Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1849
Gene name
LocationContig_142:20185..20903
Strand+
Gene length (bp)718
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13499 EF-hand_7 EF-hand domain pair 3.9E-12 135 198
PF13833 EF-hand_8 EF-hand domain pair 8.5E-11 146 199
PF13202 EF-hand_5 EF hand 5.2E-04 137 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 26 197 8.0E-21
sp|O15182|CETN3_HUMAN Centrin-3 OS=Homo sapiens GN=CETN3 PE=1 SV=2 9 197 1.0E-20
sp|O35648|CETN3_MOUSE Centrin-3 OS=Mus musculus GN=Cetn3 PE=1 SV=1 42 197 4.0E-20
sp|P06704|CDC31_YEAST Cell division control protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC31 PE=1 SV=2 42 196 1.0E-19
sp|P43646|CATR_TETST Caltractin (Fragment) OS=Tetraselmis striata PE=2 SV=1 42 197 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 26 197 8.0E-21
sp|O15182|CETN3_HUMAN Centrin-3 OS=Homo sapiens GN=CETN3 PE=1 SV=2 9 197 1.0E-20
sp|O35648|CETN3_MOUSE Centrin-3 OS=Mus musculus GN=Cetn3 PE=1 SV=1 42 197 4.0E-20
sp|P06704|CDC31_YEAST Cell division control protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC31 PE=1 SV=2 42 196 1.0E-19
sp|P43646|CATR_TETST Caltractin (Fragment) OS=Tetraselmis striata PE=2 SV=1 42 197 1.0E-19
sp|Q24956|CATR_GIAIN Caltractin OS=Giardia intestinalis GN=CAL PE=3 SV=1 17 197 2.0E-19
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 26 200 2.0E-19
sp|P53441|CATR_NAEGR Caltractin OS=Naegleria gruberi GN=CTN PE=2 SV=1 24 200 1.0E-18
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 42 200 1.0E-18
sp|P43645|CATR_SPESI Caltractin (Fragment) OS=Spermatozopsis similis PE=2 SV=1 42 197 2.0E-18
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 42 200 2.0E-18
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 42 201 3.0E-18
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 42 201 5.0E-18
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 42 200 9.0E-18
sp|Q8K4K1|CETN4_MOUSE Centrin-4 OS=Mus musculus GN=Cetn4 PE=1 SV=1 42 201 1.0E-17
sp|P54213|CATR_DUNSA Caltractin OS=Dunaliella salina PE=2 SV=1 40 200 4.0E-17
sp|O74435|CDC31_SCHPO Cell division control protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc31 PE=1 SV=1 42 200 4.0E-17
sp|P05434|CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii PE=1 SV=1 41 200 8.0E-16
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 41 197 1.0E-15
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 14 201 3.0E-15
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 41 198 1.0E-14
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 39 198 3.0E-14
sp|Q27179|CATR2_PARTE Caltractin ICL1b OS=Paramecium tetraurelia GN=Icl1b PE=3 SV=2 41 197 9.0E-14
sp|Q94726|CATR4_PARTE Caltractin ICL1d OS=Paramecium tetraurelia GN=Icl1d PE=3 SV=1 41 197 9.0E-14
sp|Q27178|CATR3_PARTE Caltractin ICL1c OS=Paramecium tetraurelia GN=Icl1c PE=3 SV=1 41 197 1.0E-13
sp|Q27177|CATR1_PARTE Caltractin ICL1a OS=Paramecium tetraurelia GN=Icl1a PE=1 SV=2 41 197 1.0E-13
sp|Q338P8|CML8_ORYSJ Probable calcium-binding protein CML8 OS=Oryza sativa subsp. japonica GN=CML8 PE=2 SV=1 47 201 2.0E-13
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 42 197 3.0E-13
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 42 197 3.0E-13
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 49 197 4.0E-13
sp|Q3SEK2|CATR6_PARTE Caltractin ICL1f OS=Paramecium tetraurelia GN=Icl1f PE=3 SV=1 41 197 5.0E-13
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 52 197 1.0E-12
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 42 197 1.0E-12
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 42 197 1.0E-12
sp|Q3SEK0|CATR5_PARTE Caltractin ICL1e OS=Paramecium tetraurelia GN=Icl1e PE=3 SV=1 21 197 2.0E-12
sp|P27163|CALM2_PETHY Calmodulin-2 OS=Petunia hybrida GN=CAM72 PE=2 SV=2 52 197 2.0E-12
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 52 197 2.0E-12
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 52 197 2.0E-12
sp|P48976|CALM_MALDO Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2 42 197 3.0E-12
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 42 197 3.0E-12
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 52 197 3.0E-12
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 52 197 3.0E-12
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 52 197 3.0E-12
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 52 197 3.0E-12
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 52 197 3.0E-12
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 52 197 3.0E-12
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 52 197 3.0E-12
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japonica GN=CAM2 PE=2 SV=3 42 197 4.0E-12
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica GN=CAM2 PE=3 SV=1 42 197 4.0E-12
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 52 197 4.0E-12
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1 PE=2 SV=2 52 197 5.0E-12
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 52 197 5.0E-12
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 52 197 5.0E-12
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2 42 197 7.0E-12
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 52 197 7.0E-12
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 52 197 7.0E-12
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 52 197 7.0E-12
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 52 197 7.0E-12
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 52 197 7.0E-12
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 52 197 7.0E-12
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 52 197 7.0E-12
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 52 197 7.0E-12
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 52 197 7.0E-12
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 52 197 7.0E-12
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 52 197 7.0E-12
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 52 197 7.0E-12
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 52 197 7.0E-12
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 52 197 7.0E-12
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 52 197 7.0E-12
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 52 197 8.0E-12
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 42 197 8.0E-12
sp|Q95NI4|CALM_HALOK Calmodulin OS=Halichondria okadai PE=2 SV=3 41 197 9.0E-12
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 42 197 9.0E-12
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 52 197 1.0E-11
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 52 197 1.0E-11
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 42 197 1.0E-11
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 42 197 1.0E-11
sp|P02595|CALM_PATSP Calmodulin OS=Patinopecten sp. PE=1 SV=2 52 197 1.0E-11
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 52 197 1.0E-11
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 42 197 2.0E-11
sp|P41040|CALM_MAIZE Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2 42 197 2.0E-11
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 52 197 2.0E-11
sp|Q682T9|CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana GN=CAM5 PE=1 SV=1 42 197 2.0E-11
sp|P0DH98|CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana GN=CAM3 PE=1 SV=1 42 197 2.0E-11
sp|P0DH97|CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=1 42 197 2.0E-11
sp|P13868|CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum GN=PCM1 PE=1 SV=2 52 197 2.0E-11
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 41 197 2.0E-11
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 41 197 2.0E-11
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 41 197 2.0E-11
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 41 197 2.0E-11
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 42 197 2.0E-11
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 52 197 2.0E-11
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 52 197 2.0E-11
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 52 197 3.0E-11
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 42 197 3.0E-11
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 52 197 3.0E-11
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 52 197 3.0E-11
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 52 197 3.0E-11
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 52 197 3.0E-11
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 52 197 3.0E-11
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 52 197 3.0E-11
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 52 197 3.0E-11
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 42 197 3.0E-11
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 42 197 3.0E-11
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 42 197 3.0E-11
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2 42 197 3.0E-11
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=1 SV=2 42 197 3.0E-11
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2 42 197 3.0E-11
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 52 197 3.0E-11
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 41 197 3.0E-11
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 41 197 3.0E-11
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 41 197 3.0E-11
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 42 197 3.0E-11
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 42 199 3.0E-11
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3 52 197 3.0E-11
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 42 197 3.0E-11
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2 42 197 3.0E-11
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japonica GN=CAM1-1 PE=1 SV=2 42 197 3.0E-11
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica GN=CAM1-1 PE=1 SV=2 42 197 3.0E-11
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 52 197 3.0E-11
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 52 197 4.0E-11
sp|P05932|CALMB_ARBPU Calmodulin-beta (Fragment) OS=Arbacia punctulata PE=2 SV=1 52 197 4.0E-11
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 52 197 4.0E-11
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 42 197 5.0E-11
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 41 197 5.0E-11
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 42 197 5.0E-11
sp|O96081|CALMB_HALRO Calmodulin-B OS=Halocynthia roretzi PE=3 SV=3 52 197 5.0E-11
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 52 197 6.0E-11
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 52 197 6.0E-11
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 41 197 7.0E-11
sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6 PE=1 SV=2 42 197 8.0E-11
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 52 200 9.0E-11
sp|P15094|CALM_ACHKL Calmodulin OS=Achlya klebsiana GN=CMD1 PE=3 SV=3 117 197 1.0E-10
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3 42 197 1.0E-10
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN=PCM5 PE=1 SV=3 52 197 1.0E-10
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica GN=CAM3 PE=3 SV=2 42 197 1.0E-10
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 52 197 1.0E-10
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 42 197 2.0E-10
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 52 197 2.0E-10
sp|Q7DMP0|CALM2_SOLTU Calmodulin-2/4 (Fragment) OS=Solanum tuberosum GN=PCM2 PE=2 SV=1 117 197 4.0E-10
sp|P05934|CALM_STRPU Calmodulin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 123 197 5.0E-10
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 41 197 6.0E-10
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 42 197 6.0E-10
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 133 197 9.0E-10
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 52 194 9.0E-10
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 113 197 9.0E-10
sp|Q9D6P8|CALL3_MOUSE Calmodulin-like protein 3 OS=Mus musculus GN=Calml3 PE=2 SV=1 42 197 1.0E-09
sp|Q39752|CALM_FAGSY Calmodulin OS=Fagus sylvatica GN=CAMF1 PE=2 SV=3 42 197 1.0E-09
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 33 197 1.0E-09
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 33 197 1.0E-09
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 52 193 2.0E-09
sp|Q9LIK5|CML11_ARATH Calmodulin-like protein 11 OS=Arabidopsis thaliana GN=CML11 PE=2 SV=1 125 197 2.0E-09
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 42 197 2.0E-09
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 52 193 3.0E-09
sp|P27482|CALL3_HUMAN Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 42 197 3.0E-09
sp|Q9LNE7|CML7_ARATH Calmodulin-like protein 7 OS=Arabidopsis thaliana GN=CML7 PE=2 SV=1 46 201 7.0E-09
sp|Q9LQN4|CML17_ARATH Probable calcium-binding protein CML17 OS=Arabidopsis thaliana GN=CML17 PE=2 SV=1 46 201 1.0E-08
sp|Q9SRR7|CML3_ARATH Calmodulin-like protein 3 OS=Arabidopsis thaliana GN=CML3 PE=2 SV=1 46 201 2.0E-08
sp|O22845|CML5_ARATH Calmodulin-like protein 5 OS=Arabidopsis thaliana GN=CML5 PE=2 SV=2 46 201 2.0E-08
sp|P49258|CALL_DROME Calmodulin-related protein 97A OS=Drosophila melanogaster GN=Acam PE=1 SV=2 109 197 6.0E-08
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 42 198 6.0E-08
sp|P04573|CAVP_BRALA Calcium vector protein OS=Branchiostoma lanceolatum PE=1 SV=3 118 200 8.0E-08
sp|O01305|CAVP_BRAFL Calcium vector protein OS=Branchiostoma floridae PE=2 SV=3 120 200 9.0E-08
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 52 197 9.0E-08
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 52 197 1.0E-07
sp|P15159|TNNC_TACTR Troponin C OS=Tachypleus tridentatus PE=1 SV=1 40 197 2.0E-07
sp|Q9LX27|CML4_ARATH Calmodulin-like protein 4 OS=Arabidopsis thaliana GN=CML4 PE=2 SV=1 53 200 2.0E-07
sp|Q7Z2B8|MLCD_DICDI Myosin-ID light chain OS=Dictyostelium discoideum GN=mlcD PE=1 SV=1 42 197 3.0E-07
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 42 197 4.0E-07
sp|P06787|CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMD1 PE=1 SV=1 42 197 4.0E-07
sp|Q9FI19|CML43_ARATH Probable calcium-binding protein CML43 OS=Arabidopsis thaliana GN=CML43 PE=2 SV=1 53 198 4.0E-07
sp|Q2QVI1|CML28_ORYSJ Probable calcium-binding protein CML28 OS=Oryza sativa subsp. japonica GN=CML28 PE=2 SV=1 130 201 9.0E-07
sp|Q9ZR02|CML6_ARATH Calmodulin-like protein 6 OS=Arabidopsis thaliana GN=CML6 PE=2 SV=1 46 200 3.0E-06
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 41 197 3.0E-06
sp|O60041|CALM_KLULA Calmodulin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CMD1 PE=1 SV=1 42 197 3.0E-06
sp|Q9FYK2|CML25_ARATH Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1 49 197 4.0E-06
sp|Q54IY3|CETNA_DICDI Centrin-A OS=Dictyostelium discoideum GN=cenA PE=3 SV=1 42 197 5.0E-06
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 41 200 5.0E-06
sp|P47947|TNNC1_DROME Troponin C, isoform 1 OS=Drosophila melanogaster GN=TpnC41C PE=2 SV=2 54 197 6.0E-06
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 41 200 6.0E-06
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 41 200 7.0E-06
sp|Q9SS31|CML36_ARATH Probable calcium-binding protein CML36 OS=Arabidopsis thaliana GN=CML36 PE=2 SV=1 123 198 8.0E-06
sp|P29289|TNNC1_HOMAM Troponin C, isoform 1 OS=Homarus americanus PE=1 SV=1 113 197 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1849
MNNHTTPRPLAMRSMAGGSTQRPPPRPPVAPQVSANEEYGAIADEDREHIDEVFDLMDMKKKGWLNSYEFKHSLA
ALGFDLPKPDYFRELQTYGSVPPDWRDPHNCPVNRLYIYLDQFRLCAAKLMANRDPREEAIKVFNMFDYDQDGII
SFDDMRHLAQDIKEERAMTDDEIQSMIEHLDHDGKGGVNLEEFIQMMEEAG*
Coding >Hirsu2|1849
ATGAACAACCACACGACGCCGAGGCCGTTGGCCATGCGCTCCATGGCCGGCGGGTCGACGCAGCGGCCGCCGCCG
AGACCGCCGGTCGCGCCGCAGGTGTCGGCGAACGAGGAGTACGGCGCGATCGCGGACGAGGACCGCGAACACATC
GACGAAGTTTTCGACCTGATGGACATGAAGAAGAAGGGCTGGCTGAATAGCTACGAATTCAAACACTCGCTGGCC
GCCCTCGGCTTCGACCTGCCCAAGCCCGACTACTTCCGCGAGCTGCAGACGTACGGCTCGGTGCCGCCCGACTGG
CGCGACCCGCACAACTGCCCCGTCAACCGGCTGTACATCTACCTCGACCAGTTCCGGCTGTGCGCCGCCAAGCTC
ATGGCCAACCGCGACCCGCGCGAGGAGGCCATCAAGGTCTTCAACATGTTCGACTACGACCAGGACGGCATCATC
TCCTTCGACGACATGCGCCACCTGGCCCAGGACATCAAGGAGGAGCGCGCCATGACGGACGACGAGATCCAGAGC
ATGATCGAGCACCTCGACCACGACGGCAAGGGCGGCGTCAACCTCGAGGAGTTCATCCAGATGATGGAGGAGGCC
GGGTAG
Transcript >Hirsu2|1849
ATGAACAACCACACGACGCCGAGGCCGTTGGCCATGCGCTCCATGGCCGGCGGGTCGACGCAGCGGCCGCCGCCG
AGACCGCCGGTCGCGCCGCAGGTGTCGGCGAACGAGGAGTACGGCGCGATCGCGGACGAGGACCGCGAACACATC
GACGAAGTTTTCGACCTGATGGACATGAAGAAGAAGGGCTGGCTGAATAGCTACGAATTCAAACACTCGCTGGCC
GCCCTCGGCTTCGACCTGCCCAAGCCCGACTACTTCCGCGAGCTGCAGACGTACGGCTCGGTGCCGCCCGACTGG
CGCGACCCGCACAACTGCCCCGTCAACCGGCTGTACATCTACCTCGACCAGTTCCGGCTGTGCGCCGCCAAGCTC
ATGGCCAACCGCGACCCGCGCGAGGAGGCCATCAAGGTCTTCAACATGTTCGACTACGACCAGGACGGCATCATC
TCCTTCGACGACATGCGCCACCTGGCCCAGGACATCAAGGAGGAGCGCGCCATGACGGACGACGAGATCCAGAGC
ATGATCGAGCACCTCGACCACGACGGCAAGGGCGGCGTCAACCTCGAGGAGTTCATCCAGATGATGGAGGAGGCC
GGGTAG
Gene >Hirsu2|1849
ATGAACAACCACACGACGCCGAGGCCGTTGGCCATGCGCTCCATGGCCGGCGGGTCGACGCAGCGGCCGCCGCCG
AGACCGCCGGTCGCGCCGCAGGTGTCGGCGAACGAGGAGTACGGCGCGATCGCGGACGAGGACCGCGAACACATC
GACGAAGTTGTGAGTGTGCCCTCCTCCTGCTCCCTCCTCTTCCTCTTTTTTTTTTCGCGACAGGGAATGAATACC
ATTCTCCCCTCTTCGATCGTCGCCCGGGGCTCACGCGCCGCCGCAGTTCGACCTGATGGACATGAAGAAGAAGGG
CTGGCTGAATAGCTACGAATTCAAACACTCGCTGGCCGCCCTCGGCTTCGACCTGCCCAAGCCCGACTACTTCCG
CGAGCTGCAGACGTACGGCTCGGTGCCGCCCGACTGGCGCGACCCGCACAACTGCCCCGTCAACCGGCTGTACAT
CTACCTCGACCAGTTCCGGCTGTGCGCCGCCAAGCTCATGGCCAACCGCGACCCGCGCGAGGAGGCCATCAAGGT
CTTCAACATGTTCGACTACGACCAGGACGGCATCATCTCCTTCGACGACATGCGCCACCTGGCCCAGGACATCAA
GGAGGAGCGCGCCATGACGGACGACGAGATCCAGAGCATGATCGAGCACCTCGACCACGACGGCAAGGGCGGCGT
CAACCTCGAGGAGTTCATCCAGATGATGGAGGAGGCCGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail