Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1856
Gene name
LocationContig_1420:3769..5096
Strand+
Gene length (bp)1327
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 8.5E-05 124 194

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6702 0.2874 0.3641 0.0674 0.2251 0.1017 0.1069 0.0581 0.2018 0.1938

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup69
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5467
Ophiocordyceps australis 1348a (Ghana) OphauG2|5656
Ophiocordyceps australis 1348a (Ghana) OphauG2|7764
Ophiocordyceps australis map64 (Brazil) OphauB2|1311
Ophiocordyceps australis map64 (Brazil) OphauB2|1430
Ophiocordyceps australis map64 (Brazil) OphauB2|1646
Ophiocordyceps australis map64 (Brazil) OphauB2|4739
Ophiocordyceps camponoti-floridani Ophcf2|01223
Ophiocordyceps camponoti-rufipedis Ophun1|1554
Ophiocordyceps kimflemingae Ophio5|1785
Ophiocordyceps kimflemingae Ophio5|712
Ophiocordyceps subramaniannii Hirsu2|1787
Ophiocordyceps subramaniannii Hirsu2|1856 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4184
Ophiocordyceps subramaniannii Hirsu2|5652
Ophiocordyceps subramaniannii Hirsu2|952

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1856
MILFTSAQKPMLRAGKGTGGSRENRLFANGVSWENSLWRIIADELLLGGGAPQPLAAGTVYASPTIAMLAAAVSA
LAEGRVLAESSSHDGTERMQELYGLNAADMPLFGRQPCRRPAEGLVVLLTESTGSLGSCTLDSLMRNPRVSQIYY
LNRGRGSRERQERAQTARKLGPLTSEVECLDADLSQPCFGLSGQIAGVRRIIDFAAHSAYGARVLFISSVGAVGG
LAGDVTEQVYRDWEASISVIICRAGQVAGPLTETGSWPKQEWLPSLVASSKYLGLLPASLGRMNTVDWIPVDVLA
QSLAEVVVNPEAASAQAPSAAAVYHAANPRRIS*
Coding >Hirsu2|1856
ATGATCCTCTTTACCTCTGCGCAAAAGCCCATGCTGCGGGCCGGCAAAGGCACGGGTGGCAGCCGCGAGAACCGC
CTGTTTGCCAATGGCGTCAGCTGGGAGAACAGCCTCTGGCGCATCATTGCCGATGAGCTGCTGCTGGGCGGCGGC
GCACCACAGCCGCTGGCGGCCGGGACAGTCTACGCCTCGCCCACCATCGCCATGCTGGCCGCGGCTGTGTCGGCC
CTCGCTGAGGGTAGAGTGCTCGCGGAGTCATCGAGCCACGACGGAACGGAGAGGATGCAGGAGCTCTACGGCCTC
AACGCCGCGGACATGCCGCTCTTTGGCCGACAGCCATGTCGGCGGCCAGCGGAAGGCTTGGTCGTCTTGCTCACT
GAATCCACCGGCTCTCTTGGCTCGTGCACGCTTGACAGTCTGATGCGCAACCCGCGTGTCTCGCAGATATACTAC
CTCAACCGGGGTCGGGGGAGCCGCGAGCGCCAAGAGAGGGCCCAAACCGCGAGAAAGCTCGGCCCGCTCACCTCC
GAGGTCGAGTGCCTAGATGCGGACTTGTCGCAGCCGTGCTTTGGCCTTTCTGGGCAGATCGCCGGCGTTCGGCGC
ATCATCGACTTCGCGGCGCACTCGGCCTACGGTGCACGGGTCTTGTTCATCTCCAGCGTCGGCGCTGTAGGGGGT
CTCGCCGGCGACGTTACCGAGCAGGTCTACCGCGACTGGGAGGCCAGCATCTCGGTCATAATCTGCCGCGCAGGT
CAGGTGGCCGGGCCCCTTACCGAGACGGGCAGCTGGCCGAAGCAGGAGTGGCTCCCCAGCCTGGTGGCCTCGTCC
AAATACCTCGGTCTGCTTCCGGCTTCCCTGGGTAGAATGAACACCGTTGACTGGATCCCGGTGGACGTCCTGGCG
CAGAGCTTGGCTGAGGTGGTCGTGAACCCCGAAGCCGCGTCCGCCCAGGCCCCGTCCGCGGCCGCCGTCTACCAC
GCGGCGAACCCCAGACGCATCAGCTAG
Transcript >Hirsu2|1856
ATGATCCTCTTTACCTCTGCGCAAAAGCCCATGCTGCGGGCCGGCAAAGGCACGGGTGGCAGCCGCGAGAACCGC
CTGTTTGCCAATGGCGTCAGCTGGGAGAACAGCCTCTGGCGCATCATTGCCGATGAGCTGCTGCTGGGCGGCGGC
GCACCACAGCCGCTGGCGGCCGGGACAGTCTACGCCTCGCCCACCATCGCCATGCTGGCCGCGGCTGTGTCGGCC
CTCGCTGAGGGTAGAGTGCTCGCGGAGTCATCGAGCCACGACGGAACGGAGAGGATGCAGGAGCTCTACGGCCTC
AACGCCGCGGACATGCCGCTCTTTGGCCGACAGCCATGTCGGCGGCCAGCGGAAGGCTTGGTCGTCTTGCTCACT
GAATCCACCGGCTCTCTTGGCTCGTGCACGCTTGACAGTCTGATGCGCAACCCGCGTGTCTCGCAGATATACTAC
CTCAACCGGGGTCGGGGGAGCCGCGAGCGCCAAGAGAGGGCCCAAACCGCGAGAAAGCTCGGCCCGCTCACCTCC
GAGGTCGAGTGCCTAGATGCGGACTTGTCGCAGCCGTGCTTTGGCCTTTCTGGGCAGATCGCCGGCGTTCGGCGC
ATCATCGACTTCGCGGCGCACTCGGCCTACGGTGCACGGGTCTTGTTCATCTCCAGCGTCGGCGCTGTAGGGGGT
CTCGCCGGCGACGTTACCGAGCAGGTCTACCGCGACTGGGAGGCCAGCATCTCGGTCATAATCTGCCGCGCAGGT
CAGGTGGCCGGGCCCCTTACCGAGACGGGCAGCTGGCCGAAGCAGGAGTGGCTCCCCAGCCTGGTGGCCTCGTCC
AAATACCTCGGTCTGCTTCCGGCTTCCCTGGGTAGAATGAACACCGTTGACTGGATCCCGGTGGACGTCCTGGCG
CAGAGCTTGGCTGAGGTGGTCGTGAACCCCGAAGCCGCGTCCGCCCAGGCCCCGTCCGCGGCCGCCGTCTACCAC
GCGGCGAACCCCAGACGCATCAGCTAG
Gene >Hirsu2|1856
ATGATCCTCTTTACCTCTGCGCAAAAGCCCATGCTGCGGGCCGGCAAAGGCACGGTACAGAGGAAGATGACATGA
GACCTGTACCGGGTCGAGCTGGACGGCCTGTATGAGAAGGGTGGCAGCCGCGAGAACCGCCTGTTTGCCAATGGC
GTCAGCTGGGAGAACAGCCTCTGGCGCATCATTGCCGAGTGCACGGATATTTCCAGTCCACACAGTCTCCCGAGA
CACCGACCTGTTCGCTATCGGGCTGGATTCGCTGCAGGGGAGGCTAATTGCCAAGCACACCAGTGAGCTGCTGCT
GGGCGGCGGCGCACCACAGCCGCTGGCGGCCGGGACAGTCTACGCCTCGCCCACCATCGCCATGCTGGCCGCGGC
TGTGTCGGCCCTCGCTGAGGGTAGAGTGCTCGCGGAGTCATCGAGCCACGACGGAACGGAGAGGATGCAGGAGCT
CTACGGCCTCAACGCCGCGGACATGCCGCTCTTTGGCCGACAGCCATGTCGGCGGCCAGCGGAAGGCTTGGTCGT
CTTGCTCACTGAATCCACCGGCTCTCTTGGCTCGTGCACGCTTGACAGTCTGATGCGCAACCCGCGTGTCTCGCA
GATATACTACCTCAACCGGGGTCGGGGGAGCCGCGAGCGCCAAGAGAGGGCCCAAACCGCGAGAAAGCTCGGCCC
GCTCACCTCCGAGGTCGAGTGCCTAGATGCGGACTTGTCGCAGCCGTGCTTTGGCCTTTCTGGGCAGGTATACGG
CCGACTCCTGGCGCAGGTGACGGACGTCGTCCACAACGCCTGGCAGGTCAACTTCAACCTGTCCGTTGGCTCCTT
CGCGGCCTAGATCGCCGGCGTTCGGCGCATCATCGACTTCGCGGCGCACTCGGCCTACGGTGCACGGGTCTTGTT
CATCTCCAGCGTCGGCGCTGTAGGGGGTCTCGCCGGCGACGTTACCGAGCAGGTCTACCGCGACTGGTAAGTGCC
GCAGCCGACTGGTTACGGACAGTCGAAATTCGTCGCCGAGCGCCTCGTCGACACGGCTGCCAGGGAGGCCAGCAT
CTCGGTCATAATCTGCCGCGCAGGTCAGGTGGCCGGGCCCCTTACCGAGACGGGCAGCTGGCCGAAGCAGGAGTG
GCTCCCCAGCCTGGTGGCCTCGTCCAAATACCTCGGTCTGCTTCCGGCTTCCCTGGGTAGAATGAACACCGTTGA
CTGGATCCCGGTGGACGTCCTGGCGCAGAGCTTGGCTGAGGTGGTCGTGAACCCCGAAGCCGCGTCCGCCCAGGC
CCCGTCCGCGGCCGCCGTCTACCACGCGGCGAACCCCAGACGCATCAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail