Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1867
Gene name
LocationContig_1425:839..2849
Strand+
Gene length (bp)2010
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.9E-35 55 445

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 3 482 7.0E-53
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 77 507 2.0E-48
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 30 484 3.0E-38
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 30 484 5.0E-35
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 67 444 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 3 482 7.0E-53
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 77 507 2.0E-48
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 30 484 3.0E-38
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 30 484 5.0E-35
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 67 444 5.0E-18
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 67 444 5.0E-18
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 63 459 1.0E-17
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 62 354 3.0E-16
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 18 373 3.0E-15
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 18 373 3.0E-15
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 63 464 4.0E-15
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 99 397 3.0E-13
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 102 370 6.0E-13
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 102 370 7.0E-13
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 63 448 1.0E-12
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 81 335 2.0E-12
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 63 448 1.0E-11
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 63 371 2.0E-10
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 25 448 2.0E-10
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 66 357 3.0E-10
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 36 451 2.0E-09
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 63 307 1.0E-08
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 63 307 1.0E-08
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 63 307 1.0E-08
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 63 307 1.0E-08
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 63 357 3.0E-08
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 63 357 3.0E-08
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 62 355 5.0E-08
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 105 451 6.0E-08
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 63 254 6.0E-08
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 66 340 8.0E-08
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 95 360 8.0E-08
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 63 199 2.0E-07
sp|Q6GGX2|NORB_STAAR Quinolone resistance protein NorB OS=Staphylococcus aureus (strain MRSA252) GN=norB PE=3 SV=1 65 449 4.0E-07
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 63 254 5.0E-07
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 99 366 9.0E-07
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 66 337 1.0E-06
sp|Q8NWQ5|NORB_STAAW Quinolone resistance protein NorB OS=Staphylococcus aureus (strain MW2) GN=norB PE=1 SV=1 65 449 2.0E-06
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 126 386 2.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 126 386 2.0E-06
sp|Q7A5M0|NORB_STAAN Quinolone resistance protein NorB OS=Staphylococcus aureus (strain N315) GN=norB PE=3 SV=1 65 449 2.0E-06
sp|Q99U52|NORB_STAAM Quinolone resistance protein NorB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norB PE=3 SV=1 65 449 2.0E-06
sp|A5ISW7|NORB_STAA9 Quinolone resistance protein NorB OS=Staphylococcus aureus (strain JH9) GN=norB PE=3 SV=1 65 449 2.0E-06
sp|A6U1Q6|NORB_STAA2 Quinolone resistance protein NorB OS=Staphylococcus aureus (strain JH1) GN=norB PE=3 SV=1 65 449 2.0E-06
sp|A7X2C6|NORB_STAA1 Quinolone resistance protein NorB OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=norB PE=3 SV=1 65 449 2.0E-06
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 66 371 3.0E-06
sp|Q6G9C6|NORB_STAAS Quinolone resistance protein NorB OS=Staphylococcus aureus (strain MSSA476) GN=norB PE=3 SV=1 65 449 3.0E-06
sp|A8Z415|NORB_STAAT Quinolone resistance protein NorB OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=norB PE=3 SV=1 65 376 4.0E-06
sp|A6QGY6|NORB_STAAE Quinolone resistance protein NorB OS=Staphylococcus aureus (strain Newman) GN=norB PE=2 SV=1 65 376 4.0E-06
sp|Q2FYJ5|NORB_STAA8 Quinolone resistance protein NorB OS=Staphylococcus aureus (strain NCTC 8325) GN=norB PE=1 SV=1 65 376 4.0E-06
sp|Q2FH03|NORB_STAA3 Quinolone resistance protein NorB OS=Staphylococcus aureus (strain USA300) GN=norB PE=3 SV=1 65 376 4.0E-06
sp|Q5HFY7|NORB_STAAC Quinolone resistance protein NorB OS=Staphylococcus aureus (strain COL) GN=norB PE=3 SV=1 65 376 4.0E-06
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 97 285 7.0E-06
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 60 387 8.0E-06
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 90 372 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 80 99 19
3 106 128 22
4 138 160 22
5 167 189 22
6 199 218 19
7 235 252 17
8 265 287 22
9 308 330 22
10 340 362 22
11 367 386 19
12 396 418 22
13 430 449 19
14 469 491 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1867
MTSQEPAVTVQEVSEELPPQRLDVEKLGRQRPADFSSTWLEVAFVTSMLGALSMCDFVIGGFQVVLPALVKPFDI
PPGSQTWPSSVLTLVAGAFLFPLGRLSDMYGGFFLFNGGLLWLTLWTVVGGFAGNFTVLVVCRALQGLGAAAFLP
AGISLLGRIYRPGPRKNLVFALYGAVAPLGFFAGIIVGGLSQDLLSWRWYFWLGGIILGVCWVGTVLTSPRDYAA
AREMNVRMDWWGVLTMVPGLMLFIYAITESVNNGWSSPQIIATLVLGILFLAATVYVEGWVATSPLIPADIFRVP
YMKRMLCLLLLSWGVFSMYLFYSNFYIQLILGRSALITAVWYGPWAAGGLVLSLLSGSILHILPGRVLLIISGTS
KVLAVLFFALIPDNPNYWAWVFPAMLCEAACVDVLWTVSNVFLTTSLPRHRQGLAGAVISVTLFLGGALFLAVAD
VAKEQFHAAGWELKRQYKGIFWVGVGFAGLALAICFFIRLGRAGCALTVEEQQEAKLDPDLAREASLSGTEARSV
ESDSDTMVEVEIEGSGSGEKRKA*
Coding >Hirsu2|1867
ATGACCTCTCAAGAGCCTGCGGTGACAGTGCAGGAGGTCTCGGAAGAGCTCCCCCCCCAGAGGCTTGACGTCGAG
AAGCTCGGCCGGCAGCGGCCCGCCGACTTCTCGTCGACATGGCTGGAGGTTGCCTTTGTCACCTCCATGCTCGGG
GCTCTCTCCATGTGTGATTTTGTCATTGGCGGCTTTCAAGTTGTCTTGCCGGCCCTGGTCAAGCCGTTTGACATT
CCACCCGGGTCTCAGACATGGCCGTCCAGTGTCCTGACCCTGGTGGCTGGCGCATTCCTCTTCCCGCTCGGCCGG
CTGAGTGACATGTACGGCGGCTTCTTCCTCTTCAACGGCGGCCTGCTGTGGCTCACGCTGTGGACGGTCGTGGGG
GGCTTCGCCGGCAACTTCACCGTGCTCGTCGTGTGCCGGGCCCTGCAGGGCCTGGGCGCGGCCGCCTTCCTTCCT
GCCGGCATCTCGCTGCTGGGGCGCATCTACCGGCCGGGCCCGAGGAAGAACCTGGTGTTTGCGCTGTACGGGGCC
GTGGCCCCTCTGGGCTTCTTCGCCGGCATCATCGTCGGCGGCCTGTCGCAGGACCTGCTGTCCTGGCGCTGGTAC
TTTTGGCTGGGCGGCATCATCCTCGGCGTGTGCTGGGTCGGGACGGTGCTGACGTCGCCTCGTGACTATGCGGCG
GCGCGCGAGATGAACGTCCGGATGGACTGGTGGGGCGTCCTGACCATGGTCCCGGGCCTGATGCTCTTCATCTAC
GCCATTACCGAGAGCGTCAACAACGGCTGGTCGTCGCCGCAGATCATCGCGACGCTGGTGCTCGGCATCTTGTTC
CTCGCGGCGACGGTGTACGTAGAGGGATGGGTGGCCACGTCGCCGCTGATCCCCGCCGACATCTTCCGCGTGCCG
TACATGAAGCGGATGCTGTGCCTCCTGCTGCTGTCCTGGGGCGTCTTCTCCATGTACCTGTTCTACTCCAACTTT
TACATCCAACTCATTCTCGGGCGCTCGGCGCTGATCACGGCGGTCTGGTACGGGCCCTGGGCCGCGGGCGGCCTG
GTCTTGTCGTTGCTGAGCGGCTCCATCCTGCACATCCTGCCCGGCAGGGTGCTGCTCATCATCTCGGGCACGTCC
AAGGTGCTGGCCGTCCTGTTCTTCGCGCTGATCCCCGACAACCCCAACTACTGGGCTTGGGTGTTCCCGGCCATG
CTGTGCGAGGCGGCCTGCGTCGATGTGCTGTGGACGGTGAGCAACGTCTTCCTCACGACCAGCCTGCCGCGGCAT
CGGCAGGGCCTGGCCGGGGCCGTGATCAGCGTGACGCTATTCCTCGGGGGCGCCCTGTTCCTGGCCGTCGCCGAC
GTGGCCAAGGAGCAGTTCCACGCGGCCGGCTGGGAGCTCAAGAGGCAGTACAAGGGCATCTTCTGGGTCGGCGTC
GGCTTCGCCGGCCTGGCCCTGGCCATCTGCTTCTTCATCCGGCTGGGCCGGGCAGGCTGCGCCCTGACGGTGGAG
GAGCAGCAGGAGGCCAAGCTCGACCCGGACCTGGCCCGGGAGGCGTCGCTGTCGGGGACGGAGGCGAGGTCGGTC
GAGTCGGACTCGGACACCATGGTCGAGGTCGAGATCGAGGGCTCGGGCTCGGGCGAGAAGAGGAAGGCCTGA
Transcript >Hirsu2|1867
ATGACCTCTCAAGAGCCTGCGGTGACAGTGCAGGAGGTCTCGGAAGAGCTCCCCCCCCAGAGGCTTGACGTCGAG
AAGCTCGGCCGGCAGCGGCCCGCCGACTTCTCGTCGACATGGCTGGAGGTTGCCTTTGTCACCTCCATGCTCGGG
GCTCTCTCCATGTGTGATTTTGTCATTGGCGGCTTTCAAGTTGTCTTGCCGGCCCTGGTCAAGCCGTTTGACATT
CCACCCGGGTCTCAGACATGGCCGTCCAGTGTCCTGACCCTGGTGGCTGGCGCATTCCTCTTCCCGCTCGGCCGG
CTGAGTGACATGTACGGCGGCTTCTTCCTCTTCAACGGCGGCCTGCTGTGGCTCACGCTGTGGACGGTCGTGGGG
GGCTTCGCCGGCAACTTCACCGTGCTCGTCGTGTGCCGGGCCCTGCAGGGCCTGGGCGCGGCCGCCTTCCTTCCT
GCCGGCATCTCGCTGCTGGGGCGCATCTACCGGCCGGGCCCGAGGAAGAACCTGGTGTTTGCGCTGTACGGGGCC
GTGGCCCCTCTGGGCTTCTTCGCCGGCATCATCGTCGGCGGCCTGTCGCAGGACCTGCTGTCCTGGCGCTGGTAC
TTTTGGCTGGGCGGCATCATCCTCGGCGTGTGCTGGGTCGGGACGGTGCTGACGTCGCCTCGTGACTATGCGGCG
GCGCGCGAGATGAACGTCCGGATGGACTGGTGGGGCGTCCTGACCATGGTCCCGGGCCTGATGCTCTTCATCTAC
GCCATTACCGAGAGCGTCAACAACGGCTGGTCGTCGCCGCAGATCATCGCGACGCTGGTGCTCGGCATCTTGTTC
CTCGCGGCGACGGTGTACGTAGAGGGATGGGTGGCCACGTCGCCGCTGATCCCCGCCGACATCTTCCGCGTGCCG
TACATGAAGCGGATGCTGTGCCTCCTGCTGCTGTCCTGGGGCGTCTTCTCCATGTACCTGTTCTACTCCAACTTT
TACATCCAACTCATTCTCGGGCGCTCGGCGCTGATCACGGCGGTCTGGTACGGGCCCTGGGCCGCGGGCGGCCTG
GTCTTGTCGTTGCTGAGCGGCTCCATCCTGCACATCCTGCCCGGCAGGGTGCTGCTCATCATCTCGGGCACGTCC
AAGGTGCTGGCCGTCCTGTTCTTCGCGCTGATCCCCGACAACCCCAACTACTGGGCTTGGGTGTTCCCGGCCATG
CTGTGCGAGGCGGCCTGCGTCGATGTGCTGTGGACGGTGAGCAACGTCTTCCTCACGACCAGCCTGCCGCGGCAT
CGGCAGGGCCTGGCCGGGGCCGTGATCAGCGTGACGCTATTCCTCGGGGGCGCCCTGTTCCTGGCCGTCGCCGAC
GTGGCCAAGGAGCAGTTCCACGCGGCCGGCTGGGAGCTCAAGAGGCAGTACAAGGGCATCTTCTGGGTCGGCGTC
GGCTTCGCCGGCCTGGCCCTGGCCATCTGCTTCTTCATCCGGCTGGGCCGGGCAGGCTGCGCCCTGACGGTGGAG
GAGCAGCAGGAGGCCAAGCTCGACCCGGACCTGGCCCGGGAGGCGTCGCTGTCGGGGACGGAGGCGAGGTCGGTC
GAGTCGGACTCGGACACCATGGTCGAGGTCGAGATCGAGGGCTCGGGCTCGGGCGAGAAGAGGAAGGCCTGA
Gene >Hirsu2|1867
ATGACCTCTCAAGAGCCTGCGGTGACAGTGCAGGAGGTCTCGGAAGAGCTCCCCCCCCAGAGGCTTGACGTCGAG
AAGCTCGGCCGGCAGCGGCCCGCCGACTTCTCGTCGACATGGCTGGAGGTTGCCTTTGTCACCTCCATGCTCGGG
GCTCTCTCCATGTGTGTGGGTGCTTCCTCGTGATCGAGGTCTCCGTTGTCGTCGTTTAGCTGCTGCCTCCGCCGC
CGTTGCTGATGCTCGACGGACGATTGGGCTCTGCGGCATGGCACATCTCCAATCTTCCTCTTCTTCTTCTGCTTC
TTCTTGCTTCCACTCCGCCTCCTCTTCATCCTCCTCCTCCTCCTCCTCCTCCTTCTCCCGACATCTGCTCCTGCT
CCTTTCTAGCTCCGCGTCGTGGGACAGAGCAGCTTGCTGATCCTCATCGGGAACCGCAGGATTTTGTCATTGGCG
GCTTTCAAGTTGTCTTGCCGGCCCTGGTCAAGCCGTTTGACATTCCACCCGGGTCTCAGACATGGCCGTCCAGTG
TCCTGACCCTGGTGGCTGGCGCATTCCTCTTCCCGCTCGGCCGGCTGAGTGACATGTACGGCGGCTTCTTCCTCT
TCAACGGCGGCCTGCTGTGGCTCACGCTGTGGACGGTCGTGGGGGGCTTCGCCGGCAACTTCACCGTGCTCGTCG
TGTGCCGGGCCCTGCAGGGCCTGGGCGCGGCCGCCTTCCTTCCTGCCGGCATCTCGCTGCTGGGGCGCATCTACC
GGCCGGGCCCGAGGAAGAACCTGGTGTTTGCGCTGTACGGGGCCGTGGCCCCTCTGGGCTTCTTCGCCGGCATCA
TCGTCGGCGGCCTGTCGCAGGACCTGCTGTCCTGGCGCTGGTACTTTTGGCTGGGCGGCATCATCCTCGGCGTGT
GCTGGGTCGGGACGGTGCTGACGTCGCCTCGTGACTATGCGGCGGCGCGCGAGATGAACGTCCGGATGGACTGGT
GGGGCGTCCTGACCATGGTCCCGGGCCTGATGCTCTTCATCTACGCCATTACCGAGAGCGTCAACAACGGCTGGT
CGTCGCCGCAGATCATCGCGACGCTGGTGCTCGGCATCTTGTTCCTCGCGGCGACGGTGTACGTAGAGGGATGGG
TGGCCACGTCGCCGCTGATCCCCGCCGACATCTTCCGCGTGCCGTACATGAAGCGGATGCTGTGCCTCCTGCTGC
TGTCCTGGGGCGTCTTCTCCATGTACCTGTTCTACTCCAACTTTTAGTGAGTGCCGATCACCTTGCCGCGTGTCT
CCGGGGGGGGGGGGGGGGGGGGGGGGGGCGCGGACCGATCCAGGGCTGACGGCGGGCACGCACAGCATCCAACTC
ATTCTCGGGCGCTCGGCGCTGATCACGGCGGTCTGGTACGGGCCCTGGGCCGCGGGCGGCCTGGTCTTGTCGTTG
CTGAGCGGCTCCATCCTGCACATCCTGCCCGGCAGGGTGCTGCTCATCATCTCGGGCACGTCCAAGGTGCTGGCC
GTCCTGTTCTTCGCGCTGATCCCCGACAACCCCAACTACTGGGCTTGGGTGTTCCCGGCCATGCTGTGCGAGGCG
GCCTGCGTCGATGTGCTGTGGACGGTGAGCAACGTCTTCCTCACGACCAGCCTGCCGCGGCATCGGCAGGGCCTG
GCCGGGGCCGTGATCAGCGTGACGCTATTCCTCGGGGGCGCCCTGTTCCTGGCCGTCGCCGACGTGGCCAAGGAG
CAGTTCCACGCGGCCGGCTGGGAGCTCAAGAGGCAGTACAAGGGCATCTTCTGGGTCGGCGTCGGCTTCGCCGGC
CTGGCCCTGGCCATCTGCTTCTTCATCCGGCTGGGCCGGGCAGGCTGCGCCCTGACGGTGGAGGAGCAGCAGGAG
GCCAAGCTCGACCCGGACCTGGCCCGGGAGGCGTCGCTGTCGGGGACGGAGGCGAGGTCGGTCGAGTCGGACTCG
GACACCATGGTCGAGGTCGAGATCGAGGGCTCGGGCTCGGGCGAGAAGAGGAAGGCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail