Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1868
Gene name
LocationContig_1425:4161..5251
Strand-
Gene length (bp)1090
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00651 BTB BTB/POZ domain 7.1E-15 9 85

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.671 0.5159 0.1827 0.0636 0.0448 0.0186 0.105 0.1549 0.1705 0.0035

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup213
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4084
Ophiocordyceps australis 1348a (Ghana) OphauG2|6581
Ophiocordyceps australis map64 (Brazil) OphauB2|5910
Ophiocordyceps camponoti-floridani Ophcf2|06305
Ophiocordyceps camponoti-floridani Ophcf2|06307
Ophiocordyceps camponoti-rufipedis Ophun1|2265
Ophiocordyceps camponoti-rufipedis Ophun1|2266
Ophiocordyceps camponoti-rufipedis Ophun1|2268
Ophiocordyceps kimflemingae Ophio5|7325
Ophiocordyceps kimflemingae Ophio5|7327
Ophiocordyceps subramaniannii Hirsu2|1868 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1868
MATNRGVFLEEMLKSEEYSDLRFTCNEHIFRVHKAVVCAQSPVVRAALSGHFKESEANAINMDSFHPMSVRNFVR
FLYTGDYDATATLENPDGESSRSRKQEADTISKQLIDLSIVEGGADSSSCKLAAAPPVPPPTTSVTELICEHIRV
NSIGHYYGVEALVSLANGKISALVHKDGKDQSWIADLPKLTAEALESTGDSAMLEILASATARNMSALTKPDWLR
DLGAAWACDVAILQACAQHMDAQRAKITRRSRTISELESRISQLEGKIEALSSKNDRFAAVLRQMNDTAECRNLS
CQAPDFSTHIDPDELILRCRHCKCKH*
Coding >Hirsu2|1868
ATGGCCACAAACCGCGGTGTCTTCCTCGAGGAGATGTTGAAGTCCGAGGAGTACAGTGACCTCAGATTTACATGC
AACGAGCATATCTTCCGGGTTCACAAGGCCGTCGTTTGCGCCCAGTCTCCCGTCGTCAGAGCGGCTCTGTCGGGC
CATTTCAAGGAATCCGAAGCCAATGCCATCAATATGGACAGCTTTCATCCCATGTCCGTCAGGAACTTCGTTCGG
TTCCTGTATACTGGCGATTACGACGCCACGGCCACGCTGGAAAATCCCGACGGCGAGAGTTCACGCAGCCGCAAA
CAAGAAGCTGATACCATATCCAAACAACTAATCGACCTGAGTATCGTCGAAGGCGGCGCGGACTCTTCGTCTTGC
AAGCTGGCGGCAGCACCGCCGGTGCCGCCACCGACCACCAGCGTGACCGAACTTATCTGTGAACACATCCGCGTC
AATTCCATCGGGCACTACTACGGCGTTGAGGCTCTCGTGTCGCTTGCCAACGGCAAGATTTCCGCTCTTGTTCAC
AAAGATGGCAAGGACCAGAGCTGGATTGCGGACCTCCCCAAGTTGACCGCAGAAGCACTGGAGTCGACGGGGGAC
TCGGCCATGCTTGAGATCCTGGCATCAGCAACAGCGAGAAATATGTCGGCCCTGACAAAGCCGGATTGGCTCCGC
GATCTGGGTGCTGCCTGGGCTTGCGATGTCGCCATCCTCCAGGCCTGTGCTCAGCATATGGACGCACAGCGGGCG
AAAATCACAAGGCGCTCTCGGACCATTTCCGAGCTGGAGTCGAGAATTTCGCAGCTAGAGGGGAAAATCGAGGCA
CTGTCGTCCAAGAATGATCGCTTCGCTGCTGTTCTTCGTCAAATGAACGATACCGCTGAATGCAGGAACCTATCC
TGCCAGGCCCCAGATTTTTCGACACACATAGACCCGGACGAGCTCATTTTGCGCTGCCGACACTGCAAGTGCAAG
CATTGA
Transcript >Hirsu2|1868
ATGGCCACAAACCGCGGTGTCTTCCTCGAGGAGATGTTGAAGTCCGAGGAGTACAGTGACCTCAGATTTACATGC
AACGAGCATATCTTCCGGGTTCACAAGGCCGTCGTTTGCGCCCAGTCTCCCGTCGTCAGAGCGGCTCTGTCGGGC
CATTTCAAGGAATCCGAAGCCAATGCCATCAATATGGACAGCTTTCATCCCATGTCCGTCAGGAACTTCGTTCGG
TTCCTGTATACTGGCGATTACGACGCCACGGCCACGCTGGAAAATCCCGACGGCGAGAGTTCACGCAGCCGCAAA
CAAGAAGCTGATACCATATCCAAACAACTAATCGACCTGAGTATCGTCGAAGGCGGCGCGGACTCTTCGTCTTGC
AAGCTGGCGGCAGCACCGCCGGTGCCGCCACCGACCACCAGCGTGACCGAACTTATCTGTGAACACATCCGCGTC
AATTCCATCGGGCACTACTACGGCGTTGAGGCTCTCGTGTCGCTTGCCAACGGCAAGATTTCCGCTCTTGTTCAC
AAAGATGGCAAGGACCAGAGCTGGATTGCGGACCTCCCCAAGTTGACCGCAGAAGCACTGGAGTCGACGGGGGAC
TCGGCCATGCTTGAGATCCTGGCATCAGCAACAGCGAGAAATATGTCGGCCCTGACAAAGCCGGATTGGCTCCGC
GATCTGGGTGCTGCCTGGGCTTGCGATGTCGCCATCCTCCAGGCCTGTGCTCAGCATATGGACGCACAGCGGGCG
AAAATCACAAGGCGCTCTCGGACCATTTCCGAGCTGGAGTCGAGAATTTCGCAGCTAGAGGGGAAAATCGAGGCA
CTGTCGTCCAAGAATGATCGCTTCGCTGCTGTTCTTCGTCAAATGAACGATACCGCTGAATGCAGGAACCTATCC
TGCCAGGCCCCAGATTTTTCGACACACATAGACCCGGACGAGCTCATTTTGCGCTGCCGACACTGCAAGTGCAAG
CATTGA
Gene >Hirsu2|1868
ATGGCCACAAACCGCGGTGTCTTCCTCGAGGAGATGTTGAAGTCCGAGGAGTACAGTGACCTCAGATTTACATGC
AACGAGCATATCTTCCGGGTTCACAAGGCCGTCGTTTGCGCCCAGTCTCCCGTCGTCAGAGCGGCTCTGTCGGGC
CATTTCAAGGTTCGTTGTCGAACCCCTTGGCTCGTCGGGACGTACGCTCATGCCGCTGCTACAGGAATCCGAAGC
CAATGCCATCAATATGGACAGCTTTCATCCCATGTCCGTCAGGAACTTCGTTCGGTTCCTGTATACTGGCGATTA
CGACGCCACGGCCACGCTGGAAAATCCCGACGGCGAGAGTTCACGCAGCCGCAAACAAGGTGAGGCGTCAGGCCG
AGCATAGCTGAGAAGCCCCAGGACTAACAGCACGGCAGAAGCTGATACCATATCCAAACAACTAATCGACCTGAG
TATCGTCGAAGGCGGCGCGGACTCTTCGTCTTGCAAGCTGGCGGCAGCACCGCCGGTGCCGCCACCGACCACCAG
CGTGACCGAACTTATCTGTGAACACATCCGCGTCAATTCCATCGGGCACTACTACGGCGTTGAGGCTCTCGTGTC
GCTTGCCAACGGCAAGATTTCCGCTCTTGTTCACAAAGATGGCAAGGACCAGAGCTGGATTGCGGACCTCCCCAA
GTTGACCGCAGAAGCACTGGAGTCGACGGGGGACTCGGCCATGCTTGAGATCCTGGCATCAGCAACAGCGAGAAA
TATGTCGGCCCTGACAAAGCCGGATTGGCTCCGCGATCTGGGTGCTGCCTGGGCTTGCGATGTCGCCATCCTCCA
GGCCTGTGCTCAGCATATGGACGCACAGCGGGCGAAAATCACAAGGCGCTCTCGGACCATTTCCGAGCTGGAGTC
GAGAATTTCGCAGCTAGAGGGGAAAATCGAGGCACTGTCGTCCAAGAATGATCGCTTCGCTGCTGTTCTTCGTCA
AATGAACGATACCGCTGAATGCAGGAACCTATCCTGCCAGGCCCCAGATTTTTCGACACACATAGACCCGGACGA
GCTCATTTTGCGCTGCCGACACTGCAAGTGCAAGCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail