Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1865
Gene name
LocationContig_1424:1228..2970
Strand-
Gene length (bp)1742
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.6E-49 167 365
PF07714 Pkinase_Tyr Protein tyrosine kinase 3.6E-25 166 364
PF00498 FHA FHA domain 1.5E-14 50 128

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 39 369 4.0E-43
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 69 381 2.0E-33
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 156 362 8.0E-33
sp|P24719|MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEK1 PE=3 SV=1 39 363 9.0E-33
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 156 362 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 39 369 4.0E-43
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 69 381 2.0E-33
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 156 362 8.0E-33
sp|P24719|MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEK1 PE=3 SV=1 39 363 9.0E-33
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 156 362 1.0E-32
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 96 380 5.0E-32
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 162 362 9.0E-32
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 162 362 2.0E-31
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 162 362 2.0E-31
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 69 362 3.0E-31
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 169 362 2.0E-30
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 169 362 2.0E-30
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 169 362 6.0E-30
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 67 385 7.0E-30
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 161 366 1.0E-29
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 161 366 1.0E-29
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 152 362 1.0E-29
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 161 363 2.0E-29
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 166 363 3.0E-29
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 167 363 3.0E-29
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 167 362 3.0E-29
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 166 363 3.0E-29
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 166 363 3.0E-29
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 167 363 3.0E-29
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 167 370 4.0E-29
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 167 363 4.0E-29
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 167 363 4.0E-29
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 167 370 4.0E-29
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 161 366 6.0E-29
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 153 375 7.0E-29
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 167 366 7.0E-29
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 161 366 8.0E-29
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 169 362 1.0E-28
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 167 380 1.0E-28
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 161 363 2.0E-28
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 167 363 2.0E-28
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 161 386 3.0E-28
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 169 362 3.0E-28
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 169 362 3.0E-28
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 161 366 3.0E-28
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 169 362 4.0E-28
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 167 362 5.0E-28
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 161 375 8.0E-28
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 130 363 9.0E-28
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 161 401 1.0E-27
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 161 401 1.0E-27
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 161 362 1.0E-27
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 130 363 2.0E-27
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 167 366 2.0E-27
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 167 366 2.0E-27
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 161 366 2.0E-27
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 130 363 3.0E-27
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 167 366 5.0E-27
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 167 362 5.0E-27
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 161 366 9.0E-27
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 168 366 9.0E-27
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 162 362 9.0E-27
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 161 366 9.0E-27
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 161 366 1.0E-26
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 164 362 1.0E-26
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 161 366 1.0E-26
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 167 362 1.0E-26
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 154 378 1.0E-26
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 152 366 2.0E-26
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 169 365 2.0E-26
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 161 392 2.0E-26
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 161 366 3.0E-26
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 152 366 3.0E-26
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 167 366 3.0E-26
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 167 381 3.0E-26
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 161 362 4.0E-26
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 167 366 4.0E-26
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 70 363 4.0E-26
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 169 362 4.0E-26
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 144 362 4.0E-26
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 167 366 5.0E-26
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 140 366 6.0E-26
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 161 370 6.0E-26
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 169 362 7.0E-26
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 169 362 7.0E-26
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 144 357 7.0E-26
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 169 362 8.0E-26
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 83 365 8.0E-26
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 142 371 1.0E-25
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 169 362 1.0E-25
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 161 362 1.0E-25
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 161 366 1.0E-25
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 142 371 1.0E-25
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 161 366 1.0E-25
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 163 366 1.0E-25
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 150 366 1.0E-25
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 142 371 1.0E-25
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 167 362 2.0E-25
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 147 363 2.0E-25
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 157 357 2.0E-25
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 163 363 2.0E-25
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 161 366 2.0E-25
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 53 365 2.0E-25
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 162 362 2.0E-25
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 162 362 3.0E-25
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 162 362 3.0E-25
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 148 362 3.0E-25
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 162 366 3.0E-25
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 162 362 3.0E-25
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 161 362 4.0E-25
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 151 366 4.0E-25
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 161 366 4.0E-25
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 167 362 4.0E-25
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 167 362 5.0E-25
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 167 366 7.0E-25
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 167 362 8.0E-25
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 161 363 8.0E-25
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 152 366 9.0E-25
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 166 362 1.0E-24
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 161 365 1.0E-24
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 167 363 1.0E-24
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 161 366 2.0E-24
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 53 365 2.0E-24
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 161 366 2.0E-24
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 157 363 2.0E-24
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 169 363 3.0E-24
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 167 362 3.0E-24
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 161 366 3.0E-24
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 167 362 3.0E-24
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 166 369 3.0E-24
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 167 362 4.0E-24
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 167 385 5.0E-24
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 148 389 6.0E-24
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 169 362 6.0E-24
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 161 362 7.0E-24
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 166 369 8.0E-24
sp|A4IFM7|MYLK2_BOVIN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Bos taurus GN=MYLK2 PE=2 SV=1 165 363 8.0E-24
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 146 362 9.0E-24
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 167 379 1.0E-23
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 167 379 1.0E-23
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 167 379 1.0E-23
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 162 363 1.0E-23
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 152 374 1.0E-23
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 207 362 1.0E-23
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 152 363 1.0E-23
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 162 363 2.0E-23
sp|P07313|MYLK2_RABIT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Oryctolagus cuniculus GN=MYLK2 PE=1 SV=3 165 363 2.0E-23
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 162 363 2.0E-23
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 166 357 2.0E-23
sp|P20689|MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus GN=Mylk2 PE=1 SV=2 165 363 2.0E-23
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 167 379 2.0E-23
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 167 362 2.0E-23
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 161 366 2.0E-23
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 152 389 3.0E-23
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 213 362 3.0E-23
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 169 384 3.0E-23
sp|Q875L0|HOG1_CRYPA Mitogen-activated protein kinase HOG1 OS=Cryphonectria parasitica GN=HOG1 PE=1 SV=1 155 362 3.0E-23
sp|P0C431|HOG1_GIBZE Mitogen-activated protein kinase HOG1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HOG1 PE=3 SV=1 155 362 3.0E-23
sp|Q2WFL5|HOG1_COCMI Mitogen-activated protein kinase HOG1 OS=Cochliobolus miyabeanus GN=HOG1 PE=3 SV=1 155 362 3.0E-23
sp|Q4W6D3|HOG1_COCHE Mitogen-activated protein kinase HOG1 OS=Cochliobolus heterostrophus GN=HOG1 PE=1 SV=1 155 362 4.0E-23
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 169 362 4.0E-23
sp|Q39025|MPK5_ARATH Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2 157 363 4.0E-23
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 213 362 4.0E-23
sp|Q96TL5|HOG1_NEUCR Mitogen-activated protein kinase hog-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hog-1 PE=1 SV=1 155 362 5.0E-23
sp|Q9UV51|HOG1_MAGO7 Mitogen-activated protein kinase HOG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HOG1 PE=3 SV=1 155 362 5.0E-23
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 169 363 5.0E-23
sp|Q2H332|HOG1_CHAGB Mitogen-activated protein kinase HOG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HOG1 PE=3 SV=1 155 362 5.0E-23
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 152 366 5.0E-23
sp|Q6PWX2|HOG1_BEABA Mitogen-activated protein kinase HOG1 OS=Beauveria bassiana GN=HOG1 PE=3 SV=1 155 362 5.0E-23
sp|Q75Q66|HOG1_COLOR Mitogen-activated protein kinase HOG1 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=HOG1 PE=3 SV=1 155 362 5.0E-23
sp|Q9H1R3|MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens GN=MYLK2 PE=1 SV=3 165 363 6.0E-23
sp|A3EZ55|HOG1A_WALI9 Mitogen-activated protein kinase HOG1A OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1A PE=1 SV=2 169 357 6.0E-23
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 153 366 6.0E-23
sp|Q52PH6|HOG1_ALTBR Mitogen-activated protein kinase HOG1 OS=Alternaria brassicicola GN=HOG1 PE=3 SV=1 155 362 6.0E-23
sp|Q2WGK3|HOG1_TRIHA Mitogen-activated protein kinase hog1 OS=Trichoderma harzianum GN=hog1 PE=1 SV=1 155 362 6.0E-23
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 152 366 6.0E-23
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 167 363 7.0E-23
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 155 362 7.0E-23
sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1 156 363 7.0E-23
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 162 357 7.0E-23
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 164 375 8.0E-23
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 166 362 8.0E-23
sp|Q6FIU2|HOG1_CANGA Mitogen-activated protein kinase HOG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HOG1 PE=3 SV=1 148 357 8.0E-23
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 168 363 9.0E-23
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 155 362 9.0E-23
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 155 363 9.0E-23
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 160 397 9.0E-23
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 167 366 1.0E-22
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 155 362 1.0E-22
sp|Q8VCR8|MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus GN=Mylk2 PE=1 SV=2 165 363 1.0E-22
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 156 363 1.0E-22
sp|A1CPG7|HOG1_ASPCL Mitogen-activated protein kinase hog1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hog1 PE=3 SV=1 155 362 1.0E-22
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 156 362 1.0E-22
sp|Q0U4L8|HOG1_PHANO Mitogen-activated protein kinase HOG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HOG1 PE=3 SV=2 155 362 1.0E-22
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 155 363 1.0E-22
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 167 373 1.0E-22
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 166 362 1.0E-22
sp|Q4WSF6|HOG1_ASPFU Mitogen-activated protein kinase hog1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hog1 PE=1 SV=1 155 362 1.0E-22
sp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1 160 363 1.0E-22
sp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2 160 363 1.0E-22
sp|Q09892|HOG1_SCHPO Mitogen-activated protein kinase sty1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sty1 PE=1 SV=1 155 357 1.0E-22
sp|Q39024|MPK4_ARATH Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana GN=MPK4 PE=1 SV=2 156 363 1.0E-22
sp|A1D2C9|HOG1_NEOFI Mitogen-activated protein kinase hog1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hog1 PE=3 SV=1 155 362 1.0E-22
sp|Q6XKY3|HOG1_HYPAT Mitogen-activated protein kinase hog1 OS=Hypocrea atroviridis GN=hog1 PE=3 SV=1 155 362 1.0E-22
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 166 362 1.0E-22
sp|Q9M1Z5|MPK10_ARATH Mitogen-activated protein kinase 10 OS=Arabidopsis thaliana GN=MPK10 PE=1 SV=1 161 362 1.0E-22
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 166 362 1.0E-22
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 155 362 2.0E-22
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 157 366 2.0E-22
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 152 389 2.0E-22
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 167 362 2.0E-22
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 167 363 2.0E-22
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 169 369 2.0E-22
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 161 381 2.0E-22
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 166 362 2.0E-22
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 162 357 2.0E-22
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 166 362 2.0E-22
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 166 362 2.0E-22
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 169 362 2.0E-22
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 167 362 2.0E-22
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 150 362 3.0E-22
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 167 363 3.0E-22
sp|A1IVT7|HOG1_BOTFB Mitogen-activated protein kinase hog1 OS=Botryotinia fuckeliana (strain B05.10) GN=hog1 PE=1 SV=1 155 362 3.0E-22
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 75 362 3.0E-22
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 161 362 3.0E-22
sp|O14019|HAL4_SCHPO Serine/threonine-protein kinase hal4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hal4 PE=1 SV=1 155 363 3.0E-22
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 167 363 3.0E-22
sp|Q4PC06|HOG1_USTMA Mitogen-activated protein kinase HOG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HOG1 PE=3 SV=1 157 362 3.0E-22
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 167 373 3.0E-22
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 160 362 4.0E-22
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 167 363 4.0E-22
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 140 373 4.0E-22
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 153 362 4.0E-22
sp|Q702W0|HOG1_BLAAD Mitogen-activated protein kinase hog1 OS=Blastobotrys adeninivorans GN=hog1 PE=1 SV=1 155 362 4.0E-22
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 167 375 4.0E-22
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 153 362 4.0E-22
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 169 363 4.0E-22
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 169 362 4.0E-22
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 161 366 4.0E-22
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 155 363 5.0E-22
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 167 375 5.0E-22
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 167 362 5.0E-22
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 146 362 5.0E-22
sp|Q0D0P5|HOG1_ASPTN Mitogen-activated protein kinase hog1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hog1 PE=3 SV=2 155 362 5.0E-22
sp|Q6C4M9|HOG1_YARLI Mitogen-activated protein kinase HOG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOG1 PE=3 SV=1 155 362 5.0E-22
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 158 362 5.0E-22
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 169 384 5.0E-22
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 158 362 5.0E-22
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 169 379 5.0E-22
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 167 362 5.0E-22
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 169 362 5.0E-22
sp|Q9P419|HOG1_EMENI Mitogen-activated protein kinase hog1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hog1 PE=1 SV=1 155 362 6.0E-22
sp|P32485|HOG1_YEAST Mitogen-activated protein kinase HOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOG1 PE=1 SV=2 148 357 6.0E-22
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 169 384 6.0E-22
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 155 363 7.0E-22
sp|A2QRF6|HOG1_ASPNC Mitogen-activated protein kinase hog1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hog1 PE=3 SV=2 155 362 7.0E-22
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 157 362 7.0E-22
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 148 363 7.0E-22
sp|P0CP68|HOG1_CRYNJ Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HOG1 PE=1 SV=1 157 362 7.0E-22
sp|Q56R42|HOG1_CRYNH Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=HOG1 PE=1 SV=1 157 362 7.0E-22
sp|P0CP69|HOG1_CRYNB Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HOG1 PE=3 SV=1 157 362 7.0E-22
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 159 362 7.0E-22
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 155 363 7.0E-22
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 156 363 7.0E-22
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 167 362 8.0E-22
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 167 362 8.0E-22
sp|Q6CJA8|HOG1_KLULA Mitogen-activated protein kinase HOG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HOG1 PE=3 SV=1 147 357 8.0E-22
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 168 363 8.0E-22
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 156 362 8.0E-22
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 148 390 8.0E-22
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 163 359 8.0E-22
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 158 362 9.0E-22
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 167 362 9.0E-22
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 146 365 1.0E-21
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 169 362 1.0E-21
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 169 363 1.0E-21
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 169 381 1.0E-21
sp|Q0CIC7|MPKC_ASPTN Mitogen-activated protein kinase mpkC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mpkC PE=3 SV=2 158 362 1.0E-21
sp|Q92207|HOG1_CANAL Mitogen-activated protein kinase HOG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HOG1 PE=1 SV=2 153 357 1.0E-21
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 161 366 1.0E-21
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 169 362 1.0E-21
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 169 362 1.0E-21
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 169 381 1.0E-21
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 169 362 1.0E-21
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 169 362 1.0E-21
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 169 362 1.0E-21
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 169 362 1.0E-21
sp|Q9D2E1|TSSK3_MOUSE Testis-specific serine/threonine-protein kinase 3 OS=Mus musculus GN=Tssk3 PE=2 SV=1 154 362 1.0E-21
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 169 362 1.0E-21
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 169 363 1.0E-21
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 169 362 1.0E-21
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 167 362 1.0E-21
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 169 379 1.0E-21
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 169 363 1.0E-21
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 162 362 1.0E-21
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 155 362 1.0E-21
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 208 363 2.0E-21
sp|Q9FFP9|SRK2H_ARATH Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana GN=SRK2H PE=1 SV=1 169 363 2.0E-21
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 167 376 2.0E-21
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 167 362 2.0E-21
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 169 362 2.0E-21
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 167 362 2.0E-21
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 169 362 2.0E-21
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 169 362 2.0E-21
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 169 362 2.0E-21
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 169 362 2.0E-21
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 153 362 2.0E-21
sp|Q5J4W4|MPK2_ORYSJ Mitogen-activated protein kinase 2 OS=Oryza sativa subsp. japonica GN=MPK2 PE=2 SV=1 157 363 2.0E-21
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 169 362 2.0E-21
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 167 366 2.0E-21
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 169 381 2.0E-21
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 169 362 2.0E-21
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 167 363 2.0E-21
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 156 362 2.0E-21
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 158 362 2.0E-21
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 157 366 2.0E-21
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 146 363 2.0E-21
sp|A3LN91|HOG1_PICST Mitogen-activated protein kinase HOG1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HOG1 PE=3 SV=2 153 357 2.0E-21
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 164 357 2.0E-21
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 153 362 2.0E-21
sp|Q02066|AAIP_WHEAT Abscisic acid-inducible protein kinase (Fragment) OS=Triticum aestivum PE=2 SV=1 170 363 2.0E-21
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 169 381 3.0E-21
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 169 362 3.0E-21
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 169 381 3.0E-21
sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 142 363 3.0E-21
sp|Q2U469|MPKC_ASPOR Mitogen-activated protein kinase mpkC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpkC PE=3 SV=2 160 362 3.0E-21
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 162 363 3.0E-21
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 169 366 3.0E-21
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 166 362 3.0E-21
sp|P43292|SRK2G_ARATH Serine/threonine-protein kinase SRK2G OS=Arabidopsis thaliana GN=SRK2G PE=1 SV=2 169 363 3.0E-21
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 169 363 3.0E-21
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 152 357 3.0E-21
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 158 363 4.0E-21
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 168 363 4.0E-21
sp|Q9LQQ9|MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana GN=MPK13 PE=1 SV=1 157 362 4.0E-21
sp|Q6GLS4|CAMKV_XENLA CaM kinase-like vesicle-associated protein OS=Xenopus laevis GN=camkv PE=2 SV=1 213 363 4.0E-21
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 166 362 4.0E-21
sp|Q39192|SRK2D_ARATH Serine/threonine-protein kinase SRK2D OS=Arabidopsis thaliana GN=SRK2D PE=1 SV=1 169 363 4.0E-21
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 166 362 4.0E-21
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 167 362 4.0E-21
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 167 363 5.0E-21
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 154 366 5.0E-21
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 167 362 5.0E-21
sp|Q6L5D4|MPK9_ORYSJ Mitogen-activated protein kinase 9 OS=Oryza sativa subsp. japonica GN=MPK9 PE=3 SV=2 144 363 6.0E-21
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 167 362 6.0E-21
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 168 363 6.0E-21
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 169 369 6.0E-21
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 169 363 6.0E-21
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 167 362 6.0E-21
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 126 362 6.0E-21
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 167 362 6.0E-21
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 158 365 7.0E-21
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 167 363 7.0E-21
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 148 362 7.0E-21
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 169 369 7.0E-21
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 213 363 7.0E-21
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 154 392 7.0E-21
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 167 362 7.0E-21
sp|Q750A9|HOG1_ASHGO Mitogen-activated protein kinase HOG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HOG1 PE=3 SV=2 155 357 8.0E-21
sp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2 157 363 8.0E-21
sp|Q8GYQ5|MPK12_ARATH Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1 156 363 8.0E-21
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 167 362 8.0E-21
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 213 363 8.0E-21
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 167 362 8.0E-21
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 167 362 8.0E-21
sp|Q63092|CAMKV_RAT CaM kinase-like vesicle-associated protein OS=Rattus norvegicus GN=Camkv PE=1 SV=1 213 363 9.0E-21
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 152 366 9.0E-21
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 213 363 9.0E-21
sp|Q9HBH9|MKNK2_HUMAN MAP kinase-interacting serine/threonine-protein kinase 2 OS=Homo sapiens GN=MKNK2 PE=1 SV=3 158 363 9.0E-21
sp|Q32MK0|MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens GN=MYLK3 PE=2 SV=3 142 363 1.0E-20
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 167 362 1.0E-20
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 169 381 1.0E-20
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 161 362 1.0E-20
sp|Q9UV50|HOG1_DEBHA Mitogen-activated protein kinase HOG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HOG1 PE=1 SV=3 153 357 1.0E-20
sp|Q3UHL1|CAMKV_MOUSE CaM kinase-like vesicle-associated protein OS=Mus musculus GN=Camkv PE=1 SV=2 214 363 1.0E-20
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 167 366 1.0E-20
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 161 363 1.0E-20
sp|Q1L5Z8|HOG1_TORDE Mitogen-activated protein kinase HOG1 OS=Torulaspora delbrueckii GN=HOG1 PE=1 SV=1 148 357 1.0E-20
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 167 366 1.0E-20
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 210 363 1.0E-20
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 169 362 1.0E-20
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 167 363 1.0E-20
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 168 369 1.0E-20
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 169 362 1.0E-20
sp|Q40531|NTF6_TOBAC Mitogen-activated protein kinase homolog NTF6 OS=Nicotiana tabacum GN=NTF6 PE=2 SV=1 160 362 1.0E-20
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 167 363 1.0E-20
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 169 362 1.0E-20
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 169 379 1.0E-20
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 169 363 1.0E-20
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 169 362 1.0E-20
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 161 366 1.0E-20
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 39 362 1.0E-20
sp|Q8NCB2|CAMKV_HUMAN CaM kinase-like vesicle-associated protein OS=Homo sapiens GN=CAMKV PE=2 SV=2 214 363 1.0E-20
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 159 359 2.0E-20
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 167 362 2.0E-20
sp|Q96PN8|TSSK3_HUMAN Testis-specific serine/threonine-protein kinase 3 OS=Homo sapiens GN=TSSK3 PE=1 SV=1 154 362 2.0E-20
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 161 362 2.0E-20
sp|Q5I6M2|HOG1_SETTU Mitogen-activated protein kinase HOG1 OS=Setosphaeria turcica GN=HOG1 PE=2 SV=2 172 362 2.0E-20
sp|E9PT87|MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus GN=Mylk3 PE=1 SV=1 142 363 2.0E-20
sp|Q7SY49|CAMKV_DANRE CaM kinase-like vesicle-associated protein OS=Danio rerio GN=camkv PE=2 SV=2 217 363 2.0E-20
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 207 363 2.0E-20
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 167 363 2.0E-20
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 169 374 2.0E-20
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 167 362 2.0E-20
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 140 362 2.0E-20
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 150 362 2.0E-20
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 150 362 2.0E-20
sp|Q38HL5|HOG1_EURHE Mitogen-activated protein kinase hog1 OS=Eurotium herbariorum GN=hog1 PE=3 SV=1 155 362 3.0E-20
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 158 365 3.0E-20
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 167 363 3.0E-20
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 167 363 3.0E-20
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 208 363 3.0E-20
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 169 362 3.0E-20
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 167 362 3.0E-20
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 207 363 3.0E-20
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 169 362 3.0E-20
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 167 362 3.0E-20
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 167 363 3.0E-20
sp|O93982|HOG1_ZYGRC Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HOG1 PE=3 SV=2 148 357 3.0E-20
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 167 362 3.0E-20
sp|O59853|HOG2_ZYGRO Mitogen-activated protein kinase HOG2 OS=Zygosaccharomyces rouxii GN=HOG2 PE=3 SV=1 148 357 3.0E-20
sp|Q8CDB0|MKNK2_MOUSE MAP kinase-interacting serine/threonine-protein kinase 2 OS=Mus musculus GN=Mknk2 PE=1 SV=3 158 363 3.0E-20
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 167 363 3.0E-20
sp|Q5U2N4|MKNK2_RAT MAP kinase-interacting serine/threonine-protein kinase 2 OS=Rattus norvegicus GN=Mknk2 PE=2 SV=1 158 363 4.0E-20
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 46 362 4.0E-20
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 169 362 4.0E-20
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 158 363 4.0E-20
sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 146 363 4.0E-20
sp|Q8SSA8|CHK1_ENCCU Probable serine/threonine-protein kinase CHK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHK1 PE=3 SV=1 200 363 4.0E-20
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 167 366 4.0E-20
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 167 363 4.0E-20
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 169 363 4.0E-20
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 167 362 5.0E-20
sp|Q6ZI44|SAPK6_ORYSJ Serine/threonine-protein kinase SAPK6 OS=Oryza sativa subsp. japonica GN=SAPK6 PE=2 SV=1 169 362 5.0E-20
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 204 363 5.0E-20
sp|O59854|HOG1_ZYGRO Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii GN=HOG1 PE=3 SV=1 148 357 5.0E-20
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 169 366 5.0E-20
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 161 362 5.0E-20
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 167 363 5.0E-20
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 167 410 5.0E-20
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 169 363 5.0E-20
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 167 356 5.0E-20
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 167 363 5.0E-20
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 167 362 5.0E-20
sp|Q7XQP4|SAPK7_ORYSJ Serine/threonine-protein kinase SAPK7 OS=Oryza sativa subsp. japonica GN=SAPK7 PE=2 SV=2 169 363 6.0E-20
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 155 363 6.0E-20
sp|Q9N3Z3|CHK1_CAEEL Serine/threonine-protein kinase chk-1 OS=Caenorhabditis elegans GN=chk-1 PE=2 SV=2 159 366 6.0E-20
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 169 362 6.0E-20
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 168 363 6.0E-20
sp|Q336X9|MPK6_ORYSJ Mitogen-activated protein kinase 6 OS=Oryza sativa subsp. japonica GN=MPK6 PE=2 SV=1 160 363 6.0E-20
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 167 362 6.0E-20
sp|Q9HG11|MPKC_EMENI Mitogen-activated protein kinase mpkC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpkC PE=2 SV=2 160 369 6.0E-20
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 167 366 6.0E-20
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 169 379 7.0E-20
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 167 362 7.0E-20
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 158 362 7.0E-20
sp|Q9BXA6|TSSK6_HUMAN Testis-specific serine/threonine-protein kinase 6 OS=Homo sapiens GN=TSSK6 PE=1 SV=1 157 374 7.0E-20
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 162 362 7.0E-20
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 167 357 7.0E-20
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 205 366 7.0E-20
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 162 362 7.0E-20
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 154 390 7.0E-20
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 169 362 8.0E-20
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 169 362 8.0E-20
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 158 363 8.0E-20
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 146 362 9.0E-20
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 158 362 9.0E-20
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 158 362 9.0E-20
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 214 412 9.0E-20
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 158 362 9.0E-20
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 158 362 9.0E-20
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 167 363 1.0E-19
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 158 362 1.0E-19
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 167 362 1.0E-19
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 152 363 1.0E-19
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 160 362 1.0E-19
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 169 362 1.0E-19
sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 157 374 1.0E-19
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 166 363 1.0E-19
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 146 363 1.0E-19
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 167 363 1.0E-19
sp|A2QN07|MPKC_ASPNC Mitogen-activated protein kinase mpkC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mpkC PE=3 SV=1 158 362 1.0E-19
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 166 363 1.0E-19
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 169 366 1.0E-19
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 158 365 1.0E-19
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 166 363 1.0E-19
sp|Q7XKA8|SAPK5_ORYSJ Serine/threonine-protein kinase SAPK5 OS=Oryza sativa subsp. japonica GN=SAPK5 PE=2 SV=1 167 363 1.0E-19
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 130 362 1.0E-19
sp|Q3UIZ8|MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus GN=Mylk3 PE=1 SV=1 142 363 1.0E-19
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 167 359 1.0E-19
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 166 363 1.0E-19
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 169 365 1.0E-19
sp|Q04770|CDK2_ENTHI Cell division protein kinase 2 homolog OS=Entamoeba histolytica GN=CDC2 PE=3 SV=1 160 357 1.0E-19
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 212 363 1.0E-19
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 158 362 1.0E-19
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 166 363 1.0E-19
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 158 385 1.0E-19
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 168 363 1.0E-19
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 167 359 1.0E-19
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 167 394 2.0E-19
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 151 359 2.0E-19
sp|P54739|PKAA_STRCO Serine/threonine-protein kinase PkaA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pkaA PE=3 SV=1 160 379 2.0E-19
sp|Q8QZX0|SBK1_MOUSE Serine/threonine-protein kinase SBK1 OS=Mus musculus GN=Sbk1 PE=2 SV=1 160 396 2.0E-19
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 161 363 2.0E-19
sp|P34208|CHK1_SCHPO Serine/threonine-protein kinase chk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chk1 PE=1 SV=2 156 362 2.0E-19
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 166 363 2.0E-19
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 143 363 3.0E-19
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 158 363 3.0E-19
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 146 362 3.0E-19
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 143 363 4.0E-19
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 167 363 5.0E-19
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 167 363 2.0E-16
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 131 363 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0005515 protein binding Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032555 purine ribonucleotide binding No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1865
MASQLAAKQPNRETNRSCGLETPDKCLLLSDRRKQDEYQELIPVWDDEIVKVGRDPLSRVCIEDDADNVVSREHC
EVYVVVYDESNSHVYVRDRRSSNGTFVNGVRIGTVESGTSAGYLLEHGDMIEIRPFWTLTFCENRRPKLHRLTNV
QETESKLFETKYHISQRCLGQGAEGVVCLATEVETRRQLVCKVVDLTAAKGKNAPDGLRRRLQEADVLRQLQHPN
ILPYVDAIISPHSLYMFMELATGGDLWSFLYQRGAVSEFETRVIVRQVVRALDYIHHKGVVHRDLKPENILLAYS
PNSKCHRIMLSDFGASAVPRRSRMLTHIGTANYQAPEIQGQPQLQTAAVDIWSLGVVALTVLTHHMDDFRTAGLH
LLDQARVDAFLEQNVFGGAGRSAAGDRKANCGPCRSSCPM*
Coding >Hirsu2|1865
ATGGCGTCTCAATTGGCGGCCAAGCAGCCAAATCGGGAAACCAATAGGAGCTGCGGTCTTGAAACGCCCGACAAA
TGCCTTCTCCTGAGCGACCGACGCAAGCAAGACGAGTATCAAGAGCTGATCCCTGTATGGGATGACGAGATCGTC
AAGGTCGGACGCGATCCGCTGTCCCGGGTGTGTATCGAGGATGACGCCGATAACGTGGTATCCCGCGAACACTGC
GAAGTGTACGTGGTGGTATATGACGAGTCCAACAGCCACGTGTACGTCCGAGACCGCAGGTCATCCAACGGGACA
TTTGTCAATGGCGTTCGAATTGGGACCGTCGAGTCTGGGACATCGGCTGGCTATCTTCTAGAGCATGGTGACATG
ATCGAGATCCGACCCTTCTGGACCCTCACCTTTTGTGAAAATCGAAGACCGAAGCTTCACCGCCTCACGAACGTA
CAGGAAACGGAATCCAAGCTCTTCGAGACCAAGTACCACATTAGCCAGCGTTGCCTCGGGCAAGGGGCAGAGGGC
GTGGTCTGCCTGGCCACGGAAGTCGAGACGAGGAGGCAGCTGGTCTGTAAGGTGGTCGATTTGACGGCGGCCAAG
GGCAAGAATGCCCCAGACGGCCTGCGGCGCAGGCTACAGGAAGCCGATGTTCTCCGCCAGCTCCAGCATCCCAAC
ATCCTACCCTATGTCGACGCCATCATCTCGCCTCATTCGCTATACATGTTCATGGAGCTGGCAACAGGAGGCGAC
TTGTGGTCCTTCCTATACCAACGTGGTGCCGTGAGCGAATTCGAGACTCGAGTCATCGTTCGCCAGGTGGTTCGC
GCTCTCGACTACATCCACCACAAGGGCGTCGTCCATCGCGACCTGAAGCCCGAAAACATCCTGCTCGCATACTCA
CCCAACAGCAAATGCCACCGAATCATGCTTTCGGATTTTGGGGCCAGTGCAGTCCCTCGCCGAAGCAGAATGCTG
ACGCACATTGGCACGGCCAATTACCAGGCCCCGGAAATCCAGGGCCAGCCCCAGCTCCAGACTGCCGCCGTCGAC
ATCTGGTCACTGGGCGTCGTGGCCCTCACCGTCCTCACGCACCACATGGACGACTTCCGTACGGCGGGCCTCCAT
CTCCTGGACCAGGCTCGGGTCGACGCGTTCCTGGAGCAGAACGTCTTTGGCGGGGCGGGTCGGTCAGCAGCTGGC
GATCGCAAGGCCAACTGCGGCCCATGCCGCTCCAGCTGCCCGATGTGA
Transcript >Hirsu2|1865
ATGGCGTCTCAATTGGCGGCCAAGCAGCCAAATCGGGAAACCAATAGGAGCTGCGGTCTTGAAACGCCCGACAAA
TGCCTTCTCCTGAGCGACCGACGCAAGCAAGACGAGTATCAAGAGCTGATCCCTGTATGGGATGACGAGATCGTC
AAGGTCGGACGCGATCCGCTGTCCCGGGTGTGTATCGAGGATGACGCCGATAACGTGGTATCCCGCGAACACTGC
GAAGTGTACGTGGTGGTATATGACGAGTCCAACAGCCACGTGTACGTCCGAGACCGCAGGTCATCCAACGGGACA
TTTGTCAATGGCGTTCGAATTGGGACCGTCGAGTCTGGGACATCGGCTGGCTATCTTCTAGAGCATGGTGACATG
ATCGAGATCCGACCCTTCTGGACCCTCACCTTTTGTGAAAATCGAAGACCGAAGCTTCACCGCCTCACGAACGTA
CAGGAAACGGAATCCAAGCTCTTCGAGACCAAGTACCACATTAGCCAGCGTTGCCTCGGGCAAGGGGCAGAGGGC
GTGGTCTGCCTGGCCACGGAAGTCGAGACGAGGAGGCAGCTGGTCTGTAAGGTGGTCGATTTGACGGCGGCCAAG
GGCAAGAATGCCCCAGACGGCCTGCGGCGCAGGCTACAGGAAGCCGATGTTCTCCGCCAGCTCCAGCATCCCAAC
ATCCTACCCTATGTCGACGCCATCATCTCGCCTCATTCGCTATACATGTTCATGGAGCTGGCAACAGGAGGCGAC
TTGTGGTCCTTCCTATACCAACGTGGTGCCGTGAGCGAATTCGAGACTCGAGTCATCGTTCGCCAGGTGGTTCGC
GCTCTCGACTACATCCACCACAAGGGCGTCGTCCATCGCGACCTGAAGCCCGAAAACATCCTGCTCGCATACTCA
CCCAACAGCAAATGCCACCGAATCATGCTTTCGGATTTTGGGGCCAGTGCAGTCCCTCGCCGAAGCAGAATGCTG
ACGCACATTGGCACGGCCAATTACCAGGCCCCGGAAATCCAGGGCCAGCCCCAGCTCCAGACTGCCGCCGTCGAC
ATCTGGTCACTGGGCGTCGTGGCCCTCACCGTCCTCACGCACCACATGGACGACTTCCGTACGGCGGGCCTCCAT
CTCCTGGACCAGGCTCGGGTCGACGCGTTCCTGGAGCAGAACGTCTTTGGCGGGGCGGGTCGGTCAGCAGCTGGC
GATCGCAAGGCCAACTGCGGCCCATGCCGCTCCAGCTGCCCGATGTGA
Gene >Hirsu2|1865
ATGGCGTCTCAATTGGCGGCCAAGCAGCCAAATCGGGAAACCAATAGGAGCTGCGGTCTTGAAACGCCCGACAAA
TGCCTTCTCCTGAGCGACCGACGCAAGCAAGACGAGTATCAAGGTGAGCCGGCCAGCCTTGCCTCGTTGGCTGCC
GGCCTCGTCCTCGCAGCGTTCTCATGACTTACTGTTCGGCGCAGAGCTGATCCCTGTATGGGATGACGAGATCGT
CAAGGTCGGACGCGATCCGCTGTCCCGGTATGCCAGCCAACGACCCAACACGTGAATTCAATGGGCTGACGCAGT
GCTGACGTGCAGGGTGTGTATCGAGGATGACGCCGATAACGTGGTATCCCGCGAACACTGCGAAGTGTACGTGGT
GGTATATGACGAGTCCAACAGCCACGTGTACGTCCGAGACCGCAGGTCATCCAACGGGACATTTGTCAATGGCGT
TCGAATTGGGACCGTCGAGTCTGGGACATCGGCTGGCTATCTTCTAGAGCATGGTGACATGATCGAGATCCGACC
CTTCTGGACCCTCACCTTTTGTGAAAATCGAAGACCGAAGCTTCACCGCCTCACGAACGTACAGGAAACGGAATC
CAAGGTGAGACTCCCCTTCACTCCCTTCGCTCAGAAGATTGACCGTCGCCAGCTCTTCGAGACCAAGTACCACAT
TAGCCAGCGTTGCCTCGGGCAAGGGGCAGAGGGCGTGGTCTGCCTGGCCACGGAAGTCGAGACGAGGAGGCAGCT
GGTCTGTAAGGTGGTCGATTTGACGGCGGCCAAGGGCAAGAATGCCCCAGACGGCCTGCGGCGCAGGCTACAGGA
AGCCGATGTTCTCCGCCAGCTCCAGCATGTATGAGAGAAAGGCCGCTTTGCAACAAGCTGCCCCGGCCCTGGGCT
GACTGTCCGATACTGCAGCCCAACATCCTACCCTATGTCGACGCCATCATCTCGCCTCATTCGCTGTCAGTGCCC
CGAAGCTCACCATGGCGGCGGGCAAGCTGACGAGCCTCAGATACATGTTCATGGAGCTGGCAACAGGAGGCGACT
TGTGGTCCTTCCTATACCAACGTGGTGCCGTGAGCGAATTCGAGACTCGAGTCATCGTTCGCCAGGTGGTTCGCG
CTCTCGACTACATCCACCACAAGGGCGTCGTCCATCGCGACCTGAAGCCCGAAAACATCCTGCTCGCATACTCAC
CCAACAGCAAATGCCACCGAATCATGCTTTCGGATTTTGGGGCCAGTGCAGTCCCTCGCCGAAGCAGAATGCTGA
CGCACATTGGCACGGCCAATTACCAGGCCCCGTGAGTCTTGGCCCATGCCGATGCGTGAGCAAGCTTACACGTTC
TAGGGAAATCCAGGGCCAGCCCCAGCTCCAGACTGCCGCCGTCGACATCTGGTCACTGGGCGTCGTGGCCCTCAC
CGTCCTCACGCACCACATGGACGACTTCCGTACGGCGGGCCTCCATCTCCTGGACCAGGCTCGGGTCGACGCGTT
CCTGGAGCAGAACGTCTTTGGCGGGGCGGGTCAATTCTCGTCCAACTGCGAGGATTTCGTCAGACGATGTCTCCA
GGTTTCGCCGCGTGATCGCCCACGTGCGGTCGAGGCCCGAATACACGACTGGCTTTGCACGCCTCAGACACATCT
GGCTCATTTCCGGGAACTGGAACGCAGGTCGGTCAGCAGCTGGCGATCGCAAGGCCAACTGCGGCCCATGCCGCT
CCAGCTGCCCGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail