Protein ID | Hirsu2|1874 |
Gene name | |
Location | Contig_1428:5973..6697 |
Strand | - |
Gene length (bp) | 724 |
Transcript length (bp) | 639 |
Coding sequence length (bp) | 639 |
Protein length (aa) | 213 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00185 | OTCace | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain | 3.0E-42 | 45 | 202 |
PF02729 | OTCace_N | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain | 2.8E-07 | 1 | 31 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P11803|OTC_EMENI | Ornithine carbamoyltransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=argB PE=2 SV=1 | 1 | 211 | 7.0E-101 |
sp|P11066|OTC_ASPNG | Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus niger GN=argB PE=2 SV=1 | 1 | 211 | 3.0E-99 |
sp|P0CL21|OTC_COCIM | Ornithine carbamoyltransferase, mitochondrial OS=Coccidioides immitis (strain RS) GN=CIMG_04084 PE=1 SV=1 | 1 | 210 | 1.0E-97 |
sp|P0C2P3|OTC_ASPTN | Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=arg1 PE=3 SV=1 | 1 | 210 | 2.0E-97 |
sp|P0C2P2|OTC_ASPTE | Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus terreus GN=arg1 PE=3 SV=1 | 1 | 210 | 2.0E-97 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P11803|OTC_EMENI | Ornithine carbamoyltransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=argB PE=2 SV=1 | 1 | 211 | 7.0E-101 |
sp|P11066|OTC_ASPNG | Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus niger GN=argB PE=2 SV=1 | 1 | 211 | 3.0E-99 |
sp|P0CL21|OTC_COCIM | Ornithine carbamoyltransferase, mitochondrial OS=Coccidioides immitis (strain RS) GN=CIMG_04084 PE=1 SV=1 | 1 | 210 | 1.0E-97 |
sp|P0C2P3|OTC_ASPTN | Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=arg1 PE=3 SV=1 | 1 | 210 | 2.0E-97 |
sp|P0C2P2|OTC_ASPTE | Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus terreus GN=arg1 PE=3 SV=1 | 1 | 210 | 2.0E-97 |
sp|P31317|OTC_SCHPO | Ornithine carbamoyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg3 PE=1 SV=1 | 1 | 212 | 6.0E-67 |
sp|P14995|OTC_PACTA | Ornithine carbamoyltransferase, mitochondrial OS=Pachysolen tannophilus GN=OTC PE=3 SV=1 | 1 | 210 | 6.0E-66 |
sp|P05150|OTC_YEAST | Ornithine carbamoyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG3 PE=1 SV=1 | 5 | 211 | 4.0E-57 |
sp|Q9YHY9|OTC_CHICK | Ornithine carbamoyltransferase, mitochondrial OS=Gallus gallus GN=OTC PE=1 SV=1 | 1 | 206 | 6.0E-57 |
sp|P00481|OTC_RAT | Ornithine carbamoyltransferase, mitochondrial OS=Rattus norvegicus GN=Otc PE=1 SV=1 | 1 | 206 | 2.0E-56 |
sp|P11725|OTC_MOUSE | Ornithine carbamoyltransferase, mitochondrial OS=Mus musculus GN=Otc PE=1 SV=1 | 1 | 206 | 2.0E-56 |
sp|O19072|OTC_PIG | Ornithine carbamoyltransferase, mitochondrial (Fragment) OS=Sus scrofa GN=OTC PE=2 SV=1 | 1 | 206 | 7.0E-56 |
sp|P84010|OTC_SHEEP | Ornithine carbamoyltransferase, mitochondrial OS=Ovis aries GN=OTC PE=1 SV=1 | 1 | 206 | 6.0E-55 |
sp|P00480|OTC_HUMAN | Ornithine carbamoyltransferase, mitochondrial OS=Homo sapiens GN=OTC PE=1 SV=3 | 1 | 206 | 2.0E-54 |
sp|Q9N1U7|OTC_BOVIN | Ornithine carbamoyltransferase, mitochondrial OS=Bos taurus GN=OTC PE=2 SV=1 | 1 | 206 | 2.0E-54 |
sp|P31326|OTC_LITCT | Ornithine carbamoyltransferase, mitochondrial OS=Lithobates catesbeiana PE=2 SV=1 | 1 | 206 | 2.0E-53 |
sp|P78605|OTC_TRAHI | Ornithine carbamoyltransferase, mitochondrial OS=Trametes hirsuta PE=3 SV=1 | 1 | 203 | 2.0E-53 |
sp|A4XLM2|OTC_CALS8 | Ornithine carbamoyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=argF PE=3 SV=1 | 1 | 210 | 1.0E-49 |
sp|Q3A9W4|OTC_CARHZ | Ornithine carbamoyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=argF PE=3 SV=1 | 1 | 204 | 9.0E-47 |
sp|P18186|OTC_BACSU | Ornithine carbamoyltransferase OS=Bacillus subtilis (strain 168) GN=argF PE=1 SV=1 | 1 | 204 | 2.0E-46 |
sp|Q731G7|OTC_BACC1 | Ornithine carbamoyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=argF PE=3 SV=1 | 1 | 206 | 1.0E-44 |
sp|Q67JZ8|OTC_SYMTH | Ornithine carbamoyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=argF PE=3 SV=1 | 1 | 204 | 2.0E-44 |
sp|B9IXC5|OTC_BACCQ | Ornithine carbamoyltransferase OS=Bacillus cereus (strain Q1) GN=arcB PE=3 SV=1 | 1 | 206 | 3.0E-44 |
sp|B7HNP5|OTC_BACC7 | Ornithine carbamoyltransferase OS=Bacillus cereus (strain AH187) GN=arcB PE=3 SV=1 | 1 | 206 | 3.0E-44 |
sp|Q635F4|OTC_BACCZ | Ornithine carbamoyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=argF PE=3 SV=1 | 1 | 206 | 6.0E-44 |
sp|Q818W3|OTC_BACCR | Ornithine carbamoyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=argF PE=3 SV=1 | 1 | 206 | 1.0E-43 |
sp|Q18E28|OTC_HALWD | Ornithine carbamoyltransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=arcB PE=3 SV=1 | 1 | 204 | 2.0E-43 |
sp|Q81M99|OTC_BACAN | Ornithine carbamoyltransferase OS=Bacillus anthracis GN=argF PE=1 SV=1 | 1 | 206 | 6.0E-43 |
sp|C3LJQ5|OTC_BACAC | Ornithine carbamoyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=arcB PE=3 SV=1 | 1 | 206 | 6.0E-43 |
sp|C3P7R4|OTC_BACAA | Ornithine carbamoyltransferase OS=Bacillus anthracis (strain A0248) GN=arcB PE=3 SV=1 | 1 | 206 | 6.0E-43 |
sp|C1ER02|OTC_BACC3 | Ornithine carbamoyltransferase OS=Bacillus cereus (strain 03BB102) GN=arcB PE=3 SV=1 | 1 | 206 | 1.0E-42 |
sp|A0LUC1|OTC_ACIC1 | Ornithine carbamoyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=argF PE=3 SV=1 | 1 | 204 | 1.0E-42 |
sp|Q6HE32|OTC_BACHK | Ornithine carbamoyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=argF PE=3 SV=1 | 1 | 203 | 2.0E-42 |
sp|P96134|OTC_THET2 | Ornithine carbamoyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argF PE=1 SV=1 | 1 | 204 | 2.0E-42 |
sp|A0RR73|OTC_CAMFF | Ornithine carbamoyltransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=argF PE=3 SV=1 | 1 | 200 | 4.0E-42 |
sp|Q7NGR7|OTC_GLOVI | Ornithine carbamoyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=argF PE=1 SV=1 | 2 | 204 | 6.0E-42 |
sp|O58457|OTC_PYRHO | Ornithine carbamoyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=argF PE=3 SV=3 | 1 | 204 | 7.0E-42 |
sp|Q3J8G0|OTC_NITOC | Ornithine carbamoyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=argF PE=3 SV=1 | 1 | 205 | 1.0E-41 |
sp|Q9K8V8|OTC_BACHD | Ornithine carbamoyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argF PE=3 SV=1 | 1 | 205 | 3.0E-41 |
sp|O93656|OTC_PYRAB | Ornithine carbamoyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=argF PE=3 SV=4 | 1 | 204 | 4.0E-41 |
sp|Q5JI16|OTC_THEKO | Ornithine carbamoyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=argF PE=3 SV=1 | 1 | 205 | 6.0E-41 |
sp|A8ACB1|OTC_IGNH4 | Ornithine carbamoyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=arcB PE=3 SV=1 | 1 | 204 | 1.0E-40 |
sp|Q8G2L7|OTC_BRUSU | Ornithine carbamoyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=argF PE=3 SV=1 | 1 | 208 | 2.0E-40 |
sp|Q8TKT5|OTC_METAC | Ornithine carbamoyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=argF PE=3 SV=1 | 1 | 204 | 2.0E-40 |
sp|Q8YFA2|OTC_BRUME | Ornithine carbamoyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=argF PE=3 SV=2 | 1 | 208 | 2.0E-40 |
sp|Q57F56|OTC_BRUAB | Ornithine carbamoyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=argF PE=3 SV=1 | 1 | 208 | 2.0E-40 |
sp|Q2YPH2|OTC_BRUA2 | Ornithine carbamoyltransferase OS=Brucella abortus (strain 2308) GN=arcB PE=3 SV=1 | 1 | 208 | 2.0E-40 |
sp|O29013|OTC_ARCFU | Ornithine carbamoyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=argF PE=3 SV=1 | 1 | 204 | 2.0E-40 |
sp|A3CU82|OTC_METMJ | Ornithine carbamoyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=argF PE=3 SV=1 | 1 | 204 | 2.0E-40 |
sp|Q51742|OTC_PYRFU | Ornithine carbamoyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=argF PE=1 SV=6 | 1 | 205 | 5.0E-40 |
sp|Q465R0|OTC_METBF | Ornithine carbamoyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=argF PE=3 SV=1 | 1 | 204 | 5.0E-40 |
sp|B7GM02|OTC_ANOFW | Ornithine carbamoyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=argF PE=3 SV=1 | 1 | 204 | 5.0E-40 |
sp|Q59283|OTC_CORGL | Ornithine carbamoyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=argF PE=3 SV=2 | 1 | 209 | 6.0E-40 |
sp|A5VNP2|OTC_BRUO2 | Ornithine carbamoyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=argF PE=3 SV=1 | 1 | 208 | 6.0E-40 |
sp|Q2G3J8|OTC_NOVAD | Ornithine carbamoyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=argF PE=3 SV=1 | 1 | 200 | 3.0E-39 |
sp|A1ATU5|OTC_PELPD | Ornithine carbamoyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=argF PE=3 SV=1 | 1 | 204 | 3.0E-39 |
sp|Q7NWJ6|OTC_CHRVO | Ornithine carbamoyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=argF PE=3 SV=1 | 1 | 205 | 4.0E-39 |
sp|Q98BB6|OTC_RHILO | Ornithine carbamoyltransferase OS=Rhizobium loti (strain MAFF303099) GN=argF PE=3 SV=1 | 1 | 200 | 6.0E-39 |
sp|Q97C32|OTCC_THEVO | Ornithine carbamoyltransferase, catabolic OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=arcB PE=3 SV=1 | 1 | 204 | 7.0E-39 |
sp|Q74GU2|OTC_GEOSL | Ornithine carbamoyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=argF PE=3 SV=1 | 1 | 204 | 7.0E-39 |
sp|Q8Q0J1|OTC_METMA | Ornithine carbamoyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=argF PE=3 SV=2 | 1 | 204 | 1.0E-38 |
sp|Q71Z80|OTC_LISMF | Ornithine carbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argF PE=3 SV=1 | 1 | 204 | 1.0E-38 |
sp|Q6NHG6|OTC_CORDI | Ornithine carbamoyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=argF PE=3 SV=1 | 1 | 209 | 1.0E-38 |
sp|P11724|OTC_PSEAE | Ornithine carbamoyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argF PE=1 SV=3 | 1 | 204 | 2.0E-38 |
sp|O27495|OTC_METTH | Ornithine carbamoyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=argF PE=3 SV=1 | 1 | 204 | 3.0E-38 |
sp|A7ZCL8|OTC_CAMC1 | Ornithine carbamoyltransferase OS=Campylobacter concisus (strain 13826) GN=arcB PE=3 SV=1 | 1 | 195 | 5.0E-38 |
sp|Q39Z73|OTC_GEOMG | Ornithine carbamoyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=argF PE=3 SV=1 | 1 | 204 | 6.0E-38 |
sp|Q31I95|OTC_THICR | Ornithine carbamoyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=argF PE=3 SV=1 | 1 | 204 | 7.0E-38 |
sp|A2SQ85|OTC_METLZ | Ornithine carbamoyltransferase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=argF PE=3 SV=1 | 1 | 206 | 7.0E-38 |
sp|Q1H0L0|OTC_METFK | Ornithine carbamoyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=argF PE=3 SV=1 | 1 | 210 | 7.0E-38 |
sp|Q1QAR3|OTC_PSYCK | Ornithine carbamoyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=argF PE=3 SV=1 | 1 | 210 | 1.0E-37 |
sp|Q8Y6U5|OTC_LISMO | Ornithine carbamoyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argF PE=3 SV=1 | 1 | 204 | 1.0E-37 |
sp|B8DHF4|OTC_LISMH | Ornithine carbamoyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=arcB PE=3 SV=1 | 1 | 204 | 2.0E-37 |
sp|Q92BC1|OTC_LISIN | Ornithine carbamoyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argF PE=3 SV=1 | 1 | 207 | 2.0E-37 |
sp|Q3MB19|OTC_ANAVT | Ornithine carbamoyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=argF PE=3 SV=1 | 1 | 204 | 2.0E-37 |
sp|Q2FPP7|OTC_METHJ | Ornithine carbamoyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=argF PE=3 SV=1 | 1 | 204 | 2.0E-37 |
sp|Q9ZB62|OTC_GEOSE | Ornithine carbamoyltransferase OS=Geobacillus stearothermophilus GN=argF PE=3 SV=1 | 1 | 200 | 2.0E-37 |
sp|Q9YAE7|OTC_AERPE | Ornithine carbamoyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=argF PE=3 SV=2 | 1 | 204 | 3.0E-37 |
sp|Q39DI7|OTC_BURL3 | Ornithine carbamoyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=argF PE=3 SV=1 | 1 | 207 | 3.0E-37 |
sp|A1U324|OTC_MARHV | Ornithine carbamoyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=argF PE=3 SV=1 | 1 | 207 | 3.0E-37 |
sp|A5CSJ2|OTC_CLAM3 | Ornithine carbamoyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=argF PE=3 SV=1 | 1 | 200 | 3.0E-37 |
sp|Q8YMM6|OTC_NOSS1 | Ornithine carbamoyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argF PE=3 SV=1 | 1 | 204 | 4.0E-37 |
sp|A1WUZ6|OTC_HALHL | Ornithine carbamoyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=argF PE=3 SV=1 | 1 | 205 | 5.0E-37 |
sp|Q5P0Z8|OTC_AROAE | Ornithine carbamoyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=argF PE=3 SV=1 | 1 | 207 | 5.0E-37 |
sp|Q7M8B5|OTC_WOLSU | Ornithine carbamoyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argF PE=3 SV=1 | 1 | 193 | 6.0E-37 |
sp|Q7VAW6|OTC_PROMA | Ornithine carbamoyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argF PE=3 SV=1 | 5 | 193 | 7.0E-37 |
sp|A4T9W6|OTC_MYCGI | Ornithine carbamoyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=argF PE=3 SV=1 | 1 | 200 | 1.0E-36 |
sp|B4E9G6|OTC_BURCJ | Ornithine carbamoyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=arcB PE=3 SV=1 | 1 | 211 | 2.0E-36 |
sp|A0K9X6|OTC_BURCH | Ornithine carbamoyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=argF PE=3 SV=1 | 1 | 211 | 2.0E-36 |
sp|Q1BU60|OTC_BURCA | Ornithine carbamoyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=argF PE=3 SV=1 | 1 | 211 | 2.0E-36 |
sp|A5WDJ2|OTC_PSYWF | Ornithine carbamoyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=argF PE=3 SV=1 | 1 | 210 | 2.0E-36 |
sp|Q3SVB0|OTC_NITWN | Ornithine carbamoyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=argF PE=3 SV=1 | 1 | 200 | 2.0E-36 |
sp|Q58291|OTC_METJA | Ornithine carbamoyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=argF PE=3 SV=1 | 1 | 193 | 2.0E-36 |
sp|Q0C4M2|OTC_HYPNA | Ornithine carbamoyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=argF PE=3 SV=1 | 1 | 200 | 2.0E-36 |
sp|B0RHD4|OTC_CLAMS | Ornithine carbamoyltransferase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=argF PE=3 SV=1 | 1 | 200 | 2.0E-36 |
sp|Q8FTN1|OTC_COREF | Ornithine carbamoyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=argF PE=3 SV=1 | 1 | 207 | 2.0E-36 |
sp|Q6N0J0|OTC_RHOPA | Ornithine carbamoyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=argF PE=3 SV=1 | 1 | 200 | 3.0E-36 |
sp|Q1QVM7|OTC_CHRSD | Ornithine carbamoyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=argF PE=3 SV=1 | 2 | 207 | 4.0E-36 |
sp|Q89VE8|OTC_BRADU | Ornithine carbamoyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=argF PE=3 SV=1 | 1 | 200 | 5.0E-36 |
sp|Q7VTJ8|OTC_BORPE | Ornithine carbamoyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argF PE=3 SV=1 | 1 | 207 | 5.0E-36 |
sp|Q7W7H7|OTC_BORPA | Ornithine carbamoyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argF PE=3 SV=1 | 1 | 207 | 5.0E-36 |
sp|Q7WKW6|OTC_BORBR | Ornithine carbamoyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argF PE=3 SV=1 | 1 | 207 | 5.0E-36 |
sp|Q30YB7|OTC_DESAG | Ornithine carbamoyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=argF PE=3 SV=1 | 1 | 201 | 6.0E-36 |
sp|Q6AR58|OTC_DESPS | Ornithine carbamoyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=argF PE=3 SV=1 | 1 | 204 | 7.0E-36 |
sp|Q7VHJ0|OTC_HELHP | Ornithine carbamoyltransferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=argF PE=3 SV=1 | 1 | 207 | 7.0E-36 |
sp|Q47BL9|OTC_DECAR | Ornithine carbamoyltransferase OS=Dechloromonas aromatica (strain RCB) GN=argF PE=3 SV=1 | 1 | 211 | 1.0E-35 |
sp|Q4FT48|OTC_PSYA2 | Ornithine carbamoyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=argF PE=3 SV=1 | 1 | 210 | 1.0E-35 |
sp|A0RUE9|OTC_CENSY | Ornithine carbamoyltransferase OS=Cenarchaeum symbiosum (strain A) GN=argF PE=3 SV=1 | 1 | 203 | 2.0E-35 |
sp|Q46XK9|OTC_CUPPJ | Ornithine carbamoyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=argF PE=3 SV=1 | 1 | 207 | 2.0E-35 |
sp|C1ASZ8|OTC_RHOOB | Ornithine carbamoyltransferase OS=Rhodococcus opacus (strain B4) GN=arcB PE=3 SV=1 | 1 | 207 | 2.0E-35 |
sp|Q8ET05|OTC_OCEIH | Ornithine carbamoyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=argF PE=3 SV=1 | 1 | 204 | 2.0E-35 |
sp|Q1MLV9|OTC_RHIL3 | Ornithine carbamoyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=argF PE=3 SV=1 | 1 | 200 | 3.0E-35 |
sp|Q82UP4|OTC_NITEU | Ornithine carbamoyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argF PE=3 SV=1 | 1 | 210 | 3.0E-35 |
sp|A7GZL8|OTC_CAMC5 | Ornithine carbamoyltransferase OS=Campylobacter curvus (strain 525.92) GN=arcB PE=3 SV=1 | 1 | 195 | 3.0E-35 |
sp|Q9A653|OTC_CAUCR | Ornithine carbamoyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argF PE=3 SV=1 | 5 | 200 | 3.0E-35 |
sp|Q63WM2|OTC_BURPS | Ornithine carbamoyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=argF PE=3 SV=1 | 1 | 207 | 4.0E-35 |
sp|Q62M76|OTC_BURMA | Ornithine carbamoyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=argF PE=3 SV=1 | 1 | 207 | 4.0E-35 |
sp|Q07GY2|OTC_RHOP5 | Ornithine carbamoyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=argF PE=3 SV=1 | 1 | 200 | 4.0E-35 |
sp|O50039|OTC_ARATH | Ornithine carbamoyltransferase, chloroplastic OS=Arabidopsis thaliana GN=OTC PE=1 SV=2 | 1 | 204 | 5.0E-35 |
sp|Q2KZD0|OTC_BORA1 | Ornithine carbamoyltransferase OS=Bordetella avium (strain 197N) GN=argF PE=3 SV=1 | 1 | 205 | 5.0E-35 |
sp|A1K7J9|OTC_AZOSB | Ornithine carbamoyltransferase OS=Azoarcus sp. (strain BH72) GN=arcB PE=3 SV=1 | 1 | 207 | 5.0E-35 |
sp|A0QHB0|OTC_MYCA1 | Ornithine carbamoyltransferase OS=Mycobacterium avium (strain 104) GN=argF PE=3 SV=1 | 1 | 204 | 5.0E-35 |
sp|Q740I5|OTC_MYCPA | Ornithine carbamoyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=argF PE=3 SV=1 | 1 | 204 | 6.0E-35 |
sp|A4G3H2|OTC_HERAR | Ornithine carbamoyltransferase OS=Herminiimonas arsenicoxydans GN=argF PE=3 SV=1 | 1 | 207 | 7.0E-35 |
sp|B0V6G5|OTC_ACIBY | Ornithine carbamoyltransferase OS=Acinetobacter baumannii (strain AYE) GN=arcB PE=3 SV=1 | 1 | 204 | 8.0E-35 |
sp|A1TLB7|OTC_ACIAC | Ornithine carbamoyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=argF PE=3 SV=1 | 1 | 207 | 8.0E-35 |
sp|Q8DJW4|OTC_THEEB | Ornithine carbamoyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=argF PE=3 SV=1 | 1 | 205 | 9.0E-35 |
sp|A6QC22|OTC_SULNB | Ornithine carbamoyltransferase OS=Sulfurovum sp. (strain NBC37-1) GN=argF PE=3 SV=1 | 1 | 195 | 1.0E-34 |
sp|A3M663|OTC_ACIBT | Ornithine carbamoyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=argF PE=3 SV=2 | 1 | 204 | 1.0E-34 |
sp|Q1LJA1|OTC_CUPMC | Ornithine carbamoyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=argF PE=3 SV=1 | 1 | 207 | 1.0E-34 |
sp|Q5N1N8|OTC_SYNP6 | Ornithine carbamoyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argF PE=3 SV=1 | 2 | 204 | 2.0E-34 |
sp|Q935Y4|OTC_SYNE7 | Ornithine carbamoyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=argF PE=3 SV=5 | 2 | 204 | 2.0E-34 |
sp|Q8UI70|OTC_AGRFC | Ornithine carbamoyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=argF PE=3 SV=1 | 1 | 200 | 2.0E-34 |
sp|O67607|OTC_AQUAE | Ornithine carbamoyltransferase OS=Aquifex aeolicus (strain VF5) GN=argF PE=3 SV=1 | 1 | 203 | 2.0E-34 |
sp|A8F7Z9|OTC_PSELT | Ornithine carbamoyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=argF PE=3 SV=1 | 1 | 205 | 3.0E-34 |
sp|Q6L135|OTC_PICTO | Ornithine carbamoyltransferase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=argF PE=3 SV=1 | 1 | 204 | 4.0E-34 |
sp|Q0SI56|OTC_RHOJR | Ornithine carbamoyltransferase OS=Rhodococcus jostii (strain RHA1) GN=argF PE=3 SV=1 | 1 | 207 | 4.0E-34 |
sp|A9ERU2|OTC_SORC5 | Ornithine carbamoyltransferase OS=Sorangium cellulosum (strain So ce56) GN=argF PE=3 SV=1 | 5 | 193 | 4.0E-34 |
sp|A0QYS8|OTC_MYCS2 | Ornithine carbamoyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=argF PE=1 SV=1 | 1 | 200 | 4.0E-34 |
sp|A3DL27|OTC_STAMF | Ornithine carbamoyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=arcB PE=3 SV=1 | 1 | 205 | 4.0E-34 |
sp|Q8TWG4|OTC_METKA | Ornithine carbamoyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=argF PE=3 SV=1 | 1 | 204 | 4.0E-34 |
sp|Q92S99|OTC_RHIME | Ornithine carbamoyltransferase OS=Rhizobium meliloti (strain 1021) GN=argF PE=3 SV=1 | 1 | 200 | 5.0E-34 |
sp|Q43814|OTC_PEA | Ornithine carbamoyltransferase, chloroplastic OS=Pisum sativum GN=ARGF PE=2 SV=1 | 1 | 200 | 5.0E-34 |
sp|A2BM26|OTC_HYPBU | Ornithine carbamoyltransferase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=argF PE=3 SV=1 | 1 | 200 | 6.0E-34 |
sp|Q1QQG6|OTC_NITHX | Ornithine carbamoyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=argF PE=3 SV=1 | 1 | 200 | 7.0E-34 |
sp|B3R6D6|OTC_CUPTR | Ornithine carbamoyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=arcB PE=3 SV=1 | 1 | 207 | 1.0E-33 |
sp|Q30TL4|OTC_SULDN | Ornithine carbamoyltransferase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=argF PE=3 SV=1 | 1 | 195 | 1.0E-33 |
sp|A1VEP9|OTC_DESVV | Ornithine carbamoyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=argF PE=3 SV=1 | 1 | 201 | 1.0E-33 |
sp|Q72D35|OTC_DESVH | Ornithine carbamoyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=argF PE=3 SV=1 | 1 | 201 | 1.0E-33 |
sp|Q0AEE3|OTC_NITEC | Ornithine carbamoyltransferase OS=Nitrosomonas eutropha (strain C91) GN=argF PE=3 SV=1 | 1 | 210 | 1.0E-33 |
sp|O87319|OTC_NOSP7 | Ornithine carbamoyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=argF PE=3 SV=2 | 1 | 204 | 2.0E-33 |
sp|Q606D8|OTC_METCA | Ornithine carbamoyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=argF PE=3 SV=1 | 1 | 205 | 2.0E-33 |
sp|Q6FCH8|OTC_ACIAD | Ornithine carbamoyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=argF PE=3 SV=1 | 1 | 204 | 2.0E-33 |
sp|Q48296|OTCC_HALSA | Ornithine carbamoyltransferase, catabolic OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arcB PE=1 SV=1 | 1 | 204 | 2.0E-33 |
sp|A5UMK3|OTC_METS3 | Ornithine carbamoyltransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=argF PE=3 SV=1 | 1 | 200 | 2.0E-33 |
sp|Q2LT98|OTC_SYNAS | Ornithine carbamoyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=argF PE=3 SV=1 | 1 | 204 | 3.0E-33 |
sp|A5V656|OTC_SPHWW | Ornithine carbamoyltransferase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=argF PE=3 SV=1 | 1 | 200 | 4.0E-33 |
sp|Q8XWC0|OTC_RALSO | Ornithine carbamoyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=argF PE=3 SV=1 | 1 | 207 | 4.0E-33 |
sp|B2UBA4|OTC_RALPJ | Ornithine carbamoyltransferase OS=Ralstonia pickettii (strain 12J) GN=arcB PE=3 SV=1 | 1 | 207 | 5.0E-33 |
sp|Q55497|OTC_SYNY3 | Ornithine carbamoyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argF PE=3 SV=1 | 1 | 204 | 5.0E-33 |
sp|Q97ZM1|OTC_SULSO | Ornithine carbamoyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=argF PE=3 SV=1 | 1 | 204 | 8.0E-33 |
sp|B7GTP2|OTC_BIFLS | Ornithine carbamoyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=arcB PE=3 SV=1 | 1 | 204 | 8.0E-33 |
sp|Q9CEY4|PTC_LACLA | Putrescine carbamoyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ptcA PE=3 SV=1 | 1 | 212 | 8.0E-33 |
sp|P59778|OTC_BIFLO | Ornithine carbamoyltransferase OS=Bifidobacterium longum (strain NCC 2705) GN=argF PE=3 SV=1 | 1 | 204 | 8.0E-33 |
sp|Q2NI83|OTC_METST | Ornithine carbamoyltransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=argF PE=3 SV=1 | 1 | 200 | 1.0E-32 |
sp|Q88NX4|OTC_PSEPK | Ornithine carbamoyltransferase OS=Pseudomonas putida (strain KT2440) GN=argF PE=3 SV=3 | 1 | 204 | 1.0E-32 |
sp|Q7UQZ6|OTC_RHOBA | Ornithine carbamoyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=argF PE=3 SV=1 | 1 | 204 | 1.0E-32 |
sp|Q9HIK9|OTCC_THEAC | Ornithine carbamoyltransferase, catabolic OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=arcB PE=3 SV=2 | 1 | 204 | 1.0E-32 |
sp|Q02047|OTC1_PSESH | Ornithine carbamoyltransferase 1, phaseolotoxin-sensitive OS=Pseudomonas savastanoi pv. phaseolicola GN=argF PE=1 SV=3 | 1 | 204 | 2.0E-32 |
sp|Q6AGC9|OTC_LEIXX | Ornithine carbamoyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=argF PE=3 SV=1 | 5 | 207 | 3.0E-32 |
sp|Q971Y3|OTC_SULTO | Ornithine carbamoyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=argF PE=3 SV=1 | 1 | 204 | 3.0E-32 |
sp|Q3A1V3|OTC_PELCD | Ornithine carbamoyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=argF PE=3 SV=1 | 1 | 204 | 5.0E-32 |
sp|Q7U5V5|OTC_SYNPX | Ornithine carbamoyltransferase OS=Synechococcus sp. (strain WH8102) GN=argF PE=3 SV=1 | 5 | 204 | 5.0E-32 |
sp|A6Q1W6|OTC_NITSB | Ornithine carbamoyltransferase OS=Nitratiruptor sp. (strain SB155-2) GN=argF PE=3 SV=1 | 1 | 195 | 5.0E-32 |
sp|Q9RY70|OTC_DEIRA | Ornithine carbamoyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=argF PE=3 SV=2 | 1 | 200 | 7.0E-32 |
sp|Q9CC11|OTC_MYCLE | Ornithine carbamoyltransferase OS=Mycobacterium leprae (strain TN) GN=argF PE=3 SV=2 | 1 | 200 | 7.0E-32 |
sp|A6UTW9|OTC_META3 | Ornithine carbamoyltransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=argF PE=3 SV=1 | 1 | 203 | 9.0E-32 |
sp|Q6LZS1|OTC_METMP | Ornithine carbamoyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=argF PE=3 SV=1 | 1 | 203 | 1.0E-31 |
sp|Q87XL4|OTC_PSESM | Ornithine carbamoyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argF PE=3 SV=3 | 1 | 204 | 1.0E-31 |
sp|Q9PNU6|OTC_CAMJE | Ornithine carbamoyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=argF PE=1 SV=1 | 1 | 209 | 2.0E-31 |
sp|A1VZY2|OTC_CAMJJ | Ornithine carbamoyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=argF PE=3 SV=1 | 1 | 209 | 2.0E-31 |
sp|Q5HUG8|OTC_CAMJR | Ornithine carbamoyltransferase OS=Campylobacter jejuni (strain RM1221) GN=argF PE=3 SV=1 | 1 | 209 | 2.0E-31 |
sp|A1AWA3|OTC_RUTMC | Ornithine carbamoyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=argF PE=3 SV=1 | 1 | 204 | 4.0E-31 |
sp|A8FM43|OTC_CAMJ8 | Ornithine carbamoyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=arcB PE=3 SV=1 | 1 | 209 | 4.0E-31 |
sp|A0PP77|OTC_MYCUA | Ornithine carbamoyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=argF PE=3 SV=1 | 1 | 209 | 8.0E-31 |
sp|Q8KDE2|OTC_CHLTE | Ornithine carbamoyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argF PE=3 SV=1 | 1 | 204 | 8.0E-31 |
sp|P96108|OTC_THEMA | Ornithine carbamoyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=argF PE=1 SV=2 | 1 | 192 | 1.0E-30 |
sp|A6VJK4|OTC_METM7 | Ornithine carbamoyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=argF PE=3 SV=1 | 1 | 203 | 2.0E-30 |
sp|A8LE44|OTC_FRASN | Ornithine carbamoyltransferase OS=Frankia sp. (strain EAN1pec) GN=argF PE=3 SV=1 | 1 | 204 | 3.0E-30 |
sp|A9WQ88|OTC_RENSM | Ornithine carbamoyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=argF PE=3 SV=1 | 1 | 204 | 3.0E-30 |
sp|A7I3W8|OTC_CAMHC | Ornithine carbamoyltransferase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=argF PE=3 SV=1 | 1 | 195 | 3.0E-30 |
sp|A4FYS5|OTC_METM5 | Ornithine carbamoyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=argF PE=3 SV=1 | 1 | 203 | 4.0E-30 |
sp|P9WIT9|OTC_MYCTU | Ornithine carbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=argF PE=1 SV=1 | 1 | 200 | 5.0E-30 |
sp|P9WIT8|OTC_MYCTO | Ornithine carbamoyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=argF PE=3 SV=1 | 1 | 200 | 5.0E-30 |
sp|A5U313|OTC_MYCTA | Ornithine carbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=argF PE=3 SV=1 | 1 | 200 | 5.0E-30 |
sp|A1KJ73|OTC_MYCBP | Ornithine carbamoyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=argF PE=3 SV=1 | 1 | 200 | 5.0E-30 |
sp|P0A5M9|OTC_MYCBO | Ornithine carbamoyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=argF PE=1 SV=1 | 1 | 200 | 5.0E-30 |
sp|Q8ZW40|OTC_PYRAE | Ornithine carbamoyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=argF PE=3 SV=3 | 1 | 204 | 6.0E-30 |
sp|Q0SM07|OTC_BORAP | Ornithine carbamoyltransferase OS=Borrelia afzelii (strain PKo) GN=arcB PE=3 SV=1 | 1 | 200 | 7.0E-30 |
sp|O51897|OTCC_BORAF | Ornithine carbamoyltransferase, catabolic OS=Borrelia afzelii GN=arcB PE=3 SV=1 | 1 | 200 | 7.0E-30 |
sp|A5IN78|OTC_THEP1 | Ornithine carbamoyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=argF PE=3 SV=1 | 1 | 192 | 7.0E-30 |
sp|P68747|OTC2_PSESH | Ornithine carbamoyltransferase 2, phaseolotoxin-insensitive OS=Pseudomonas savastanoi pv. phaseolicola GN=argK PE=1 SV=2 | 1 | 205 | 8.0E-30 |
sp|P68746|OTC2_PSESF | Ornithine carbamoyltransferase 2, phaseolotoxin-insensitive OS=Pseudomonas syringae pv. actinidiae GN=argK PE=3 SV=2 | 1 | 205 | 8.0E-30 |
sp|A1RVH4|OTC_PYRIL | Ornithine carbamoyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=argF PE=3 SV=1 | 1 | 204 | 8.0E-30 |
sp|A3MWJ5|OTC_PYRCJ | Ornithine carbamoyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=argF PE=3 SV=1 | 1 | 207 | 1.0E-29 |
sp|Q7V0J3|OTC_PROMP | Ornithine carbamoyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argF PE=3 SV=1 | 5 | 204 | 1.0E-29 |
sp|Q8DW19|PTC_STRMU | Putrescine carbamoyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ptcA PE=1 SV=1 | 1 | 204 | 1.0E-29 |
sp|O86132|OTCC_BACLD | Ornithine carbamoyltransferase, catabolic OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-29 |
sp|Q8EK29|OTC_SHEON | Ornithine carbamoyltransferase OS=Shewanella oneidensis (strain MR-1) GN=argF PE=3 SV=1 | 1 | 203 | 4.0E-29 |
sp|A1B3N7|OTC_PARDP | Ornithine carbamoyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=argF PE=3 SV=1 | 1 | 200 | 8.0E-29 |
sp|A7H345|OTC_CAMJD | Ornithine carbamoyltransferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=arcB PE=3 SV=1 | 1 | 209 | 9.0E-29 |
sp|Q4J8Z2|OTC_SULAC | Ornithine carbamoyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=argF PE=3 SV=1 | 1 | 204 | 9.0E-29 |
sp|Q8RCA4|OTC_CALS4 | Ornithine carbamoyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argF PE=3 SV=1 | 1 | 205 | 2.0E-28 |
sp|B9KMW0|OTC_RHOSK | Ornithine carbamoyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=arcB PE=3 SV=1 | 1 | 200 | 2.0E-28 |
sp|Q7V8G9|OTC_PROMM | Ornithine carbamoyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=argF PE=3 SV=1 | 5 | 204 | 2.0E-28 |
sp|B7J0T6|OTC_BORBZ | Ornithine carbamoyltransferase OS=Borrelia burgdorferi (strain ZS7) GN=arcB PE=3 SV=1 | 1 | 206 | 5.0E-28 |
sp|O51782|OTCC_BORBU | Ornithine carbamoyltransferase, catabolic OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=arcB PE=3 SV=2 | 1 | 206 | 5.0E-28 |
sp|A7MSD8|OTC_VIBCB | Ornithine carbamoyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=argF PE=3 SV=1 | 1 | 202 | 6.0E-28 |
sp|Q63U72|OTCC_BURPS | Ornithine carbamoyltransferase, catabolic OS=Burkholderia pseudomallei (strain K96243) GN=arcB PE=3 SV=1 | 1 | 200 | 7.0E-28 |
sp|Q5LUT9|OTC_RUEPO | Ornithine carbamoyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=argF PE=3 SV=1 | 1 | 200 | 7.0E-28 |
sp|B7S4N1|PTC_STRRT | Putrescine carbamoyltransferase OS=Streptococcus ratti GN=ptcA PE=3 SV=2 | 1 | 204 | 7.0E-28 |
sp|Q62KD8|OTCC_BURMA | Ornithine carbamoyltransferase, catabolic OS=Burkholderia mallei (strain ATCC 23344) GN=arcB PE=3 SV=1 | 1 | 200 | 7.0E-28 |
sp|Q65ZT0|OTCC_BORBP | Ornithine carbamoyltransferase, catabolic OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=arcB PE=3 SV=1 | 1 | 205 | 8.0E-28 |
sp|Q319M8|OTC_PROM9 | Ornithine carbamoyltransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=argF PE=3 SV=1 | 5 | 204 | 9.0E-28 |
sp|Q169P2|OTC_ROSDO | Ornithine carbamoyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=argF PE=3 SV=1 | 1 | 200 | 1.0E-27 |
sp|P57876|OTC_PASMU | Ornithine carbamoyltransferase OS=Pasteurella multocida (strain Pm70) GN=argF PE=3 SV=1 | 1 | 202 | 1.0E-27 |
sp|Q837U7|PTC_ENTFA | Putrescine carbamoyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ptcA PE=1 SV=1 | 1 | 195 | 1.0E-27 |
sp|Q87LF9|OTC_VIBPA | Ornithine carbamoyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argF PE=3 SV=1 | 1 | 205 | 1.0E-27 |
sp|C3LR49|OTC_VIBCM | Ornithine carbamoyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=arcB PE=3 SV=1 | 1 | 202 | 1.0E-27 |
sp|Q9KP68|OTC_VIBCH | Ornithine carbamoyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argF PE=3 SV=1 | 1 | 202 | 1.0E-27 |
sp|Q3J4X5|OTC_RHOS4 | Ornithine carbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=argF PE=3 SV=1 | 1 | 200 | 2.0E-27 |
sp|Q6TK73|OTCC_STRRT | Ornithine carbamoyltransferase, catabolic OS=Streptococcus ratti GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-27 |
sp|B2UML6|OTC_AKKM8 | Ornithine carbamoyltransferase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=arcB PE=3 SV=1 | 1 | 203 | 2.0E-27 |
sp|Q1GIW7|OTC_RUEST | Ornithine carbamoyltransferase OS=Ruegeria sp. (strain TM1040) GN=argF PE=3 SV=1 | 1 | 200 | 3.0E-27 |
sp|A3PHL6|OTC_RHOS1 | Ornithine carbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=argF PE=3 SV=1 | 1 | 200 | 3.0E-27 |
sp|A6UNM1|OTC_METVS | Ornithine carbamoyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=argF PE=3 SV=1 | 1 | 207 | 3.0E-27 |
sp|Q7MHF2|OTC_VIBVY | Ornithine carbamoyltransferase OS=Vibrio vulnificus (strain YJ016) GN=argF PE=3 SV=1 | 1 | 202 | 4.0E-27 |
sp|P65602|OTCC_STAAN | Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain N315) GN=arcB PE=1 SV=1 | 1 | 202 | 9.0E-27 |
sp|P65601|OTCC_STAAM | Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arcB PE=3 SV=1 | 1 | 202 | 9.0E-27 |
sp|Q6GDG8|OTCC_STAAR | Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain MRSA252) GN=arcB PE=3 SV=1 | 1 | 202 | 1.0E-26 |
sp|Q8NUK8|OTCC_STAAW | Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain MW2) GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-26 |
sp|Q6G640|OTCC_STAAS | Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain MSSA476) GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-26 |
sp|Q5HCR3|OTCC_STAAC | Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain COL) GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-26 |
sp|Q97M82|OTC_CLOAB | Ornithine carbamoyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argF PE=3 SV=1 | 1 | 202 | 2.0E-26 |
sp|A6TWW1|OTC_ALKMQ | Ornithine carbamoyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=argF PE=3 SV=1 | 1 | 205 | 2.0E-26 |
sp|Q6HP28|OTCC_BACHK | Ornithine carbamoyltransferase, catabolic OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-26 |
sp|Q8DCF5|OTC_VIBVU | Ornithine carbamoyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=argF PE=1 SV=1 | 1 | 202 | 3.0E-26 |
sp|B5XMC1|OTC_STRPZ | Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=arcB PE=3 SV=1 | 1 | 206 | 4.0E-26 |
sp|A2RDJ1|OTC_STRPG | Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=arcB PE=3 SV=1 | 1 | 206 | 4.0E-26 |
sp|Q1J5Q6|OTC_STRPF | Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=arcB PE=3 SV=1 | 1 | 206 | 4.0E-26 |
sp|Q1JFZ1|OTC_STRPD | Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=arcB PE=3 SV=1 | 1 | 206 | 4.0E-26 |
sp|Q1JKW5|OTC_STRPC | Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=arcB PE=3 SV=1 | 1 | 206 | 4.0E-26 |
sp|Q1JAR4|OTC_STRPB | Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=arcB PE=3 SV=1 | 1 | 206 | 4.0E-26 |
sp|P0DC83|OTCC_STRPQ | Ornithine carbamoyltransferase, catabolic OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=arcB PE=3 SV=1 | 1 | 206 | 4.0E-26 |
sp|P65610|OTCC_STRP8 | Ornithine carbamoyltransferase, catabolic OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=arcB PE=3 SV=2 | 1 | 206 | 4.0E-26 |
sp|Q5XAY4|OTCC_STRP6 | Ornithine carbamoyltransferase, catabolic OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=arcB PE=1 SV=3 | 1 | 206 | 4.0E-26 |
sp|P0DC82|OTCC_STRP3 | Ornithine carbamoyltransferase, catabolic OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=arcB PE=3 SV=1 | 1 | 206 | 4.0E-26 |
sp|P0C0D0|OTCC_STRP1 | Ornithine carbamoyltransferase, catabolic OS=Streptococcus pyogenes serotype M1 GN=arcB PE=3 SV=3 | 1 | 206 | 4.0E-26 |
sp|Q6MSR6|PTC_MYCMS | Putrescine carbamoyltransferase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=ptcA PE=3 SV=1 | 1 | 200 | 4.0E-26 |
sp|Q73E86|OTCC_BACC1 | Ornithine carbamoyltransferase, catabolic OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=arcB PE=3 SV=1 | 1 | 206 | 6.0E-26 |
sp|Q81II0|OTCC_BACCR | Ornithine carbamoyltransferase, catabolic OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=arcB PE=3 SV=1 | 1 | 206 | 1.0E-25 |
sp|P59100|OTC_BUCAP | Ornithine carbamoyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argI PE=3 SV=1 | 1 | 205 | 1.0E-25 |
sp|Q9K4Z4|OTC_MORPR | Ornithine carbamoyltransferase OS=Moritella profunda GN=argF PE=3 SV=1 | 1 | 204 | 1.0E-25 |
sp|P65606|OTCC2_STRA5 | Ornithine carbamoyltransferase 2, catabolic OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=arcB2 PE=3 SV=1 | 1 | 206 | 2.0E-25 |
sp|P65605|OTCC2_STRA3 | Ornithine carbamoyltransferase 2, catabolic OS=Streptococcus agalactiae serotype III (strain NEM316) GN=arcB2 PE=3 SV=1 | 1 | 206 | 2.0E-25 |
sp|Q8RP83|OTCC_STRAG | Ornithine carbamoyltransferase, catabolic OS=Streptococcus agalactiae GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-25 |
sp|Q8Z127|OTCC_SALTI | Ornithine carbamoyltransferase, catabolic OS=Salmonella typhi GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-25 |
sp|Q0SWK5|OTC_CLOPS | Ornithine carbamoyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-25 |
sp|Q73P70|OTCC_TREDE | Ornithine carbamoyltransferase, catabolic OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-25 |
sp|P0C2E4|OTCC_CLOPE | Ornithine carbamoyltransferase, catabolic OS=Clostridium perfringens (strain 13 / Type A) GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-25 |
sp|Q0TUR4|OTCC_CLOP1 | Ornithine carbamoyltransferase, catabolic OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-25 |
sp|Q8ZK35|OTCC_SALTY | Ornithine carbamoyltransferase, catabolic OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-25 |
sp|P96172|OTC_VIBS2 | Ornithine carbamoyltransferase OS=Vibrio sp. (strain 2693) GN=argF PE=3 SV=2 | 1 | 204 | 3.0E-25 |
sp|Q2SRJ4|PTC_MYCCT | Putrescine carbamoyltransferase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=ptcA PE=3 SV=1 | 1 | 200 | 4.0E-25 |
sp|O08322|OTC_LACPL | Ornithine carbamoyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argF PE=3 SV=2 | 1 | 206 | 4.0E-25 |
sp|C0MBK6|OTC_STRE4 | Ornithine carbamoyltransferase OS=Streptococcus equi subsp. equi (strain 4047) GN=arcB PE=3 SV=1 | 1 | 206 | 4.0E-25 |
sp|Q9K4Y9|OTC_MORAB | Ornithine carbamoyltransferase OS=Moritella abyssi GN=argF PE=1 SV=1 | 1 | 204 | 6.0E-25 |
sp|Q8FAD6|OTC_ECOL6 | Ornithine carbamoyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argI PE=3 SV=3 | 1 | 202 | 8.0E-25 |
sp|Q8CMW2|OTCC2_STAES | Ornithine carbamoyltransferase 2, catabolic OS=Staphylococcus epidermidis (strain ATCC 12228) GN=arcB2 PE=3 SV=1 | 1 | 202 | 9.0E-25 |
sp|A0KQG4|OTC_AERHH | Ornithine carbamoyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=argF PE=3 SV=1 | 1 | 202 | 1.0E-24 |
sp|C0MD77|OTC_STRS7 | Ornithine carbamoyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-24 |
sp|B4U1S2|OTC_STREM | Ornithine carbamoyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-24 |
sp|Q9K575|OTCC_LACLM | Ornithine carbamoyltransferase, catabolic OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-24 |
sp|Q0SXJ4|OTC_SHIF8 | Ornithine carbamoyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=argI PE=3 SV=1 | 1 | 203 | 3.0E-24 |
sp|P04391|OTC1_ECOLI | Ornithine carbamoyltransferase chain I OS=Escherichia coli (strain K12) GN=argI PE=1 SV=3 | 1 | 202 | 3.0E-24 |
sp|B1IJJ6|OTC_CLOBK | Ornithine carbamoyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=arcB PE=3 SV=1 | 1 | 202 | 3.0E-24 |
sp|Q7B9Y6|PTC_LACBR | Putrescine carbamoyltransferase OS=Lactobacillus brevis GN=ptcA PE=3 SV=2 | 5 | 204 | 4.0E-24 |
sp|Q03NG2|PTC_LACBA | Putrescine carbamoyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ptcA PE=3 SV=1 | 5 | 204 | 4.0E-24 |
sp|B5E3F8|OTC_STRP4 | Ornithine carbamoyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=arcB PE=3 SV=1 | 1 | 206 | 4.0E-24 |
sp|Q8GND4|OTCC_STRGC | Ornithine carbamoyltransferase, catabolic OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=arcB PE=3 SV=1 | 1 | 206 | 5.0E-24 |
sp|Q08016|OTC_SALTY | Ornithine carbamoyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argI PE=3 SV=3 | 1 | 202 | 5.0E-24 |
sp|B2VL36|OTC_ERWT9 | Ornithine carbamoyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=argI PE=3 SV=1 | 1 | 207 | 5.0E-24 |
sp|P0C2U0|OTCC_LACLA | Ornithine carbamoyltransferase, catabolic OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=arcB PE=3 SV=1 | 1 | 206 | 5.0E-24 |
sp|C3L179|OTC_CLOB6 | Ornithine carbamoyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=arcB PE=3 SV=1 | 1 | 202 | 5.0E-24 |
sp|A5I524|OTC_CLOBH | Ornithine carbamoyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=arcB PE=3 SV=1 | 1 | 202 | 5.0E-24 |
sp|A7FWM4|OTC_CLOB1 | Ornithine carbamoyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=arcB PE=3 SV=1 | 1 | 202 | 5.0E-24 |
sp|Q92ZT1|OTCC_RHIME | Ornithine carbamoyltransferase, catabolic OS=Rhizobium meliloti (strain 1021) GN=arcB PE=3 SV=1 | 1 | 205 | 5.0E-24 |
sp|B1KXQ3|OTC_CLOBM | Ornithine carbamoyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=arcB PE=3 SV=1 | 1 | 202 | 6.0E-24 |
sp|A7GGI0|OTC_CLOBL | Ornithine carbamoyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=arcB PE=3 SV=1 | 1 | 202 | 6.0E-24 |
sp|A4VU03|OTC_STRSY | Ornithine carbamoyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=arcB PE=3 SV=1 | 1 | 202 | 6.0E-24 |
sp|A4W094|OTC_STRS2 | Ornithine carbamoyltransferase OS=Streptococcus suis (strain 98HAH33) GN=arcB PE=3 SV=1 | 1 | 202 | 6.0E-24 |
sp|Q8GG79|OTCC_STRSU | Ornithine carbamoyltransferase, catabolic OS=Streptococcus suis GN=arcB PE=3 SV=2 | 1 | 202 | 6.0E-24 |
sp|Q38ZL1|PTC_LACSS | Putrescine carbamoyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ptcA PE=3 SV=1 | 1 | 204 | 7.0E-24 |
sp|Q83IM2|OTC_SHIFL | Ornithine carbamoyltransferase OS=Shigella flexneri GN=argI PE=3 SV=1 | 1 | 203 | 8.0E-24 |
sp|P0C2U1|OTCC_LACLC | Ornithine carbamoyltransferase, catabolic OS=Lactococcus lactis subsp. cremoris GN=arcB PE=3 SV=1 | 1 | 206 | 1.0E-23 |
sp|B0BQQ2|OTC_ACTPJ | Ornithine carbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=arcB PE=3 SV=1 | 1 | 202 | 1.0E-23 |
sp|B3GY96|OTC_ACTP7 | Ornithine carbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=arcB PE=3 SV=1 | 1 | 202 | 1.0E-23 |
sp|A3N1W5|OTC_ACTP2 | Ornithine carbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=argF PE=3 SV=1 | 1 | 202 | 1.0E-23 |
sp|B7NGI6|OTC_ECOLU | Ornithine carbamoyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=argI PE=3 SV=1 | 1 | 202 | 1.0E-23 |
sp|B1ISV4|OTC_ECOLC | Ornithine carbamoyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=argI PE=3 SV=1 | 1 | 202 | 1.0E-23 |
sp|A8A810|OTC_ECOHS | Ornithine carbamoyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=argI PE=3 SV=1 | 1 | 202 | 1.0E-23 |
sp|B7M9L3|OTC_ECO8A | Ornithine carbamoyltransferase OS=Escherichia coli O8 (strain IAI1) GN=argI PE=3 SV=1 | 1 | 202 | 1.0E-23 |
sp|B7LCW4|OTC_ECO55 | Ornithine carbamoyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=argI PE=3 SV=1 | 1 | 202 | 1.0E-23 |
sp|Q31TJ4|OTC_SHIBS | Ornithine carbamoyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=argI PE=3 SV=1 | 1 | 204 | 1.0E-23 |
sp|Q6LUW9|OTCC_PHOPR | Ornithine carbamoyltransferase, catabolic OS=Photobacterium profundum GN=arcB PE=3 SV=1 | 1 | 205 | 1.0E-23 |
sp|P08308|OTCC_PSEAE | Ornithine carbamoyltransferase, catabolic OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=arcB PE=1 SV=3 | 1 | 200 | 1.0E-23 |
sp|C1FTE9|OTC_CLOBJ | Ornithine carbamoyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-23 |
sp|Q5E7U4|OTC_VIBF1 | Ornithine carbamoyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=argF PE=3 SV=1 | 1 | 202 | 2.0E-23 |
sp|Q3YU98|OTC_SHISS | Ornithine carbamoyltransferase OS=Shigella sonnei (strain Ss046) GN=argI PE=3 SV=1 | 1 | 202 | 2.0E-23 |
sp|Q8Z123|OTC_SALTI | Ornithine carbamoyltransferase OS=Salmonella typhi GN=argI PE=3 SV=3 | 1 | 202 | 2.0E-23 |
sp|A7ZVD3|OTC_ECO24 | Ornithine carbamoyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=argI PE=3 SV=1 | 1 | 203 | 2.0E-23 |
sp|A4TQQ1|OTC_YERPP | Ornithine carbamoyltransferase OS=Yersinia pestis (strain Pestoides F) GN=argI PE=3 SV=1 | 1 | 202 | 2.0E-23 |
sp|Q1CM06|OTC_YERPN | Ornithine carbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=argI PE=3 SV=1 | 1 | 202 | 2.0E-23 |
sp|Q8ZBG8|OTC_YERPE | Ornithine carbamoyltransferase OS=Yersinia pestis GN=argI PE=3 SV=1 | 1 | 202 | 2.0E-23 |
sp|P44770|OTCC_HAEIN | Ornithine carbamoyltransferase, catabolic OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=arcB PE=3 SV=1 | 1 | 202 | 2.0E-23 |
sp|P06960|OTC2_ECOLI | Ornithine carbamoyltransferase chain F OS=Escherichia coli (strain K12) GN=argF PE=1 SV=4 | 1 | 202 | 2.0E-23 |
sp|C1CU67|OTC_STRZT | Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-23 |
sp|C1CHE7|OTC_STRZJ | Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-23 |
sp|B2INH0|OTC_STRPS | Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-23 |
sp|B8ZPY8|OTC_STRPJ | Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-23 |
sp|B1I9W1|OTC_STRPI | Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-23 |
sp|C1CAZ4|OTC_STRP7 | Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-23 |
sp|Q04I25|OTC_STRP2 | Ornithine carbamoyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-23 |
sp|P65608|OTCC_STRR6 | Ornithine carbamoyltransferase, catabolic OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-23 |
sp|P65607|OTCC_STRPN | Ornithine carbamoyltransferase, catabolic OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-23 |
sp|Q9CHD1|OTC_LACLA | Ornithine carbamoyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argF PE=3 SV=1 | 1 | 193 | 3.0E-23 |
sp|Q65TN0|OTC_MANSM | Ornithine carbamoyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=argF PE=3 SV=1 | 1 | 202 | 3.0E-23 |
sp|Q93JF1|OTC_STRCO | Ornithine carbamoyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=argF PE=3 SV=1 | 1 | 202 | 3.0E-23 |
sp|B7MLQ9|OTC_ECO45 | Ornithine carbamoyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=argI PE=3 SV=1 | 1 | 202 | 3.0E-23 |
sp|A5UHA3|OTC_HAEIG | Ornithine carbamoyltransferase OS=Haemophilus influenzae (strain PittGG) GN=arcB PE=3 SV=1 | 1 | 202 | 3.0E-23 |
sp|Q8XCB8|OTC_ECO57 | Ornithine carbamoyltransferase OS=Escherichia coli O157:H7 GN=argI PE=3 SV=3 | 1 | 202 | 4.0E-23 |
sp|Q66F14|OTC_YERPS | Ornithine carbamoyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=argI PE=3 SV=1 | 1 | 202 | 5.0E-23 |
sp|Q88P53|OTCC_PSEPK | Ornithine carbamoyltransferase, catabolic OS=Pseudomonas putida (strain KT2440) GN=arcB PE=3 SV=3 | 1 | 200 | 5.0E-23 |
sp|Q328S8|OTC_SHIDS | Ornithine carbamoyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=argI PE=3 SV=1 | 1 | 202 | 5.0E-23 |
sp|A7FMM5|OTC_YERP3 | Ornithine carbamoyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=argI PE=3 SV=1 | 1 | 202 | 5.0E-23 |
sp|B9DUY9|OTC_STRU0 | Ornithine carbamoyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=arcB PE=3 SV=1 | 1 | 206 | 5.0E-23 |
sp|A4SHP4|OTC_AERS4 | Ornithine carbamoyltransferase OS=Aeromonas salmonicida (strain A449) GN=argF PE=3 SV=1 | 1 | 202 | 7.0E-23 |
sp|Q01322|OTC_NEICI | Ornithine carbamoyltransferase (Fragment) OS=Neisseria cinerea GN=argF PE=3 SV=1 | 1 | 189 | 8.0E-23 |
sp|Q936V7|OTCC_PSEME | Ornithine carbamoyltransferase, catabolic OS=Pseudomonas mendocina GN=arcB PE=3 SV=3 | 1 | 200 | 9.0E-23 |
sp|Q8YAS7|PTC_LISMO | Putrescine carbamoyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ptcA PE=3 SV=1 | 1 | 200 | 9.0E-23 |
sp|Q725C8|PTC_LISMF | Putrescine carbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ptcA PE=3 SV=1 | 1 | 200 | 1.0E-22 |
sp|C1KV77|PTC_LISMC | Putrescine carbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=ptcA PE=3 SV=1 | 1 | 200 | 1.0E-22 |
sp|Q9ZIX8|OTCC_AVIPA | Ornithine carbamoyltransferase, catabolic OS=Avibacterium paragallinarum GN=arcB PE=3 SV=1 | 1 | 202 | 1.0E-22 |
sp|Q7VQT3|OTC_BLOFL | Ornithine carbamoyltransferase OS=Blochmannia floridanus GN=Bfl032 PE=3 SV=1 | 1 | 205 | 1.0E-22 |
sp|Q6DA71|OTC_PECAS | Ornithine carbamoyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=argI PE=3 SV=1 | 1 | 202 | 1.0E-22 |
sp|O53089|OTCC_LACSK | Ornithine carbamoyltransferase, catabolic OS=Lactobacillus sakei GN=arcB PE=3 SV=1 | 1 | 206 | 2.0E-22 |
sp|Q8FAE1|OTCC_ECOL6 | Ornithine carbamoyltransferase, catabolic OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=arcB PE=3 SV=2 | 1 | 202 | 2.0E-22 |
sp|O31018|OTCC_RHIET | Ornithine carbamoyltransferase, catabolic OS=Rhizobium etli GN=arcB PE=3 SV=1 | 1 | 205 | 2.0E-22 |
sp|Q89AG1|OTC_BUCBP | Ornithine carbamoyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=argI PE=3 SV=1 | 1 | 205 | 3.0E-22 |
sp|Q8G998|OTCC_LACHI | Ornithine carbamoyltransferase, catabolic OS=Lactobacillus hilgardii GN=arcB PE=1 SV=1 | 1 | 206 | 3.0E-22 |
sp|Q6AA77|OTC_PROAC | Ornithine carbamoyltransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=argF PE=3 SV=1 | 1 | 200 | 3.0E-22 |
sp|Q7MZ18|OTC_PHOLL | Ornithine carbamoyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argI PE=3 SV=1 | 1 | 210 | 3.0E-22 |
sp|Q01324|OTC_NEILA | Ornithine carbamoyltransferase (Fragment) OS=Neisseria lactamica GN=argF PE=3 SV=1 | 1 | 189 | 3.0E-22 |
sp|Q8NX44|OTC_STAAW | Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain MW2) GN=argF PE=3 SV=1 | 1 | 202 | 4.0E-22 |
sp|Q6GA45|OTC_STAAS | Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=argF PE=3 SV=1 | 1 | 202 | 4.0E-22 |
sp|B8D9F3|OTC_BUCA5 | Ornithine carbamoyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=arcB PE=3 SV=1 | 1 | 200 | 5.0E-22 |
sp|Q9JTI4|OTC_NEIMA | Ornithine carbamoyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argF PE=3 SV=1 | 1 | 202 | 5.0E-22 |
sp|B8D7Q5|OTC_BUCAT | Ornithine carbamoyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=arcB PE=3 SV=1 | 1 | 200 | 5.0E-22 |
sp|P0C6P3|OTC_STAAU | Ornithine carbamoyltransferase OS=Staphylococcus aureus GN=argF PE=3 SV=1 | 1 | 202 | 6.0E-22 |
sp|Q6GHR7|OTC_STAAR | Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=argF PE=3 SV=1 | 1 | 202 | 6.0E-22 |
sp|P99073|OTC_STAAN | Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain N315) GN=argF PE=1 SV=1 | 1 | 202 | 6.0E-22 |
sp|P0A099|OTC_STAAM | Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=argF PE=3 SV=1 | 1 | 202 | 6.0E-22 |
sp|E6N013|OTC_NEIMH | Ornithine carbamoyltransferase OS=Neisseria meningitidis serogroup B / serotype 15 (strain H44/76) GN=argF PE=3 SV=1 | 1 | 202 | 7.0E-22 |
sp|P0DH57|OTC_NEIMB | Ornithine carbamoyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argF PE=3 SV=1 | 1 | 202 | 7.0E-22 |
sp|A6QG68|OTC_STAAE | Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain Newman) GN=argF PE=3 SV=2 | 1 | 202 | 8.0E-22 |
sp|Q5HGR3|OTC_STAAC | Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain COL) GN=argF PE=3 SV=1 | 1 | 202 | 8.0E-22 |
sp|B2G653|OTC_LACRJ | Ornithine carbamoyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=arcB PE=3 SV=1 | 1 | 202 | 8.0E-22 |
sp|A5VIM0|OTC_LACRD | Ornithine carbamoyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=arcB PE=3 SV=1 | 1 | 202 | 8.0E-22 |
sp|Q03HM9|PTC_PEDPA | Putrescine carbamoyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=ptcA PE=3 SV=1 | 4 | 204 | 1.0E-21 |
sp|P57449|OTC_BUCAI | Ornithine carbamoyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argI PE=3 SV=1 | 1 | 200 | 1.0E-21 |
sp|A1KUZ7|OTC_NEIMF | Ornithine carbamoyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=argF PE=3 SV=1 | 1 | 202 | 1.0E-21 |
sp|Q82KQ4|OTC_STRAW | Ornithine carbamoyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argF PE=3 SV=1 | 1 | 202 | 1.0E-21 |
sp|Q01326|OTC_NEIMU | Ornithine carbamoyltransferase (Fragment) OS=Neisseria mucosa GN=argF PE=3 SV=1 | 1 | 189 | 2.0E-21 |
sp|Q8CU41|OTCC1_STAES | Ornithine carbamoyltransferase 1, catabolic OS=Staphylococcus epidermidis (strain ATCC 12228) GN=arcB1 PE=3 SV=1 | 1 | 192 | 4.0E-21 |
sp|Q7VP68|OTC_HAEDU | Ornithine carbamoyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=argF PE=3 SV=1 | 1 | 202 | 4.0E-21 |
sp|Q03NY9|OTC_LACBA | Ornithine carbamoyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=arcB PE=3 SV=1 | 1 | 206 | 4.0E-21 |
sp|Q4L9V8|OTC_STAHJ | Ornithine carbamoyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=argF PE=3 SV=1 | 1 | 192 | 4.0E-21 |
sp|Q5F7E6|OTC_NEIG1 | Ornithine carbamoyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=argF PE=3 SV=1 | 1 | 202 | 5.0E-21 |
sp|P21302|OTC_NEIGO | Ornithine carbamoyltransferase OS=Neisseria gonorrhoeae GN=argF PE=3 SV=1 | 1 | 202 | 5.0E-21 |
sp|Q6LG09|OTC_PHOPR | Ornithine carbamoyltransferase OS=Photobacterium profundum GN=argF PE=3 SV=1 | 1 | 204 | 5.0E-21 |
sp|Q7NRK0|OTCC_CHRVO | Ornithine carbamoyltransferase, catabolic OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=arcB PE=3 SV=1 | 1 | 206 | 6.0E-21 |
sp|Q839Q5|OTCC_ENTFA | Ornithine carbamoyltransferase, catabolic OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=arcB PE=3 SV=1 | 1 | 206 | 8.0E-21 |
sp|P0C0N1|OTC_STAES | Ornithine carbamoyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argF PE=3 SV=1 | 1 | 202 | 9.0E-21 |
sp|Q47NE4|OTC_THEFY | Ornithine carbamoyltransferase OS=Thermobifida fusca (strain YX) GN=argF PE=3 SV=1 | 1 | 205 | 1.0E-20 |
sp|O86385|OTC_NEIFV | Ornithine carbamoyltransferase (Fragment) OS=Neisseria flava GN=argF PE=3 SV=1 | 1 | 167 | 1.0E-20 |
sp|O86412|OTC_NEISI | Ornithine carbamoyltransferase (Fragment) OS=Neisseria sicca GN=argF PE=3 SV=1 | 1 | 167 | 2.0E-20 |
sp|Q01323|OTC_NEIFL | Ornithine carbamoyltransferase (Fragment) OS=Neisseria flavescens GN=argF PE=3 SV=1 | 1 | 189 | 2.0E-20 |
sp|O86408|OTC_NEIPH | Ornithine carbamoyltransferase (Fragment) OS=Neisseria pharyngis GN=argF PE=3 SV=1 | 1 | 167 | 2.0E-20 |
sp|P65604|OTCC1_STRA5 | Ornithine carbamoyltransferase 1, catabolic OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=arcB1 PE=3 SV=1 | 1 | 202 | 3.0E-20 |
sp|P65603|OTCC1_STRA3 | Ornithine carbamoyltransferase 1, catabolic OS=Streptococcus agalactiae serotype III (strain NEM316) GN=arcB1 PE=3 SV=1 | 1 | 202 | 3.0E-20 |
sp|Q8VW55|OTCC_OENOE | Ornithine carbamoyltransferase, catabolic OS=Oenococcus oeni GN=arcB PE=3 SV=1 | 1 | 206 | 3.0E-20 |
sp|Q03DS0|OTC_PEDPA | Ornithine carbamoyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=arcB PE=3 SV=1 | 1 | 202 | 3.0E-20 |
sp|Q8F2D1|OTC_LEPIN | Ornithine carbamoyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=argF PE=3 SV=1 | 5 | 204 | 4.0E-20 |
sp|Q72T26|OTC_LEPIC | Ornithine carbamoyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=argF PE=3 SV=1 | 5 | 204 | 4.0E-20 |
sp|O86376|OTC_NEIAN | Ornithine carbamoyltransferase (Fragment) OS=Neisseria animalis GN=argF PE=3 SV=1 | 1 | 179 | 4.0E-20 |
sp|O86415|OTC_NEISU | Ornithine carbamoyltransferase (Fragment) OS=Neisseria subflava GN=argF PE=3 SV=1 | 1 | 167 | 6.0E-20 |
sp|Q9R3D1|OTC_NEIEL | Ornithine carbamoyltransferase (Fragment) OS=Neisseria elongata GN=argF PE=3 SV=1 | 1 | 167 | 7.0E-20 |
sp|Q8EVF5|OTCC_MYCPE | Ornithine carbamoyltransferase, catabolic OS=Mycoplasma penetrans (strain HF-2) GN=arcB PE=1 SV=1 | 1 | 204 | 2.0E-19 |
sp|Q01325|OTC_NEIME | Ornithine carbamoyltransferase (Fragment) OS=Neisseria meningitidis GN=argF PE=3 SV=2 | 1 | 189 | 2.0E-19 |
sp|P59779|OTCC_MYCCC | Ornithine carbamoyltransferase, catabolic OS=Mycoplasma capricolum subsp. capripneumoniae GN=arcB PE=3 SV=1 | 1 | 186 | 6.0E-19 |
sp|Q01327|OTC_NEIPO | Ornithine carbamoyltransferase (Fragment) OS=Neisseria polysaccharea GN=argF PE=3 SV=1 | 1 | 189 | 7.0E-19 |
sp|Q8DVC9|OTC_STRMU | Ornithine carbamoyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argF PE=3 SV=1 | 1 | 200 | 2.0E-18 |
sp|Q0T9E0|OTC_ECOL5 | Ornithine carbamoyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=argI PE=3 SV=1 | 1 | 172 | 6.0E-18 |
sp|O86404|OTC_NEIPE | Ornithine carbamoyltransferase (Fragment) OS=Neisseria perflava GN=argF PE=3 SV=1 | 1 | 179 | 2.0E-17 |
sp|P75473|OTCC_MYCPN | Ornithine carbamoyltransferase, catabolic OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=arcB PE=3 SV=2 | 1 | 202 | 2.0E-16 |
sp|Q5F5P0|PYRB_NEIG1 | Aspartate carbamoyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pyrB PE=3 SV=1 | 2 | 207 | 2.0E-09 |
sp|B4RPW7|PYRB_NEIG2 | Aspartate carbamoyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=pyrB PE=3 SV=1 | 2 | 207 | 2.0E-09 |
sp|A9M469|PYRB_NEIM0 | Aspartate carbamoyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=pyrB PE=3 SV=1 | 2 | 207 | 5.0E-09 |
sp|P08955|PYR1_MESAU | CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 | 2 | 204 | 5.0E-09 |
sp|Q91437|PYR1_SQUAC | CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 | 2 | 204 | 1.0E-08 |
sp|P65616|PYRB_NEIMB | Aspartate carbamoyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pyrB PE=3 SV=1 | 2 | 207 | 2.0E-08 |
sp|P65615|PYRB_NEIMA | Aspartate carbamoyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pyrB PE=3 SV=1 | 2 | 207 | 2.0E-08 |
sp|A4SHP8|PYRB_AERS4 | Aspartate carbamoyltransferase OS=Aeromonas salmonicida (strain A449) GN=pyrB PE=3 SV=1 | 5 | 207 | 1.0E-07 |
sp|Q8P8J2|AOTC_XANCP | N-acetylornithine carbamoyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=argF' PE=1 SV=1 | 1 | 204 | 5.0E-07 |
sp|A0KQG0|PYRB_AERHH | Aspartate carbamoyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pyrB PE=3 SV=2 | 5 | 207 | 8.0E-07 |
sp|Q8PK25|AOTC_XANAC | N-acetylornithine carbamoyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=argF' PE=3 SV=1 | 1 | 208 | 1.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0016597 | amino acid binding | Yes |
GO:0006520 | cellular amino acid metabolic process | Yes |
GO:0016743 | carboxyl- or carbamoyltransferase activity | Yes |
GO:0019752 | carboxylic acid metabolic process | No |
GO:0016741 | transferase activity, transferring one-carbon groups | No |
GO:0003674 | molecular_function | No |
GO:0016740 | transferase activity | No |
GO:0036094 | small molecule binding | No |
GO:0008150 | biological_process | No |
GO:0008152 | metabolic process | No |
GO:0043436 | oxoacid metabolic process | No |
GO:0005488 | binding | No |
GO:0044238 | primary metabolic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0009987 | cellular process | No |
GO:0044237 | cellular metabolic process | No |
GO:0031406 | carboxylic acid binding | No |
GO:0006082 | organic acid metabolic process | No |
GO:0003824 | catalytic activity | No |
GO:0043168 | anion binding | No |
GO:0043177 | organic acid binding | No |
GO:0043167 | ion binding | No |
GO:0044281 | small molecule metabolic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 39 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|1874 LAGHSSVPVVNALSDDFHPLQTVADLLTMHEALAPSAAGPGLGLDGLRVAWVGDSNNVLFDLATGCVKAGVDIAV ASPPGYGIPPAMRRVIAAAADGVDRPGRLEETTAPEEAVRGADVIVTDTWVSMGQEADQKKRLAAFAGYQVTDEL ARRGGAKDGWRFMHCLPRHREEVADDVFYGPRSLVFPEAENRLWAAVATLEALVVNKGRIEP* |
Coding | >Hirsu2|1874 CTGGCGGGGCACTCGAGCGTGCCGGTCGTCAACGCGCTGTCGGACGACTTCCACCCGCTGCAGACGGTGGCGGAC CTGCTGACGATGCACGAGGCGCTCGCGCCGTCGGCGGCCGGGCCCGGGCTGGGCCTCGACGGGCTGCGCGTCGCC TGGGTGGGCGACTCGAACAACGTGCTCTTCGACCTGGCGACGGGCTGCGTCAAGGCCGGCGTCGATATCGCCGTC GCCTCGCCCCCGGGCTACGGCATCCCGCCCGCGATGCGGCGCGTCATCGCCGCCGCCGCCGACGGCGTCGACCGC CCGGGCCGGCTGGAGGAGACGACGGCGCCGGAGGAGGCCGTCCGCGGCGCCGACGTCATCGTCACCGACACGTGG GTCTCGATGGGCCAGGAGGCCGACCAGAAGAAGCGGCTGGCCGCCTTCGCCGGCTACCAGGTCACGGACGAGCTG GCCCGCCGCGGCGGCGCCAAGGACGGCTGGCGCTTCATGCACTGCCTGCCCCGCCACCGCGAGGAGGTGGCCGAC GACGTCTTCTACGGGCCCCGCTCGCTCGTCTTCCCGGAGGCCGAGAACCGGCTCTGGGCCGCCGTCGCTACTCTC GAGGCGCTCGTCGTCAACAAGGGCCGGATCGAGCCTTGA |
Transcript | >Hirsu2|1874 CTGGCGGGGCACTCGAGCGTGCCGGTCGTCAACGCGCTGTCGGACGACTTCCACCCGCTGCAGACGGTGGCGGAC CTGCTGACGATGCACGAGGCGCTCGCGCCGTCGGCGGCCGGGCCCGGGCTGGGCCTCGACGGGCTGCGCGTCGCC TGGGTGGGCGACTCGAACAACGTGCTCTTCGACCTGGCGACGGGCTGCGTCAAGGCCGGCGTCGATATCGCCGTC GCCTCGCCCCCGGGCTACGGCATCCCGCCCGCGATGCGGCGCGTCATCGCCGCCGCCGCCGACGGCGTCGACCGC CCGGGCCGGCTGGAGGAGACGACGGCGCCGGAGGAGGCCGTCCGCGGCGCCGACGTCATCGTCACCGACACGTGG GTCTCGATGGGCCAGGAGGCCGACCAGAAGAAGCGGCTGGCCGCCTTCGCCGGCTACCAGGTCACGGACGAGCTG GCCCGCCGCGGCGGCGCCAAGGACGGCTGGCGCTTCATGCACTGCCTGCCCCGCCACCGCGAGGAGGTGGCCGAC GACGTCTTCTACGGGCCCCGCTCGCTCGTCTTCCCGGAGGCCGAGAACCGGCTCTGGGCCGCCGTCGCTACTCTC GAGGCGCTCGTCGTCAACAAGGGCCGGATCGAGCCTTGA |
Gene | >Hirsu2|1874 CTGGCGGGGCACTCGAGCGTGCCGGTCGTCAACGCGCTGTCGGACGACTTCCACCCGCTGCAGACGGTGGCGGAC CTGCTGACGATGCACGAGGCGCTCGCGCCGTCGGCGGCCGGGCCCGGGCTGGGCCTCGACGGGCTGCGCGTCGCC TGGGTGGGCGACTCGAACAACGTGCTCTTCGACCTGGCGACGGGCTGCGTCAAGGCCGGCGTCGATATCGCCGTC GCCTCGCCCCCGGGCTACGGCATCCCGCCCGCGATGCGGCGCGTCATCGCCGCCGCCGCCGACGGCGTCGACCGC CCGGGCCGGCTGGAGGAGACGACGGCGCCGGAGGAGGCCGTCCGCGGCGCCGACGTCATCGTCACCGACACGTGG GTCTCGATGGGCCAGGAGGCCGACCAGAAGAAGCGGCTGGCCGCCTTCGCCGGCTACCAGGTCACGGACGAGCTG GCCCGCCGCGGCGGCGCCAAGGACGGCTGGCGCTTCATGCACTGCCTGCCCCGCCACCGCGAGGAGGTGGCCGAC GACGTCTTCTACGGGCCCCGCTCGCTCGTCTTCCCGGAGGCCGAGAACCGGCTCTGGGCCGCCGTCGGTGAGTTG GGATAATTTCTTCTCCCCCCCTTTTTTTGTCTCTGGTGACCGGATCACGACTGATGGCTTGTGGGGGGTCGGCCC AGCTACTCTCGAGGCGCTCGTCGTCAACAAGGGCCGGATCGAGCCTTGA |