Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1848
Gene name
LocationContig_142:11030..17259
Strand-
Gene length (bp)6229
Transcript length (bp)5874
Coding sequence length (bp)5874
Protein length (aa) 1958

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12110 Nup96 Nuclear protein 96 3.5E-90 1490 1787
PF04096 Nucleoporin2 Nucleoporin autopeptidase 1.7E-46 893 1030
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 9.4E-08 399 484
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.7E-09 468 557
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 6.7E-07 546 625

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 16 1911 0.0E+00
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 1393 1934 4.0E-64
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 1490 1954 2.0E-44
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 18 1065 2.0E-41
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 126 1068 5.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 16 1911 0.0E+00
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 1393 1934 4.0E-64
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 1490 1954 2.0E-44
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 18 1065 2.0E-41
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 126 1068 5.0E-40
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 1490 1954 1.0E-39
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 1490 1954 1.0E-39
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 41 538 5.0E-35
sp|Q02629|NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP100 PE=1 SV=1 249 1024 8.0E-35
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 838 1164 2.0E-34
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 240 1065 2.0E-34
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 1424 1926 3.0E-32
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 378 1030 3.0E-30
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 87 615 9.0E-30
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 80 610 7.0E-26
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 894 1024 2.0E-22
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 18 545 7.0E-22
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 1438 1886 1.0E-21
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 243 584 3.0E-20
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 18 545 3.0E-20
sp|F4ID16|NU98B_ARATH Nuclear pore complex protein NUP98B OS=Arabidopsis thaliana GN=NUP98B PE=1 SV=1 894 1035 8.0E-19
sp|Q8RY25|NU98A_ARATH Nuclear pore complex protein NUP98A OS=Arabidopsis thaliana GN=NUP98A PE=1 SV=1 860 1041 5.0E-18
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 895 1037 2.0E-15
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 1438 1934 3.0E-15
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 294 571 3.0E-15
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 294 571 9.0E-15
sp|Q8LLD0|NUP96_ARATH Nuclear pore complex protein NUP96 OS=Arabidopsis thaliana GN=NUP96 PE=1 SV=1 1433 1871 2.0E-14
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 412 600 1.0E-13
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 250 510 1.0E-12
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 315 552 5.0E-12
sp|Q8LLD0|NUP96_ARATH Nuclear pore complex protein NUP96 OS=Arabidopsis thaliana GN=NUP96 PE=1 SV=1 895 1037 4.0E-10
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 5 375 1.0E-09
sp|Q02199|NUP49_YEAST Nucleoporin NUP49/NSP49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP49 PE=1 SV=1 273 522 2.0E-09
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 3 230 5.0E-09
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 256 436 1.0E-08
sp|Q8RY25|NU98A_ARATH Nuclear pore complex protein NUP98A OS=Arabidopsis thaliana GN=NUP98A PE=1 SV=1 2 422 3.0E-08
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 3 230 2.0E-07
sp|Q09793|NUP45_SCHPO Nucleoporin nup45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup45 PE=1 SV=2 315 579 2.0E-07
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 19 182 2.0E-07
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 3 230 2.0E-07
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 279 495 3.0E-07
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 338 590 3.0E-07
sp|Q02199|NUP49_YEAST Nucleoporin NUP49/NSP49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP49 PE=1 SV=1 412 597 3.0E-06
sp|Q02199|NUP49_YEAST Nucleoporin NUP49/NSP49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP49 PE=1 SV=1 236 377 4.0E-06
sp|G0SDP9|NU152_CHATD Nucleoporin NUP152 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP152 PE=3 SV=1 113 560 8.0E-06
sp|Q09793|NUP45_SCHPO Nucleoporin nup45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup45 PE=1 SV=2 393 610 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0017056 structural constituent of nuclear pore Yes
GO:0005643 nuclear pore Yes
GO:0006913 nucleocytoplasmic transport Yes
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0044424 intracellular part No
GO:0051641 cellular localization No
GO:0051649 establishment of localization in cell No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0005198 structural molecule activity No
GO:0003674 molecular_function No
GO:0044446 intracellular organelle part No
GO:0044428 nuclear part No
GO:0032991 protein-containing complex No
GO:0044464 cell part No
GO:0044422 organelle part No
GO:0008150 biological_process No
GO:0051169 nuclear transport No
GO:0046907 intracellular transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1848
MSFGSGGFGAFGSNNNQQSSGFGGGFGASNNTTSGFGSANTGGFGQNANTGGGMFGSTNNASGFGASSGFGSNTG
GGGFGSKPAFGAANTSSTGGLFGSSNTNNATSSGFGAFGNTNNATSSPFGGGNTTSGGLFGSSANKTGFGTANNT
GSSLFGGGQSAAGGGFGGGGFGAANNPGLGGGVGDPPGTATTPFQAFTEKEPNSSNQSNAFQNILFQDPYRKWSA
DELRLADYVQGRRHGNASGAGAFGVSSGFGGAFGSNNQTTNAFGAASNNPTNAAGGGLFGATNNNTATSGFGQTG
GNAFGANAGNTSGGLFGGNKPSGGLFGNTSNQQSGGMFGGSGGGFGTANAGNNAFGTANATSGGMFGTNNQANKP
QGGFNFGTANANNTSSGFGANAQGGFGQTNNTGSTGLFGAANNNQQPGGGLFGSNQQQPQTASSGFGGGGFQNQN
QQGGGLFGSNQQKPATGGLFGAPAGNTTSGGLFGSNNNQQQGTPGFGSNTNASTTGGLFGSAKPSTSTSLFGGTN
TGQTNTTGGNGLFGGLGSNTQAQPAPGSSLFGSANNAQQKPGGLFGGTSQTPGSGLFGGQSNQNQGGSLFGSSSN
QQQAQNSGFGGSLLGGAQQSGNAPQGLTANLNDVSAYGSPSLFAGVSGNDVSNPGPLATPLNGNAKPRRSNILPM
YKLAPSAASRFATPQKRGFGFSYSSYGTPGASPASSISSTPGALGRSLLGPSAGGTLSKSMSTNNLRRSFNTEDS
ILAPGAFSSSSGARWYGSTGSKKLVINRDIRSDLFSTPQKDKQAIDGSSSARKLAKRVSFDTSNVDADGGTPARN
ALPAPEDTPNSQGDESTPRQNRSAAAANGSKTPEMSDVKGNELAIVHEEDQTTTPESQKTAAFDKTPGHYWTKPS
KEELLNMNRMQRQRIDNFTIGRHNVGYIEFKLPVDISGIEVEDLYGGVIQLEPRSATVYPVQAKKPPVGKGLNVP
ARISLEQSWPRGGRDKRFNKHVERLRRIPDTTFESYDEESGVWVFSVEHFTTYGLDDDEEDEDDEVGEASQMTEH
ALPPTAPPQTTSRAMSIDSAEDGADEFAQRKGVPGAFDQQEEPHGDGVNNEQSFLGLSSVDSTSNNVRLSLDDEY
SSNMDDGYDMSEDEDMTRSSVGLHRAAEQDDSSSENDQETKRGTPGGILRARMRAMKDSVGPVQLEVAEGDDWME
MLRKTVSPVKRDRQLLRELNESPSKPSGALISFDDDDDDGGGGELRKSSIWAKSPSKAARAGGAAARSQMALDKG
QGFATSIDLMNSLFEKPRPARQIPGASLPAKGLPQWPYERQDKTLSIDEAEKAFHNASRPTWGPDETLVVTRSLN
VTQSSRPFRDSSGLLTFQRSGILTHAQDVRLAKFSTASSKTYLRAQDELTEIRLVDGVPSASLRTRSLFDLFHQQ
DLNDPASLHERRVWQLASILFDRDGATLSVEMDKLTRKERLSQFWTDLVERASTKNMMLASTCEERVVACLAGHR
IREACEALLAGRNFRLGTLVPLIGTSDTAKKEMKEQIRAWYDSKILSEFSDATRTVYELLSGNVCVCEGMKAVPV
EDRMESFVISNKFGLDWKQSFGLRLWYAIAQRDSVAAAVEMYKEDIDQGREELPRPWYVEQGIQPLWNDANAACR
QDLLWGLLQLYADDKADLEAVLRPENSQLSPLDMRLCWQLGLALVSTGKVSFGQRGTEKADASTLAYAAQLTAAD
EWLEAAFVLLHLRDVTARIMAIQEHLCRHAGLIGPESGTTFSILTDKFRIPATWLWQAQAVYMRSVKKDAPAEVH
CLLQAGSFVEAHRVLVQHVAPQAIIERDYEALATLIAQFEGHQESIAEWASGGEVYSNFLNLLLRRSRGEDVPPS
LLEKLLMGLGAINDGVGETELARYAAVSDMADETAREILKLAKKKQDAELRSRILSLPLTEDRLLAYSVDLSMDR
YREVMSH*
Coding >Hirsu2|1848
ATGTCGTTTGGTAGCGGCGGCTTCGGGGCCTTCGGCTCAAACAACAACCAGCAGTCGAGCGGCTTTGGTGGCGGC
TTTGGCGCAAGCAACAACACCACCTCAGGTTTTGGATCCGCAAACACCGGCGGCTTTGGCCAAAACGCCAATACG
GGAGGCGGCATGTTTGGAAGCACCAATAATGCCTCCGGCTTCGGGGCTTCGTCAGGATTTGGGTCCAATACCGGA
GGCGGCGGCTTCGGCAGTAAGCCTGCCTTTGGTGCAGCAAACACCTCCTCCACTGGAGGTCTCTTTGGATCTTCC
AATACCAATAACGCCACCTCCTCCGGCTTTGGAGCCTTCGGCAACACGAACAACGCCACCTCGTCCCCCTTCGGC
GGCGGTAACACCACAAGTGGAGGGCTTTTCGGAAGCTCCGCTAACAAGACAGGCTTCGGCACTGCGAACAACACC
GGCTCATCCCTGTTCGGCGGCGGCCAAAGCGCTGCCGGCGGCGGCTTCGGCGGCGGCGGCTTCGGCGCTGCGAAT
AACCCTGGCCTCGGAGGAGGCGTCGGCGATCCTCCCGGTACCGCGACCACGCCGTTTCAGGCCTTCACCGAGAAG
GAGCCCAACTCCAGCAACCAGTCCAACGCTTTTCAGAACATTCTCTTCCAAGACCCATATCGGAAATGGTCAGCC
GACGAGTTGAGGCTGGCGGACTATGTACAAGGACGCCGCCATGGGAATGCCAGCGGAGCCGGCGCCTTTGGCGTC
AGCTCCGGCTTTGGGGGAGCCTTCGGTTCAAACAATCAGACGACGAACGCATTTGGGGCCGCGTCGAACAATCCC
ACAAACGCCGCCGGCGGCGGCCTCTTTGGCGCTACCAACAATAACACGGCCACGTCTGGATTTGGCCAGACTGGA
GGCAATGCTTTTGGAGCCAATGCCGGCAATACCTCTGGCGGTCTGTTCGGCGGCAATAAGCCAAGTGGTGGTTTG
TTCGGCAACACCTCGAACCAGCAGAGCGGTGGCATGTTTGGAGGCTCCGGGGGTGGATTCGGCACGGCCAATGCC
GGTAATAACGCCTTCGGGACCGCCAATGCCACATCAGGCGGTATGTTTGGCACCAACAACCAGGCTAATAAGCCC
CAAGGCGGTTTCAACTTTGGGACCGCCAATGCCAACAACACCTCGTCTGGCTTCGGTGCCAATGCTCAGGGCGGG
TTCGGACAGACGAACAACACGGGAAGCACTGGGCTCTTTGGTGCCGCGAACAACAACCAGCAGCCCGGCGGAGGC
CTCTTTGGCAGCAACCAGCAGCAGCCACAAACCGCCTCTTCTGGCTTTGGGGGGGGCGGCTTCCAGAACCAGAAT
CAACAGGGCGGCGGTTTGTTCGGCAGCAACCAGCAGAAACCCGCCACAGGCGGCCTTTTTGGTGCGCCCGCCGGC
AATACGACGTCAGGTGGTCTCTTTGGGAGCAACAACAACCAGCAGCAAGGCACGCCCGGCTTTGGCTCGAACACC
AACGCGTCGACGACTGGCGGCCTCTTTGGGAGTGCCAAGCCGAGCACCAGCACCAGCTTGTTCGGCGGAACCAAT
ACTGGCCAAACGAACACTACTGGAGGCAATGGACTTTTTGGCGGCCTCGGCTCTAACACGCAAGCCCAGCCGGCA
CCCGGCTCATCCCTGTTTGGCTCGGCAAACAACGCGCAACAAAAGCCTGGCGGCCTTTTCGGCGGCACGAGCCAA
ACCCCTGGCTCGGGTCTATTCGGGGGCCAGAGCAACCAGAACCAAGGCGGCTCGCTCTTCGGTAGCAGCTCTAAT
CAGCAGCAGGCCCAGAACTCTGGGTTCGGAGGCTCCTTGCTGGGAGGCGCACAGCAGTCAGGCAACGCTCCACAA
GGACTCACCGCGAACCTTAACGACGTATCGGCTTACGGGAGTCCGTCCCTATTTGCCGGCGTCAGCGGCAACGAT
GTTTCCAACCCGGGTCCTCTCGCCACTCCCCTGAACGGCAACGCCAAACCGCGGCGAAGCAACATCCTTCCCATG
TACAAGCTTGCTCCGTCGGCCGCCTCCAGGTTCGCGACTCCCCAGAAACGAGGCTTCGGCTTTTCGTACAGCTCT
TACGGGACCCCGGGTGCCAGCCCGGCCAGCAGCATCTCAAGCACGCCTGGCGCCCTCGGTCGCAGCCTTCTTGGT
CCCAGCGCCGGTGGCACTCTGAGCAAGAGCATGTCGACGAATAACCTTCGCCGCAGCTTCAACACGGAGGACAGC
ATTCTTGCGCCGGGAGCCTTCTCGTCCAGCTCGGGCGCGCGTTGGTATGGGAGCACTGGCTCCAAAAAGCTGGTA
ATTAACAGAGACATTAGGAGTGATCTGTTTTCCACGCCCCAGAAAGACAAGCAGGCCATCGACGGCAGTTCCAGC
GCTCGCAAGCTAGCCAAGCGCGTTAGCTTTGACACGAGCAACGTCGATGCGGATGGCGGGACCCCGGCACGCAAC
GCGCTGCCAGCCCCGGAGGACACGCCGAACTCCCAAGGCGACGAGTCCACCCCGCGCCAGAACAGGTCCGCAGCT
GCTGCAAACGGTTCCAAGACCCCGGAGATGAGTGATGTCAAGGGTAACGAGCTGGCTATCGTCCACGAAGAGGAT
CAGACCACCACGCCAGAGTCGCAGAAAACCGCTGCTTTCGACAAGACGCCCGGACACTACTGGACCAAGCCGAGC
AAGGAGGAGCTGCTCAACATGAATAGGATGCAGCGACAGAGGATCGATAACTTCACCATCGGCCGCCACAATGTT
GGGTACATCGAGTTCAAATTGCCCGTTGATATCAGCGGTATCGAGGTTGAAGATTTGTACGGCGGCGTCATTCAA
CTTGAGCCTCGATCTGCGACCGTCTATCCAGTGCAAGCCAAGAAGCCGCCAGTTGGCAAAGGCCTCAACGTACCC
GCAAGGATCTCGCTGGAGCAGTCGTGGCCTCGAGGGGGACGCGATAAGCGCTTCAACAAGCACGTCGAGCGGCTT
AGGCGGATACCCGACACAACATTCGAGAGCTACGACGAAGAATCTGGTGTTTGGGTTTTCTCCGTTGAGCACTTC
ACGACCTATGGCTTGGACGACGACGAAGAGGACGAGGATGATGAGGTTGGGGAGGCCTCGCAGATGACGGAGCAT
GCACTGCCACCTACTGCTCCGCCTCAAACTACGTCTCGGGCCATGTCGATCGACTCCGCCGAGGACGGCGCCGAC
GAGTTCGCACAGCGCAAGGGCGTCCCCGGCGCTTTCGACCAGCAAGAAGAGCCCCATGGAGATGGTGTCAACAAC
GAGCAGTCTTTTTTAGGGCTTAGCTCCGTGGATTCGACGTCCAACAATGTGCGGCTGTCGCTCGACGACGAGTAC
AGCAGCAACATGGACGACGGATATGACATGTCCGAGGACGAAGACATGACGAGGTCTTCTGTCGGACTGCATCGT
GCCGCGGAGCAAGACGACAGCTCGTCGGAGAACGATCAGGAGACCAAAAGGGGCACCCCTGGCGGTATTCTTAGA
GCAAGGATGCGAGCAATGAAGGACTCCGTTGGCCCGGTCCAGCTCGAGGTAGCAGAAGGTGACGATTGGATGGAG
ATGCTTCGGAAGACGGTGAGCCCCGTGAAGAGAGACCGCCAACTCCTCAGAGAGTTGAACGAGTCCCCTTCCAAG
CCAAGCGGCGCCCTCATTAGTTTCGACGACGACGACGATGACGGCGGCGGCGGCGAGCTTCGAAAGTCATCGATA
TGGGCGAAGAGTCCGAGTAAAGCCGCCCGAGCAGGCGGTGCGGCGGCGAGATCACAGATGGCGCTGGACAAGGGC
CAGGGATTCGCCACCAGCATCGACCTTATGAACTCGCTGTTCGAGAAGCCTCGGCCCGCGCGGCAGATTCCTGGC
GCGTCTTTGCCAGCAAAGGGCCTTCCGCAGTGGCCTTACGAGCGGCAAGACAAAACTCTCAGCATCGACGAGGCT
GAGAAAGCGTTTCATAATGCGTCGCGCCCAACCTGGGGACCAGACGAGACCCTGGTCGTGACAAGATCATTGAAC
GTCACGCAGTCCAGTCGACCATTCCGCGACAGCTCGGGTCTTCTCACTTTCCAGCGATCCGGCATCCTGACACAT
GCACAAGACGTCAGGCTCGCGAAATTTTCGACAGCGTCGTCGAAAACGTACCTTCGAGCTCAGGATGAGCTGACC
GAGATCCGACTTGTTGACGGTGTTCCGTCGGCCTCGCTGCGCACCCGAAGCCTTTTCGACCTCTTCCACCAGCAA
GACCTGAACGACCCGGCCAGTCTGCATGAGAGGCGTGTCTGGCAGCTCGCGAGCATCCTCTTCGATCGTGATGGC
GCGACTCTCTCGGTCGAGATGGATAAGTTGACGAGGAAGGAGAGATTGTCGCAATTTTGGACCGATTTGGTTGAA
CGAGCGTCGACCAAGAACATGATGCTCGCAAGCACATGCGAGGAAAGGGTTGTCGCGTGTCTCGCAGGCCATCGG
ATCAGGGAAGCATGCGAGGCGCTGCTGGCTGGTCGGAATTTCAGACTCGGAACCCTGGTGCCTCTGATTGGCACG
AGTGACACTGCCAAAAAAGAGATGAAGGAGCAGATCAGGGCGTGGTACGATTCCAAGATTCTATCCGAGTTCTCT
GACGCAACCCGCACCGTCTACGAACTTCTGAGCGGCAACGTCTGTGTCTGCGAGGGGATGAAGGCGGTTCCGGTC
GAGGACCGCATGGAGTCCTTTGTCATCTCCAACAAGTTTGGCCTGGACTGGAAGCAGTCTTTCGGCCTTCGGCTC
TGGTACGCTATCGCACAACGGGACAGCGTGGCTGCTGCGGTGGAAATGTACAAGGAGGACATCGACCAGGGCCGG
GAGGAGCTGCCACGGCCATGGTACGTGGAGCAGGGTATCCAGCCGCTGTGGAACGACGCCAATGCAGCCTGCCGG
CAAGACCTTCTGTGGGGGCTCCTGCAGCTATACGCCGACGACAAGGCTGATTTGGAAGCTGTGCTTCGCCCGGAA
AACTCGCAGCTGTCGCCCCTCGACATGCGGCTCTGCTGGCAGCTGGGGCTGGCACTGGTCTCGACGGGCAAGGTC
TCATTTGGACAGCGAGGCACAGAAAAGGCGGACGCATCGACGCTGGCTTATGCCGCACAGCTGACGGCCGCAGAC
GAATGGCTCGAGGCCGCCTTCGTACTGCTGCACCTGCGCGATGTCACCGCACGCATCATGGCCATCCAGGAACAC
CTTTGCCGACACGCTGGCTTGATAGGCCCCGAGTCGGGAACGACCTTCTCGATACTGACGGACAAGTTCCGGATA
CCAGCGACGTGGCTCTGGCAAGCACAGGCCGTGTACATGCGGAGCGTGAAGAAGGACGCGCCGGCGGAGGTTCAC
TGCCTACTCCAGGCCGGGTCGTTCGTGGAAGCCCATCGTGTGCTGGTCCAGCACGTGGCGCCTCAGGCGATCATC
GAACGCGATTACGAAGCTCTGGCGACCTTGATAGCGCAGTTTGAAGGACACCAGGAGTCCATCGCCGAGTGGGCC
TCGGGTGGCGAGGTGTACAGCAACTTCCTCAACCTATTGCTGCGCCGGAGTCGGGGTGAAGATGTGCCGCCCTCG
CTGCTGGAGAAGCTGTTGATGGGCCTCGGCGCGATCAACGACGGCGTCGGCGAGACGGAGCTTGCGCGATACGCT
GCGGTCTCAGACATGGCCGACGAGACGGCGCGAGAGATCTTGAAGTTGGCCAAGAAGAAGCAGGATGCGGAACTT
CGGTCCCGAATCTTGAGCCTTCCCCTCACGGAGGACCGACTCCTGGCCTACTCGGTGGACCTAAGCATGGACCGC
TACCGGGAGGTGATGTCACACTGA
Transcript >Hirsu2|1848
ATGTCGTTTGGTAGCGGCGGCTTCGGGGCCTTCGGCTCAAACAACAACCAGCAGTCGAGCGGCTTTGGTGGCGGC
TTTGGCGCAAGCAACAACACCACCTCAGGTTTTGGATCCGCAAACACCGGCGGCTTTGGCCAAAACGCCAATACG
GGAGGCGGCATGTTTGGAAGCACCAATAATGCCTCCGGCTTCGGGGCTTCGTCAGGATTTGGGTCCAATACCGGA
GGCGGCGGCTTCGGCAGTAAGCCTGCCTTTGGTGCAGCAAACACCTCCTCCACTGGAGGTCTCTTTGGATCTTCC
AATACCAATAACGCCACCTCCTCCGGCTTTGGAGCCTTCGGCAACACGAACAACGCCACCTCGTCCCCCTTCGGC
GGCGGTAACACCACAAGTGGAGGGCTTTTCGGAAGCTCCGCTAACAAGACAGGCTTCGGCACTGCGAACAACACC
GGCTCATCCCTGTTCGGCGGCGGCCAAAGCGCTGCCGGCGGCGGCTTCGGCGGCGGCGGCTTCGGCGCTGCGAAT
AACCCTGGCCTCGGAGGAGGCGTCGGCGATCCTCCCGGTACCGCGACCACGCCGTTTCAGGCCTTCACCGAGAAG
GAGCCCAACTCCAGCAACCAGTCCAACGCTTTTCAGAACATTCTCTTCCAAGACCCATATCGGAAATGGTCAGCC
GACGAGTTGAGGCTGGCGGACTATGTACAAGGACGCCGCCATGGGAATGCCAGCGGAGCCGGCGCCTTTGGCGTC
AGCTCCGGCTTTGGGGGAGCCTTCGGTTCAAACAATCAGACGACGAACGCATTTGGGGCCGCGTCGAACAATCCC
ACAAACGCCGCCGGCGGCGGCCTCTTTGGCGCTACCAACAATAACACGGCCACGTCTGGATTTGGCCAGACTGGA
GGCAATGCTTTTGGAGCCAATGCCGGCAATACCTCTGGCGGTCTGTTCGGCGGCAATAAGCCAAGTGGTGGTTTG
TTCGGCAACACCTCGAACCAGCAGAGCGGTGGCATGTTTGGAGGCTCCGGGGGTGGATTCGGCACGGCCAATGCC
GGTAATAACGCCTTCGGGACCGCCAATGCCACATCAGGCGGTATGTTTGGCACCAACAACCAGGCTAATAAGCCC
CAAGGCGGTTTCAACTTTGGGACCGCCAATGCCAACAACACCTCGTCTGGCTTCGGTGCCAATGCTCAGGGCGGG
TTCGGACAGACGAACAACACGGGAAGCACTGGGCTCTTTGGTGCCGCGAACAACAACCAGCAGCCCGGCGGAGGC
CTCTTTGGCAGCAACCAGCAGCAGCCACAAACCGCCTCTTCTGGCTTTGGGGGGGGCGGCTTCCAGAACCAGAAT
CAACAGGGCGGCGGTTTGTTCGGCAGCAACCAGCAGAAACCCGCCACAGGCGGCCTTTTTGGTGCGCCCGCCGGC
AATACGACGTCAGGTGGTCTCTTTGGGAGCAACAACAACCAGCAGCAAGGCACGCCCGGCTTTGGCTCGAACACC
AACGCGTCGACGACTGGCGGCCTCTTTGGGAGTGCCAAGCCGAGCACCAGCACCAGCTTGTTCGGCGGAACCAAT
ACTGGCCAAACGAACACTACTGGAGGCAATGGACTTTTTGGCGGCCTCGGCTCTAACACGCAAGCCCAGCCGGCA
CCCGGCTCATCCCTGTTTGGCTCGGCAAACAACGCGCAACAAAAGCCTGGCGGCCTTTTCGGCGGCACGAGCCAA
ACCCCTGGCTCGGGTCTATTCGGGGGCCAGAGCAACCAGAACCAAGGCGGCTCGCTCTTCGGTAGCAGCTCTAAT
CAGCAGCAGGCCCAGAACTCTGGGTTCGGAGGCTCCTTGCTGGGAGGCGCACAGCAGTCAGGCAACGCTCCACAA
GGACTCACCGCGAACCTTAACGACGTATCGGCTTACGGGAGTCCGTCCCTATTTGCCGGCGTCAGCGGCAACGAT
GTTTCCAACCCGGGTCCTCTCGCCACTCCCCTGAACGGCAACGCCAAACCGCGGCGAAGCAACATCCTTCCCATG
TACAAGCTTGCTCCGTCGGCCGCCTCCAGGTTCGCGACTCCCCAGAAACGAGGCTTCGGCTTTTCGTACAGCTCT
TACGGGACCCCGGGTGCCAGCCCGGCCAGCAGCATCTCAAGCACGCCTGGCGCCCTCGGTCGCAGCCTTCTTGGT
CCCAGCGCCGGTGGCACTCTGAGCAAGAGCATGTCGACGAATAACCTTCGCCGCAGCTTCAACACGGAGGACAGC
ATTCTTGCGCCGGGAGCCTTCTCGTCCAGCTCGGGCGCGCGTTGGTATGGGAGCACTGGCTCCAAAAAGCTGGTA
ATTAACAGAGACATTAGGAGTGATCTGTTTTCCACGCCCCAGAAAGACAAGCAGGCCATCGACGGCAGTTCCAGC
GCTCGCAAGCTAGCCAAGCGCGTTAGCTTTGACACGAGCAACGTCGATGCGGATGGCGGGACCCCGGCACGCAAC
GCGCTGCCAGCCCCGGAGGACACGCCGAACTCCCAAGGCGACGAGTCCACCCCGCGCCAGAACAGGTCCGCAGCT
GCTGCAAACGGTTCCAAGACCCCGGAGATGAGTGATGTCAAGGGTAACGAGCTGGCTATCGTCCACGAAGAGGAT
CAGACCACCACGCCAGAGTCGCAGAAAACCGCTGCTTTCGACAAGACGCCCGGACACTACTGGACCAAGCCGAGC
AAGGAGGAGCTGCTCAACATGAATAGGATGCAGCGACAGAGGATCGATAACTTCACCATCGGCCGCCACAATGTT
GGGTACATCGAGTTCAAATTGCCCGTTGATATCAGCGGTATCGAGGTTGAAGATTTGTACGGCGGCGTCATTCAA
CTTGAGCCTCGATCTGCGACCGTCTATCCAGTGCAAGCCAAGAAGCCGCCAGTTGGCAAAGGCCTCAACGTACCC
GCAAGGATCTCGCTGGAGCAGTCGTGGCCTCGAGGGGGACGCGATAAGCGCTTCAACAAGCACGTCGAGCGGCTT
AGGCGGATACCCGACACAACATTCGAGAGCTACGACGAAGAATCTGGTGTTTGGGTTTTCTCCGTTGAGCACTTC
ACGACCTATGGCTTGGACGACGACGAAGAGGACGAGGATGATGAGGTTGGGGAGGCCTCGCAGATGACGGAGCAT
GCACTGCCACCTACTGCTCCGCCTCAAACTACGTCTCGGGCCATGTCGATCGACTCCGCCGAGGACGGCGCCGAC
GAGTTCGCACAGCGCAAGGGCGTCCCCGGCGCTTTCGACCAGCAAGAAGAGCCCCATGGAGATGGTGTCAACAAC
GAGCAGTCTTTTTTAGGGCTTAGCTCCGTGGATTCGACGTCCAACAATGTGCGGCTGTCGCTCGACGACGAGTAC
AGCAGCAACATGGACGACGGATATGACATGTCCGAGGACGAAGACATGACGAGGTCTTCTGTCGGACTGCATCGT
GCCGCGGAGCAAGACGACAGCTCGTCGGAGAACGATCAGGAGACCAAAAGGGGCACCCCTGGCGGTATTCTTAGA
GCAAGGATGCGAGCAATGAAGGACTCCGTTGGCCCGGTCCAGCTCGAGGTAGCAGAAGGTGACGATTGGATGGAG
ATGCTTCGGAAGACGGTGAGCCCCGTGAAGAGAGACCGCCAACTCCTCAGAGAGTTGAACGAGTCCCCTTCCAAG
CCAAGCGGCGCCCTCATTAGTTTCGACGACGACGACGATGACGGCGGCGGCGGCGAGCTTCGAAAGTCATCGATA
TGGGCGAAGAGTCCGAGTAAAGCCGCCCGAGCAGGCGGTGCGGCGGCGAGATCACAGATGGCGCTGGACAAGGGC
CAGGGATTCGCCACCAGCATCGACCTTATGAACTCGCTGTTCGAGAAGCCTCGGCCCGCGCGGCAGATTCCTGGC
GCGTCTTTGCCAGCAAAGGGCCTTCCGCAGTGGCCTTACGAGCGGCAAGACAAAACTCTCAGCATCGACGAGGCT
GAGAAAGCGTTTCATAATGCGTCGCGCCCAACCTGGGGACCAGACGAGACCCTGGTCGTGACAAGATCATTGAAC
GTCACGCAGTCCAGTCGACCATTCCGCGACAGCTCGGGTCTTCTCACTTTCCAGCGATCCGGCATCCTGACACAT
GCACAAGACGTCAGGCTCGCGAAATTTTCGACAGCGTCGTCGAAAACGTACCTTCGAGCTCAGGATGAGCTGACC
GAGATCCGACTTGTTGACGGTGTTCCGTCGGCCTCGCTGCGCACCCGAAGCCTTTTCGACCTCTTCCACCAGCAA
GACCTGAACGACCCGGCCAGTCTGCATGAGAGGCGTGTCTGGCAGCTCGCGAGCATCCTCTTCGATCGTGATGGC
GCGACTCTCTCGGTCGAGATGGATAAGTTGACGAGGAAGGAGAGATTGTCGCAATTTTGGACCGATTTGGTTGAA
CGAGCGTCGACCAAGAACATGATGCTCGCAAGCACATGCGAGGAAAGGGTTGTCGCGTGTCTCGCAGGCCATCGG
ATCAGGGAAGCATGCGAGGCGCTGCTGGCTGGTCGGAATTTCAGACTCGGAACCCTGGTGCCTCTGATTGGCACG
AGTGACACTGCCAAAAAAGAGATGAAGGAGCAGATCAGGGCGTGGTACGATTCCAAGATTCTATCCGAGTTCTCT
GACGCAACCCGCACCGTCTACGAACTTCTGAGCGGCAACGTCTGTGTCTGCGAGGGGATGAAGGCGGTTCCGGTC
GAGGACCGCATGGAGTCCTTTGTCATCTCCAACAAGTTTGGCCTGGACTGGAAGCAGTCTTTCGGCCTTCGGCTC
TGGTACGCTATCGCACAACGGGACAGCGTGGCTGCTGCGGTGGAAATGTACAAGGAGGACATCGACCAGGGCCGG
GAGGAGCTGCCACGGCCATGGTACGTGGAGCAGGGTATCCAGCCGCTGTGGAACGACGCCAATGCAGCCTGCCGG
CAAGACCTTCTGTGGGGGCTCCTGCAGCTATACGCCGACGACAAGGCTGATTTGGAAGCTGTGCTTCGCCCGGAA
AACTCGCAGCTGTCGCCCCTCGACATGCGGCTCTGCTGGCAGCTGGGGCTGGCACTGGTCTCGACGGGCAAGGTC
TCATTTGGACAGCGAGGCACAGAAAAGGCGGACGCATCGACGCTGGCTTATGCCGCACAGCTGACGGCCGCAGAC
GAATGGCTCGAGGCCGCCTTCGTACTGCTGCACCTGCGCGATGTCACCGCACGCATCATGGCCATCCAGGAACAC
CTTTGCCGACACGCTGGCTTGATAGGCCCCGAGTCGGGAACGACCTTCTCGATACTGACGGACAAGTTCCGGATA
CCAGCGACGTGGCTCTGGCAAGCACAGGCCGTGTACATGCGGAGCGTGAAGAAGGACGCGCCGGCGGAGGTTCAC
TGCCTACTCCAGGCCGGGTCGTTCGTGGAAGCCCATCGTGTGCTGGTCCAGCACGTGGCGCCTCAGGCGATCATC
GAACGCGATTACGAAGCTCTGGCGACCTTGATAGCGCAGTTTGAAGGACACCAGGAGTCCATCGCCGAGTGGGCC
TCGGGTGGCGAGGTGTACAGCAACTTCCTCAACCTATTGCTGCGCCGGAGTCGGGGTGAAGATGTGCCGCCCTCG
CTGCTGGAGAAGCTGTTGATGGGCCTCGGCGCGATCAACGACGGCGTCGGCGAGACGGAGCTTGCGCGATACGCT
GCGGTCTCAGACATGGCCGACGAGACGGCGCGAGAGATCTTGAAGTTGGCCAAGAAGAAGCAGGATGCGGAACTT
CGGTCCCGAATCTTGAGCCTTCCCCTCACGGAGGACCGACTCCTGGCCTACTCGGTGGACCTAAGCATGGACCGC
TACCGGGAGGTGATGTCACACTGA
Gene >Hirsu2|1848
ATGTCGTTTGGTAGCGGCGGCTTCGGGGCCTTCGGCTCAAACAACAACCAGCAGTCGAGCGGCTTTGGTGGCGGC
TTTGGCGCAAGCAACAACACCACCTCAGGTGCGGCCGACAACCCCGACCAGATCGTGCCAAGTGCTGAGCTTTAC
TGACCGCTGTATGCCTAGGTTTTGGATCCGCAAACACCGGCGGCTTTGGCCAAAACGCCAATACGGGAGGCGGCA
TGTTTGGAAGCACCAATAATGCCTCCGGCTTCGGGGCTTCGTCAGGTAACTCTCCTCCCACGCCGTCGAGCTCGT
GCCTCACACACCGCATCTGCTAACTGATCGACATAGGATTTGGGTCCAATACCGGAGGCGGCGGCTTCGGCAGTA
AGCCTGCCTTTGGTGCAGCAAACACCTCCTCCACTGGAGGTCTCTTTGGATCTTCCAATACCAATAACGCCACCT
CCTCCGGCTTTGGAGCCTTCGGCAACACGAACAACGCCACCTCGTCCCCCTTCGGCGGCGGTAACACCACAAGTG
GAGGGCTTTTCGGAAGCTCCGCTAACAAGACAGGCTTCGGCACTGCGAACAACACCGGCTCATCCCTGTTCGGCG
GCGGCCAAAGCGCTGCCGGCGGCGGCTTCGGCGGCGGCGGCTTCGGCGCTGCGAATAACCCTGGCCTCGGAGGAG
GCGTCGGCGATCCTCCCGGTACCGCGACCACGCCGTTTCAGGCCTTCACCGAGAAGGAGCCCAACTCCAGCAACC
AGTCCAACGCTTTTCAGAACATTCTCTTCCAAGACCCATATCGGAAATGGTCAGCCGACGAGTTGAGGCTGGCGG
ACTATGTACAAGGACGCCGCCATGGGAATGCCAGCGGAGCCGGCGCCTTTGGCGTCAGCTCCGGCTTTGGGGGAG
CCTTCGGTTCAAACAATCAGACGACGAACGCATTTGGGGCCGCGTCGAACAATCCCACAAACGCCGCCGGCGGCG
GCCTCTTTGGCGCTACCAACAATAACACGGCCACGTCTGGATTTGGCCAGACTGGAGGCAATGCTTTTGGAGCCA
ATGCCGGCAATACCTCTGGCGGTCTGTTCGGCGGCAATAAGCCAAGTGGTGGTTTGTTCGGCAACACCTCGAACC
AGCAGAGCGGTGGCATGTTTGGAGGCTCCGGGGGTGGATTCGGCACGGCCAATGCCGGTAATAACGCCTTCGGGA
CCGCCAATGCCACATCAGGCGGTATGTTTGGCACCAACAACCAGGCTAATAAGCCCCAAGGCGGTTTCAACTTTG
GGACCGCCAATGCCAACAACACCTCGTCTGGCTTCGGTGCCAATGCTCAGGGCGGGTTCGGACAGACGAACAACA
CGGGAAGCACTGGGCTCTTTGGTGCCGCGAACAACAACCAGCAGCCCGGCGGAGGCCTCTTTGGCAGCAACCAGC
AGCAGCCACAAACCGCCTCTTCTGGCTTTGGGGGGGGCGGCTTCCAGAACCAGAATCAACAGGGCGGCGGTTTGT
TCGGCAGCAACCAGCAGAAACCCGCCACAGGCGGCCTTTTTGGTGCGCCCGCCGGCAATACGACGTCAGGTGGTC
TCTTTGGGAGCAACAACAACCAGCAGCAAGGCACGCCCGGCTTTGGCTCGAACACCAACGCGTCGACGACTGGCG
GCCTCTTTGGGAGTGCCAAGCCGAGCACCAGCACCAGCTTGTTCGGCGGAACCAATACTGGCCAAACGAACACTA
CTGGAGGCAATGGACTTTTTGGCGGCCTCGGCTCTAACACGCAAGCCCAGCCGGCACCCGGCTCATCCCTGTTTG
GCTCGGCAAACAACGCGCAACAAAAGCCTGGCGGCCTTTTCGGCGGCACGAGCCAAACCCCTGGCTCGGGTCTAT
TCGGGGGCCAGAGCAACCAGAACCAAGGCGGCTCGCTCTTCGGTAGCAGCTCTAATCAGCAGCAGGCCCAGAACT
CTGGGTTCGGAGGCTCCTTGCTGGGAGGCGCACAGCAGTCAGGCAACGCTCCACAAGGACTCACCGCGAACCTTA
ACGACGTATCGGCTTACGGGAGTCCGTCCCTATTTGCCGGCGTCAGCGGCAACGATGTTTCCAACCCGGGTCCTC
TCGCCACTCCCCTGAACGGCAACGCCAAACCGCGGCGAAGCAACATCCTTCCCATGTACAAGCTTGCTCCGTCGG
CCGCCTCCAGGTTCGCGACTCCCCAGAAACGAGGCTTCGGCTTTTCGTACAGCTCTTACGGGACCCCGGGTGCCA
GCCCGGCCAGCAGCATCTCAAGCACGCCTGGCGCCCTCGGTCGCAGCCTTCTTGGTCCCAGCGCCGGTGGCACTC
TGAGCAAGAGCATGTCGACGAATAACCTTCGCCGCAGCTTCAACACGGAGGACAGCATTCTTGCGCCGGGAGCCT
TCTCGTCCAGCTCGGGCGCGCGTTGGTATGGGAGCACTGGCTCCAAAAAGCTGGTAATTAACAGAGACATTAGGA
GTGATCTGTTTTCCACGCCCCAGAAAGACAAGCAGGCCATCGACGGCAGTTCCAGCGCTCGCAAGCTAGCCAAGC
GCGTTAGCTTTGACACGAGCAACGTCGATGCGGATGGCGGGACCCCGGCACGCAACGCGCTGCCAGCCCCGGAGG
ACACGCCGAACTCCCAAGGCGACGAGTCCACCCCGCGCCAGAACAGGTCCGCAGCTGCTGCAAACGGTTCCAAGA
CCCCGGAGATGAGTGATGTCAAGGGTAACGAGCTGGCTATCGTCCACGAAGAGGATCAGACCACCACGCCAGAGT
CGCAGAAAACCGCTGCTTTCGACAAGACGCCCGGACACTACTGGACCAAGCCGAGCAAGGAGGAGCTGCTCAACA
TGAATAGGATGCAGCGACAGAGGATCGATAACTTCACCATCGGCCGCCACAATGTTGGGTACATCGAGTTCAAAT
TGCCCGTTGATATCAGCGGTATCGAGGTTGAAGATTTGTACGGCGGCGTCATTCAACTTGAGCCTCGATCTGCGA
CCGTCTATCCAGTGCAAGCCAAGAAGCCGCCAGTTGGCAAAGGCCTCAACGTACCCGCAAGGATCTCGCTGGAGC
AGTCGTGGCCTCGAGGGGGACGCGATAAGCGCTTCAACAAGCACGTCGAGCGGCTTAGGCGGATACCCGACACAA
CATTCGAGAGCTACGACGAAGAATCTGGTGTTTGGGTTTTCTCCGTTGAGCACTTCACGACCTATGGCTTGGACG
ACGACGAAGAGGACGAGGATGATGAGGTTGGGGAGGCCTCGCAGATGACGGAGCATGCACTGCCACCTACTGCTC
CGCCTCAAACTACGTCTCGGGCCATGTCGATCGACTCCGCCGAGGACGGCGCCGACGAGTTCGCACAGCGCAAGG
GCGTCCCCGGCGCTTTCGACCAGCAAGAAGAGCCCCATGGAGATGGTGTCAACAACGAGCAGTCTTTTTTAGGGC
TTAGCTCCGTGGATTCGACGTCCAACAATGTGCGGCTGTCGCTCGACGACGAGTACAGCAGCAACATGGACGACG
GATATGACATGTCCGAGGACGAAGACATGACGAGGTCTTCTGTCGGACTGCATCGTGCCGCGGAGCAAGACGACA
GCTCGTCGGAGAACGATCAGGAGACCAAAAGGGGCACCCCTGGCGGTATTCTTAGAGCAAGGATGCGAGCAATGA
AGGACTCCGTTGGCCCGGTCCAGCTCGAGGTAGCAGAAGGTGACGATTGGATGGAGATGCTTCGGAAGACGGTGA
GCCCCGTGAAGAGAGACCGCCAACTCCTCAGAGAGTTGAACGAGTCCCCTTCCAAGCCAAGCGGCGCCCTCATTA
GTTTCGACGACGACGACGATGACGGCGGCGGCGGCGAGCTTCGAAAGTCATCGATATGGGCGAAGAGTCCGAGTA
AAGCCGCCCGAGCAGGCGGTGCGGCGGCGAGATCACAGATGGCGCTGGACAAGGGCCAGGGATTCGCCACCAGCA
TCGACCTTATGAACTCGCTGTTCGAGAAGCCTCGGCCCGCGCGGCAGATTCCTGGCGCGTCTTTGCCAGCAAAGG
GCCTTCCGCAGGTACGAGCTTCACATCTGAGAGATTTTGCTGCTCTCCTGAATGAGTTATGCTACGAAGATGAGC
AAATAGACGCTAACGTGTTAACCATGCTCCAGTGGCCTTACGAGCGGCAAGACAAAACTCTCAGCATCGACGAGG
CTGAGAAAGCGTTTCATAATGCGTCGCGCCCAACCTGGGGACCAGACGAGACCCTGGTCGTGACAAGATCATTGA
ACGTCACGCAGTCCAGTCGACCATTCCGCGACAGCTCGGGTCTTCTCACTTTCCAGCGATCCGGCATCCTGACAC
ATGCACAAGACGTCAGGCTCGCGAAATTTTCGACAGCGGTATGGAAGCCACTTACCCAGACTTTGCAGAGGACAT
GCTCCCTTCTAACGCAGCAACAGTCGTCGAAAACGTACCTTCGAGCTCAGGATGAGCTGACCGAGATCCGACTTG
TTGACGGTGTTCCGTCGGCCTCGCTGCGCACCCGAAGCCTTTTCGACCTCTTCCACCAGCAAGACCTGAACGACC
CGGCCAGTCTGCATGAGAGGCGTGTCTGGCAGCTCGCGAGCATCCTCTTCGATCGTGATGGCGCGACTCTCTCGG
TCGAGATGGATAAGTTGACGAGGAAGGAGAGATTGTCGCAATTTTGGACCGATTTGGTTGAACGAGCGTCGACCA
AGAACATGATGCTCGCAAGCACATGCGAGGAAAGGGTTGTCGCGTGTCTCGCAGGCCATCGGATCAGGGAAGCAT
GCGAGGCGCTGCTGGCTGGTCGGAATTTCAGACTCGGAACCCTGGTGCCTCTGATTGGCACGAGTGACACTGCCA
AAAAAGAGATGAAGGAGCAGATCAGGGCGTGGTACGATTCCAAGATTCTATCCGAGTTCTCTGACGCAACCCGCA
CCGTCTACGAACTTCTGAGCGGCAACGTCTGTGTCTGCGAGGGGATGAAGGCGGTTCCGGTCGAGGACCGCATGG
AGTCCTTTGTCATCTCCAACAAGTTTGGCCTGGACTGGAAGCAGTCTTTCGGCCTTCGGCTCTGGTACGCTATCG
CACAACGGGACAGCGTGGCTGCTGCGGTGGAAATGTACAAGGAGGACATCGACCAGGGCCGGGAGGAGCTGCCAC
GGCCATGGTACGTGGAGCAGGGTATCCAGCCGCTGTGGAACGACGCCAATGCAGCCTGCCGGCAAGACCTTCTGT
GGGGGCTCCTGCAGCTATACGCCGACGACAAGGCTGATTTGGAAGCTGTGCTTCGCCCGGAAAACTCGCAGCTGT
CGCCCCTCGACATGCGGCTCTGCTGGCAGCTGGGGCTGGCACTGGTCTCGACGGGCAAGGTCTCATTTGGACAGC
GAGGCACAGAAAAGGCGGACGCATCGACGCTGGCTTATGCCGCACAGCTGACGGCCGCAGACGAATGGCTCGAGG
CCGCCTTCGTACTGCTGCACCTGCGCGATGTCACCGCACGCATCATGGCCATCCAGGAACACCTTTGCCGACACG
CTGGCTTGATAGGCCCCGAGTCGGGAACGACCTTCTCGATACTGACGGACAAGTTCCGGATACCAGCGACGTGGC
TCTGGCAAGCACAGGCCGTGTACATGCGGAGCGTGAAGAAGGACGCGCCGGCGGAGGTTCACTGCCTACTCCAGG
CCGGGTCGTTCGTGGAAGCCCATCGTGTGCTGGTCCAGCACGTGGCGCCTCAGGCGATCATCGAACGCGATTACG
AAGCTCTGGCGACCTTGATAGCGCAGTTTGAAGGACACCAGGAGTCCATCGCCGAGTGGGCCTCGGGTGGCGAGG
TGTACAGCAACTTCCTCAACCTATTGCTGCGCCGGAGTCGGGGTGAAGATGTGCCGCCCTCGCTGCTGGAGAAGC
TGTTGATGGGCCTCGGCGCGATCAACGACGGCGTCGGCGAGACGGAGCTTGCGCGATACGCTGCGGTCTCAGACA
TGGCCGACGAGACGGCGCGAGAGATCTTGAAGTTGGCCAAGAAGAAGCAGGTATGTTGCATCTATTTCTGCTGCT
TCGCCCTCTGCCTTCTGGCGACAGTCGCTAACAAGGATAGCAGGATGCGGAACTTCGGTCCCGAATCTTGAGCCT
TCCCCTCACGGAGGACCGACTCCTGGCCTACTCGGTGGACCTAAGCATGGACCGCTACCGGGAGGTGATGTCACA
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail