |
sp|A1SNJ1|RS13_NOCSJ | 30S ribosomal protein S13 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpsM PE=3 SV=2 | 1 | 104 | 8.0E-10 |
sp|P59753|RS13_COXBU | 30S ribosomal protein S13 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsM PE=3 SV=1 | 4 | 106 | 8.0E-10 |
sp|Q16AC0|RS13_ROSDO | 30S ribosomal protein S13 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsM PE=3 SV=1 | 1 | 105 | 8.0E-10 |
sp|Q1QN08|RS13_NITHX | 30S ribosomal protein S13 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsM PE=3 SV=1 | 1 | 104 | 8.0E-10 |
sp|C6E4N3|RS13_GEOSM | 30S ribosomal protein S13 OS=Geobacter sp. (strain M21) GN=rpsM PE=3 SV=1 | 1 | 105 | 9.0E-10 |
sp|B5EFS4|RS13_GEOBB | 30S ribosomal protein S13 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpsM PE=3 SV=1 | 1 | 105 | 9.0E-10 |
sp|Q7VGC2|RS13_HELHP | 30S ribosomal protein S13 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsM PE=3 SV=1 | 1 | 103 | 9.0E-10 |
sp|P56020|RS13_HELPY | 30S ribosomal protein S13 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsM PE=3 SV=1 | 1 | 103 | 9.0E-10 |
sp|B2UV59|RS13_HELPS | 30S ribosomal protein S13 OS=Helicobacter pylori (strain Shi470) GN=rpsM PE=3 SV=1 | 1 | 103 | 9.0E-10 |
sp|Q1CRW4|RS13_HELPH | 30S ribosomal protein S13 OS=Helicobacter pylori (strain HPAG1) GN=rpsM PE=3 SV=1 | 1 | 103 | 9.0E-10 |
sp|B5Z8U5|RS13_HELPG | 30S ribosomal protein S13 OS=Helicobacter pylori (strain G27) GN=rpsM PE=3 SV=1 | 1 | 103 | 9.0E-10 |
sp|B6JND6|RS13_HELP2 | 30S ribosomal protein S13 OS=Helicobacter pylori (strain P12) GN=rpsM PE=3 SV=1 | 1 | 103 | 9.0E-10 |
sp|A2BYR5|RS13_PROM5 | 30S ribosomal protein S13 OS=Prochlorococcus marinus (strain MIT 9515) GN=rpsM PE=3 SV=1 | 1 | 100 | 9.0E-10 |
sp|Q7UZW4|RS13_PROMP | 30S ribosomal protein S13 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rpsM PE=3 SV=1 | 1 | 100 | 1.0E-09 |
sp|Q2G5A8|RS13_NOVAD | 30S ribosomal protein S13 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-09 |
sp|Q8ETW0|RS13_OCEIH | 30S ribosomal protein S13 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsM PE=3 SV=1 | 1 | 106 | 1.0E-09 |
sp|B9KEH3|RS13_CAMLR | 30S ribosomal protein S13 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-09 |
sp|C0ZIK5|RS13_BREBN | 30S ribosomal protein S13 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-09 |
sp|B1LBL5|RS13_THESQ | 30S ribosomal protein S13 OS=Thermotoga sp. (strain RQ2) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-09 |
sp|A5IMA8|RS13_THEP1 | 30S ribosomal protein S13 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-09 |
sp|Q9X1I5|RS13_THEMA | 30S ribosomal protein S13 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-09 |
sp|Q2N9D5|RS13_ERYLH | 30S ribosomal protein S13 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-09 |
sp|A9NEF8|RS13_ACHLI | 30S ribosomal protein S13 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsM PE=3 SV=1 | 1 | 103 | 1.0E-09 |
sp|P80377|RS13_THET8 | 30S ribosomal protein S13 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsM PE=1 SV=3 | 1 | 104 | 1.0E-09 |
sp|P62655|RS13_THET2 | 30S ribosomal protein S13 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsM PE=1 SV=2 | 1 | 104 | 1.0E-09 |
sp|B7IHX0|RS13_THEAB | 30S ribosomal protein S13 OS=Thermosipho africanus (strain TCF52B) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-09 |
sp|Q6MSP7|RS13_MYCMS | 30S ribosomal protein S13 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-09 |
sp|A0ALU4|RS13_LISW6 | 30S ribosomal protein S13 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsM PE=3 SV=1 | 1 | 103 | 1.0E-09 |
sp|A7HWT3|RS13_PARL1 | 30S ribosomal protein S13 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-09 |
sp|Q89JA6|RS13_BRADU | 30S ribosomal protein S13 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-09 |
sp|Q30TS6|RS13_SULDN | 30S ribosomal protein S13 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-09 |
sp|Q98N35|RS13_RHILO | 30S ribosomal protein S13 OS=Rhizobium loti (strain MAFF303099) GN=rpsM PE=3 SV=1 | 1 | 104 | 1.0E-09 |
sp|Q211H0|RS13_RHOPB | 30S ribosomal protein S13 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsM PE=3 SV=2 | 1 | 104 | 1.0E-09 |
sp|Q3AW72|RS13_SYNS9 | 30S ribosomal protein S13 OS=Synechococcus sp. (strain CC9902) GN=rpsM PE=3 SV=1 | 1 | 100 | 1.0E-09 |
sp|Q30Z65|RS13_DESAG | 30S ribosomal protein S13 OS=Desulfovibrio alaskensis (strain G20) GN=rpsM PE=3 SV=1 | 1 | 105 | 1.0E-09 |
sp|Q1QDG4|RS13_PSYCK | 30S ribosomal protein S13 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsM PE=3 SV=1 | 1 | 103 | 2.0E-09 |
sp|P66383|RS13_LISMO | 30S ribosomal protein S13 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsM PE=3 SV=1 | 1 | 103 | 2.0E-09 |
sp|B8DB32|RS13_LISMH | 30S ribosomal protein S13 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsM PE=3 SV=1 | 1 | 103 | 2.0E-09 |
sp|Q71WH0|RS13_LISMF | 30S ribosomal protein S13 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsM PE=3 SV=1 | 1 | 103 | 2.0E-09 |
sp|C1KZF7|RS13_LISMC | 30S ribosomal protein S13 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsM PE=3 SV=1 | 1 | 103 | 2.0E-09 |
GO Term | Description | Terminal node |
---|---|---|
GO:0006412 | translation | Yes |
GO:0003723 | RNA binding | Yes |
GO:0005840 | ribosome | Yes |
GO:0003735 | structural constituent of ribosome | Yes |
GO:1901363 | heterocyclic compound binding | No |
GO:0097159 | organic cyclic compound binding | No |
GO:0043229 | intracellular organelle | No |
GO:0003676 | nucleic acid binding | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0009059 | macromolecule biosynthetic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0005488 | binding | No |
GO:0019538 | protein metabolic process | No |
GO:0043226 | organelle | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0009058 | biosynthetic process | No |
GO:0043228 | non-membrane-bounded organelle | No |
GO:0008150 | biological_process | No |
GO:0034645 | cellular macromolecule biosynthetic process | No |
GO:0043232 | intracellular non-membrane-bounded organelle | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0043604 | amide biosynthetic process | No |
GO:0006518 | peptide metabolic process | No |
GO:0043170 | macromolecule metabolic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0005575 | cellular_component | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0003674 | molecular_function | No |
GO:0110165 | cellular anatomical entity | No |
GO:0044260 | cellular macromolecule metabolic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0044238 | primary metabolic process | No |
GO:0043603 | cellular amide metabolic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0005198 | structural molecule activity | No |
GO:0008152 | metabolic process | No |
GO:0043043 | peptide biosynthetic process | No |
GO:0009987 | cellular process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 31 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|1883 MVFILGINFDERRLVKKALQSFYSLGPIASDRIMAKFSIHKLAKLSSLTPKTVTSLTAELSQMTIGSDAKRLVQQ NIIRLKDNGSLRGRRHAMGLPVRGQRTRTQTVSANQFNQVERKH* |
Coding | >Hirsu2|1883 ATGGTTTTCATACTAGGAATCAATTTCGACGAAAGACGGCTCGTCAAGAAGGCTCTCCAGTCGTTCTATTCCCTC GGTCCGATTGCTTCCGACCGCATCATGGCCAAATTCTCGATACACAAACTGGCCAAACTCAGCTCCTTGACCCCG AAGACTGTCACCTCCCTCACGGCCGAGTTGTCCCAGATGACAATAGGATCGGATGCGAAGAGGCTAGTACAGCAA AATATCATCAGACTCAAGGATAATGGGTCGCTACGCGGTAGACGCCATGCTATGGGTCTGCCAGTGCGCGGCCAG AGGACGAGGACGCAGACGGTGTCAGCGAATCAGTTCAATCAGGTCGAACGCAAGCATTGA |
Transcript | >Hirsu2|1883 ATGGTTTTCATACTAGGAATCAATTTCGACGAAAGACGGCTCGTCAAGAAGGCTCTCCAGTCGTTCTATTCCCTC GGTCCGATTGCTTCCGACCGCATCATGGCCAAATTCTCGATACACAAACTGGCCAAACTCAGCTCCTTGACCCCG AAGACTGTCACCTCCCTCACGGCCGAGTTGTCCCAGATGACAATAGGATCGGATGCGAAGAGGCTAGTACAGCAA AATATCATCAGACTCAAGGATAATGGGTCGCTACGCGGTAGACGCCATGCTATGGGTCTGCCAGTGCGCGGCCAG AGGACGAGGACGCAGACGGTGTCAGCGAATCAGTTCAATCAGGTCGAACGCAAGCATTGA |
Gene | >Hirsu2|1883 ATGGTAGGACGCCGCTCATTTTGTAGCATTTCGATTCTTTTCTGATTGTTTTCTCTAGGTTTTCATACTAGGAAT CAATTTCGACGAAAGACGGCTCGTCAAGGTGAGAAATAGCCCCAACCAAGCTGTGCGACGAAGATAGTGAACTCG ATGGCTGACCGGGCGTTCGGGCTCCCTATCCAGAAGGCTCTCCAGTCGTTCTATTCCCTCGGTCCGATTGCTTCC GACCGCATCATGGCCAAATTCTCGATACACAAACTGGCCAAACTCAGCTCCTTGACCCCGAAGACTGTCACCTCC CTCACGGCCGAGTTGTCCCAGATGACAATAGGATCGGATGCGAAGAGGCTAGTACAGCAAAATATCATCAGACTC AAGGATAATGGGTCGCTACGCGGTAGACGCCATGCTATGGGTCTGCCAGTGCGCGGCCAGAGGACGAGGACGCAG ACGGTGTCAGCGAATCAGTTCAATCAGGTCGAACGCAAGCATTGA |