Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1847
Gene name
LocationContig_142:4777..9624
Strand-
Gene length (bp)4847
Transcript length (bp)4791
Coding sequence length (bp)4791
Protein length (aa) 1597

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 4.9E-07 331 379
PF13637 Ank_4 Ankyrin repeats (many copies) 1.8E-10 97 154
PF00651 BTB BTB/POZ domain 4.1E-07 910 1025

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74881|BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb1 PE=1 SV=1 1 1067 1.0E-76
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 110 508 1.0E-28
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 124 508 1.0E-27
sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 110 508 1.0E-24
sp|Q9UGK8|SRGEF_HUMAN Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 307 563 8.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74881|BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb1 PE=1 SV=1 1 1067 1.0E-76
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 110 508 1.0E-28
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 124 508 1.0E-27
sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 110 508 1.0E-24
sp|Q9UGK8|SRGEF_HUMAN Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 307 563 8.0E-10
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 221 457 1.0E-09
sp|Q9R0X5|RPGR_MOUSE X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 219 397 1.0E-09
sp|Q92834|RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 217 400 1.0E-09
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 311 594 3.0E-09
sp|Q9N1T2|RPGR_CANLF X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris GN=RPGR PE=2 SV=1 217 400 4.0E-09
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 192 476 4.0E-09
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 311 667 7.0E-09
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 192 476 8.0E-09
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 311 594 1.0E-08
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 311 656 1.0E-08
sp|Q80YD6|SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus GN=Sergef PE=2 SV=2 310 563 2.0E-08
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 332 550 4.0E-08
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 195 476 6.0E-08
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 195 476 6.0E-08
sp|Q3MHW0|SRGEF_BOVIN Secretion-regulating guanine nucleotide exchange factor OS=Bos taurus GN=SERGEF PE=2 SV=1 320 563 9.0E-08
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 312 467 1.0E-07
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 227 476 2.0E-07
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 227 476 3.0E-07
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 915 1087 5.0E-07
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 309 505 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6511 0.5638 0.086 0.0954 0.1673 0.0296 0.0642 0.0414 0.194 0.0029

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1842
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1645
Ophiocordyceps australis map64 (Brazil) OphauB2|7044
Ophiocordyceps camponoti-floridani Ophcf2|01160
Ophiocordyceps camponoti-rufipedis Ophun1|71
Ophiocordyceps kimflemingae Ophio5|3086
Ophiocordyceps subramaniannii Hirsu2|1847 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1847
MSHLLWKYYWENDVDRFRRLLAPAGPNAAHAASKSPAIGGPGGGHLGASPGGPGGTSPRNNPKTRRASGYAATHA
RSRDGASGLSRAELNSRDHAGLTLLLRAASSTDPGARDFVQALIEHPSIDLYAQDPESGWNALHRALYFGNISIA
RLLLAKERSDLTNPALYPVSKVGQLIKTKDHEGNSPFDVYNSTIATRASTKPQDQGSSESGSDNSDSEDEMAQIS
ASVSQSMYHSTEGGELYMFGSNKNLSLGVGDEDDRQFPERIMLQRPDELLYRFYDAYLEDQALEALPSPQDVDGI
PNLIRNRPLLIQDVAMSKLHTAVLTTDPVSNLYVCGVGRGGRLGLGDENTQFRFVPVQGPFADRKIRQVALGQNH
TMAVAGNGELWTFGLNSHAQLGYVLPPPARVDEEPMSLTPRQVFGTLKKEVVVGVAASAIHSVAHTGTCLYCWGK
NVGQLALMDADSRSLDTQPTPRRVAASLLSAPIEMVSAIDKATTCLLSNFTVWVFTNYGYNLVKFPVPDILTNHG
LAASSFSNRLSPGWKEIKYIASGGETIAAVTARGDLFTMQLNHKEDANPPAGSTTNPVKIKSAVTQPQCVWDSRN
DGVTSVSVGEHESVILCTESGAVWKRVKRIKGKAAGFAGSQDAKKKAFKFQRVPYISGCVNVRSSTYGAFAAVRR
DKSVLSQKIGIAEQSLWGDVGSLLCLRDLSASRPAGDAGASRGSWEAAIARERPGSVPHEILRCTDVEQELVRWL
HSHGPQHGDMDMEVRTTASPEIRIPVHGWILAGRSCVLREAFAAFRRSVVDAANSDSFLLENTGGGKRVLTFPAV
DIFTVLNLVVFAYQDTTIPVWRYTRDAPSEAYRFRQVRTELMKMATKLQMPKLEAAARLQAGVERSLDVDLRDAV
ADPSFFEDGDIVVQLDGADVVVHSQLVCQRCPFFQGMFHGRSQGQWLSQRRGESPSTEQVRIDLRHINVDTFRYV
LQYLYADLGEDMFHDVALPTIDDFSELVLDVMGAANELMLDRLSQVCQSVIGKFVTTRNISNLLNEISPCSVAEF
KDAGLEYMCVQLECMLENHLLDGLEEELLWDLDQVVRDNQLARFPIARSGRADLLLHERYPDLVMDIDEERQRRV
RQMAFKVAQRDEERRLSSSGKSRMGSLDDGMTAVPMPERPRPGPKASRSEQASPTLRPRRSQGDMIFSMDEDACE
TRSPLSPGLEGPGPHQEMDLHHMPQSPPAWRNGKGKTSADSTGPSPSQLAAQSTGTVHELDGSPELQLPARRVGG
PWAPPALPTAKLDLKNIMSEASSKSALTSGLAAQANKSAAAGKAPVRMSQKERKKHLQMQAEAAAQFEQAKQTSE
KPRQSSSSRPSPWKAAGQAPNTSLREAMLSEMALADVAPPVKTKALTAPEAETHLSRRRTASPDTRFPGQGRAPC
SAAAATGGGGGGGGLAATPKKPLVPHSKSYMRPAPKAEPAIGASMADIIGQQKREQELVREAVAKRSLQEIQQEQ
AFQEWWDQESRRAQEEEARRQAAKGQDKGGPGNSRRGGRKTRGAAKATAAKASDEAAGTSGEAGSGPSGPRGPSG
TAARRGKAVRGGKGRQGVLGA*
Coding >Hirsu2|1847
ATGAGTCATCTGCTGTGGAAATATTACTGGGAAAACGATGTCGACAGGTTTCGGCGTCTGCTGGCCCCGGCCGGC
CCCAACGCCGCCCATGCCGCCTCCAAGAGCCCGGCGATAGGGGGACCTGGCGGAGGCCATCTCGGCGCCAGCCCC
GGCGGGCCGGGCGGGACCTCGCCCCGGAACAACCCCAAGACGCGCAGAGCTTCCGGCTACGCCGCGACCCACGCG
AGATCCCGCGACGGCGCCTCGGGCCTGAGTCGAGCCGAGCTGAACAGCCGCGATCACGCCGGGCTGACGCTCTTG
CTGCGTGCCGCCTCGTCCACCGACCCCGGCGCCCGCGACTTTGTACAGGCTCTCATCGAGCATCCCTCCATCGAT
CTCTACGCCCAAGACCCCGAGTCCGGCTGGAATGCCCTGCACAGGGCCCTGTATTTTGGCAACATCTCCATCGCC
CGACTCCTCCTGGCCAAGGAACGCAGCGATCTGACGAACCCTGCGCTCTATCCCGTGAGCAAGGTCGGCCAGCTC
ATCAAGACCAAGGACCATGAGGGGAACAGCCCGTTCGACGTCTACAACTCGACCATCGCCACCAGAGCCTCGACG
AAGCCGCAAGACCAGGGCTCATCAGAGTCTGGGTCCGACAACAGTGATAGCGAAGACGAAATGGCGCAAATATCC
GCCAGCGTGTCCCAGTCCATGTATCATTCGACTGAGGGCGGCGAGCTCTACATGTTCGGAAGCAACAAAAACCTT
TCCCTCGGCGTCGGCGATGAGGACGACCGGCAATTCCCGGAGCGCATCATGCTCCAACGACCAGACGAGCTCCTC
TACCGCTTCTACGATGCATATCTCGAAGACCAGGCCCTGGAAGCGCTGCCTTCTCCCCAGGACGTCGATGGAATC
CCCAACTTGATACGCAACCGTCCACTCCTCATCCAGGATGTTGCCATGTCCAAGCTTCATACCGCCGTTCTGACC
ACAGACCCGGTGTCCAACCTTTACGTGTGCGGTGTCGGAAGAGGTGGGCGGCTGGGGCTGGGCGATGAGAACACA
CAGTTCAGGTTTGTGCCCGTGCAAGGTCCGTTCGCAGATCGCAAGATACGGCAAGTTGCTCTTGGCCAAAACCAC
ACCATGGCTGTTGCCGGGAACGGCGAGCTATGGACGTTTGGGTTGAACTCGCATGCCCAGCTCGGCTACGTGCTG
CCGCCCCCCGCCCGGGTTGACGAGGAGCCCATGAGCTTGACGCCGCGTCAAGTGTTTGGCACCCTGAAGAAGGAA
GTTGTTGTCGGCGTCGCGGCGTCCGCCATCCATTCAGTCGCCCATACGGGGACGTGTCTGTACTGCTGGGGAAAG
AACGTCGGTCAGCTGGCGCTCATGGACGCCGATTCGAGGTCGTTGGATACCCAGCCGACCCCTCGTAGGGTTGCG
GCATCACTCCTGTCGGCGCCCATTGAGATGGTCTCTGCCATCGACAAGGCCACCACGTGCCTGCTGTCGAACTTT
ACCGTCTGGGTCTTCACCAACTACGGGTACAACCTCGTCAAGTTTCCGGTCCCCGATATCCTGACCAACCATGGC
CTGGCCGCGAGCTCCTTCTCCAACAGGCTCAGCCCCGGCTGGAAGGAAATCAAGTACATCGCGTCGGGGGGTGAA
ACGATCGCGGCCGTCACGGCCCGCGGGGACCTGTTCACCATGCAGCTCAACCACAAGGAAGACGCCAACCCGCCC
GCCGGCTCGACCACGAACCCGGTCAAGATAAAGAGCGCCGTGACGCAGCCTCAGTGCGTGTGGGACTCGAGAAAT
GACGGCGTCACTTCGGTCAGCGTCGGGGAGCACGAGTCGGTCATCCTGTGCACCGAGTCTGGCGCCGTCTGGAAA
CGGGTCAAGCGGATCAAAGGCAAGGCCGCGGGCTTTGCCGGATCCCAAGATGCAAAGAAGAAGGCCTTTAAATTT
CAACGAGTGCCGTACATCAGCGGCTGCGTCAATGTGCGCAGCTCCACCTACGGAGCGTTTGCCGCCGTCAGGAGG
GACAAGAGTGTCTTGTCGCAGAAGATTGGCATCGCCGAGCAGTCGCTCTGGGGGGACGTGGGCTCTCTCCTGTGT
CTGCGGGACTTGTCTGCTTCCCGGCCTGCCGGCGACGCCGGAGCCTCTCGCGGGTCTTGGGAGGCCGCGATTGCG
AGAGAAAGGCCCGGTTCGGTGCCCCACGAGATCTTGCGTTGCACAGACGTCGAGCAGGAACTGGTTCGGTGGCTG
CACAGCCACGGCCCCCAACACGGCGACATGGACATGGAAGTGCGTACCACGGCATCACCCGAGATCAGGATACCG
GTACATGGCTGGATCCTCGCCGGGCGGAGCTGCGTTCTGCGAGAGGCGTTTGCCGCCTTCCGCCGGTCCGTGGTG
GATGCCGCGAACTCGGACAGTTTCCTGCTCGAAAACACGGGCGGTGGGAAGCGCGTTCTCACCTTCCCAGCGGTT
GACATCTTCACCGTCTTGAACCTGGTCGTATTCGCCTACCAGGATACAACCATCCCGGTGTGGCGTTATACCCGC
GACGCCCCGTCGGAGGCCTATCGATTCCGCCAAGTTCGGACCGAACTGATGAAGATGGCGACGAAGCTTCAAATG
CCGAAGCTCGAGGCGGCCGCTCGGCTGCAGGCCGGAGTGGAGCGGTCGCTGGATGTCGACCTGAGGGACGCCGTC
GCCGACCCTTCGTTTTTCGAGGACGGGGATATCGTCGTCCAGCTCGACGGGGCGGATGTCGTGGTACACAGCCAG
CTCGTGTGCCAGCGATGCCCCTTTTTCCAGGGCATGTTTCACGGGCGATCGCAGGGCCAGTGGTTGTCCCAGCGA
CGCGGCGAATCACCCTCCACAGAACAGGTGCGCATCGACCTGAGGCACATCAACGTCGACACGTTTCGGTACGTG
CTGCAGTATCTCTATGCCGACCTGGGCGAGGACATGTTCCACGACGTCGCATTGCCGACCATCGACGACTTCTCC
GAGCTCGTCCTGGATGTCATGGGTGCTGCGAATGAGTTGATGCTCGATCGACTATCCCAGGTCTGCCAGTCTGTG
ATCGGCAAGTTCGTCACGACCCGGAACATTTCCAATCTTCTCAACGAGATCAGCCCTTGCTCGGTGGCCGAATTC
AAGGACGCCGGGTTGGAATACATGTGTGTGCAGCTGGAATGCATGCTGGAAAATCACCTCCTCGACGGTCTCGAG
GAAGAGCTCTTGTGGGACCTGGACCAGGTGGTCCGCGACAACCAACTGGCGAGGTTCCCCATCGCCCGGAGCGGA
AGGGCCGATTTACTGTTGCACGAGAGGTACCCTGACCTGGTGATGGACATCGACGAGGAACGTCAGCGTCGGGTC
AGGCAGATGGCCTTTAAAGTGGCGCAGAGGGACGAGGAGAGGAGATTGTCCTCGTCCGGCAAGAGCCGAATGGGA
AGCCTCGACGACGGCATGACGGCCGTGCCGATGCCGGAGAGGCCACGTCCAGGCCCCAAAGCCAGCCGCAGCGAG
CAAGCCAGCCCGACTCTACGTCCAAGGCGATCGCAGGGAGACATGATCTTCAGCATGGACGAGGATGCGTGCGAG
ACTCGTAGTCCCTTGTCACCCGGCCTCGAGGGTCCCGGGCCTCACCAGGAGATGGACCTGCACCACATGCCGCAG
TCGCCCCCGGCGTGGCGAAATGGCAAAGGCAAGACTTCGGCAGACTCGACGGGCCCGTCTCCGTCTCAGCTGGCG
GCCCAGAGTACAGGGACCGTTCATGAACTGGATGGGTCTCCTGAGCTGCAGCTTCCGGCGAGAAGAGTCGGTGGG
CCGTGGGCACCGCCGGCCTTGCCGACGGCGAAATTGGACCTCAAGAACATCATGTCGGAAGCGTCTTCCAAGTCG
GCCCTCACTTCGGGCCTGGCGGCACAGGCCAACAAGAGCGCGGCGGCGGGCAAGGCGCCCGTCAGGATGTCTCAG
AAGGAGCGCAAGAAACACCTTCAAATGCAGGCGGAGGCGGCCGCACAGTTCGAGCAGGCCAAACAAACGTCGGAA
AAGCCGAGGCAGAGCAGCAGCAGCCGGCCTTCGCCGTGGAAGGCGGCAGGACAGGCCCCGAACACGTCGCTGAGG
GAGGCGATGCTGTCGGAGATGGCGCTGGCAGACGTGGCGCCGCCGGTCAAGACCAAAGCACTCACGGCCCCGGAG
GCAGAGACGCACCTGAGCCGGAGACGGACGGCGTCGCCCGACACCAGGTTTCCGGGACAGGGGCGCGCGCCTTGT
TCGGCGGCGGCGGCCACTGGGGGAGGAGGAGGAGGAGGAGGCTTGGCGGCGACGCCAAAGAAGCCGCTGGTGCCG
CACTCTAAGTCGTACATGAGGCCGGCGCCCAAGGCCGAGCCCGCGATTGGGGCCAGCATGGCGGACATCATTGGG
CAGCAGAAACGCGAGCAAGAGCTGGTGAGGGAGGCCGTGGCCAAGCGGTCACTGCAGGAGATCCAGCAGGAACAA
GCGTTCCAGGAGTGGTGGGATCAGGAGAGCCGACGGGCCCAGGAGGAGGAGGCAAGGCGGCAGGCGGCCAAAGGG
CAGGACAAGGGAGGGCCGGGGAACAGCCGGCGCGGCGGCCGCAAGACGAGGGGAGCAGCCAAGGCAACGGCGGCC
AAGGCGAGCGACGAAGCTGCTGGCACCAGCGGAGAAGCTGGCTCGGGGCCCAGCGGGCCGAGGGGGCCCAGCGGC
ACGGCGGCACGGCGAGGCAAAGCCGTGAGGGGAGGAAAAGGGCGGCAGGGCGTGCTTGGGGCTTGA
Transcript >Hirsu2|1847
ATGAGTCATCTGCTGTGGAAATATTACTGGGAAAACGATGTCGACAGGTTTCGGCGTCTGCTGGCCCCGGCCGGC
CCCAACGCCGCCCATGCCGCCTCCAAGAGCCCGGCGATAGGGGGACCTGGCGGAGGCCATCTCGGCGCCAGCCCC
GGCGGGCCGGGCGGGACCTCGCCCCGGAACAACCCCAAGACGCGCAGAGCTTCCGGCTACGCCGCGACCCACGCG
AGATCCCGCGACGGCGCCTCGGGCCTGAGTCGAGCCGAGCTGAACAGCCGCGATCACGCCGGGCTGACGCTCTTG
CTGCGTGCCGCCTCGTCCACCGACCCCGGCGCCCGCGACTTTGTACAGGCTCTCATCGAGCATCCCTCCATCGAT
CTCTACGCCCAAGACCCCGAGTCCGGCTGGAATGCCCTGCACAGGGCCCTGTATTTTGGCAACATCTCCATCGCC
CGACTCCTCCTGGCCAAGGAACGCAGCGATCTGACGAACCCTGCGCTCTATCCCGTGAGCAAGGTCGGCCAGCTC
ATCAAGACCAAGGACCATGAGGGGAACAGCCCGTTCGACGTCTACAACTCGACCATCGCCACCAGAGCCTCGACG
AAGCCGCAAGACCAGGGCTCATCAGAGTCTGGGTCCGACAACAGTGATAGCGAAGACGAAATGGCGCAAATATCC
GCCAGCGTGTCCCAGTCCATGTATCATTCGACTGAGGGCGGCGAGCTCTACATGTTCGGAAGCAACAAAAACCTT
TCCCTCGGCGTCGGCGATGAGGACGACCGGCAATTCCCGGAGCGCATCATGCTCCAACGACCAGACGAGCTCCTC
TACCGCTTCTACGATGCATATCTCGAAGACCAGGCCCTGGAAGCGCTGCCTTCTCCCCAGGACGTCGATGGAATC
CCCAACTTGATACGCAACCGTCCACTCCTCATCCAGGATGTTGCCATGTCCAAGCTTCATACCGCCGTTCTGACC
ACAGACCCGGTGTCCAACCTTTACGTGTGCGGTGTCGGAAGAGGTGGGCGGCTGGGGCTGGGCGATGAGAACACA
CAGTTCAGGTTTGTGCCCGTGCAAGGTCCGTTCGCAGATCGCAAGATACGGCAAGTTGCTCTTGGCCAAAACCAC
ACCATGGCTGTTGCCGGGAACGGCGAGCTATGGACGTTTGGGTTGAACTCGCATGCCCAGCTCGGCTACGTGCTG
CCGCCCCCCGCCCGGGTTGACGAGGAGCCCATGAGCTTGACGCCGCGTCAAGTGTTTGGCACCCTGAAGAAGGAA
GTTGTTGTCGGCGTCGCGGCGTCCGCCATCCATTCAGTCGCCCATACGGGGACGTGTCTGTACTGCTGGGGAAAG
AACGTCGGTCAGCTGGCGCTCATGGACGCCGATTCGAGGTCGTTGGATACCCAGCCGACCCCTCGTAGGGTTGCG
GCATCACTCCTGTCGGCGCCCATTGAGATGGTCTCTGCCATCGACAAGGCCACCACGTGCCTGCTGTCGAACTTT
ACCGTCTGGGTCTTCACCAACTACGGGTACAACCTCGTCAAGTTTCCGGTCCCCGATATCCTGACCAACCATGGC
CTGGCCGCGAGCTCCTTCTCCAACAGGCTCAGCCCCGGCTGGAAGGAAATCAAGTACATCGCGTCGGGGGGTGAA
ACGATCGCGGCCGTCACGGCCCGCGGGGACCTGTTCACCATGCAGCTCAACCACAAGGAAGACGCCAACCCGCCC
GCCGGCTCGACCACGAACCCGGTCAAGATAAAGAGCGCCGTGACGCAGCCTCAGTGCGTGTGGGACTCGAGAAAT
GACGGCGTCACTTCGGTCAGCGTCGGGGAGCACGAGTCGGTCATCCTGTGCACCGAGTCTGGCGCCGTCTGGAAA
CGGGTCAAGCGGATCAAAGGCAAGGCCGCGGGCTTTGCCGGATCCCAAGATGCAAAGAAGAAGGCCTTTAAATTT
CAACGAGTGCCGTACATCAGCGGCTGCGTCAATGTGCGCAGCTCCACCTACGGAGCGTTTGCCGCCGTCAGGAGG
GACAAGAGTGTCTTGTCGCAGAAGATTGGCATCGCCGAGCAGTCGCTCTGGGGGGACGTGGGCTCTCTCCTGTGT
CTGCGGGACTTGTCTGCTTCCCGGCCTGCCGGCGACGCCGGAGCCTCTCGCGGGTCTTGGGAGGCCGCGATTGCG
AGAGAAAGGCCCGGTTCGGTGCCCCACGAGATCTTGCGTTGCACAGACGTCGAGCAGGAACTGGTTCGGTGGCTG
CACAGCCACGGCCCCCAACACGGCGACATGGACATGGAAGTGCGTACCACGGCATCACCCGAGATCAGGATACCG
GTACATGGCTGGATCCTCGCCGGGCGGAGCTGCGTTCTGCGAGAGGCGTTTGCCGCCTTCCGCCGGTCCGTGGTG
GATGCCGCGAACTCGGACAGTTTCCTGCTCGAAAACACGGGCGGTGGGAAGCGCGTTCTCACCTTCCCAGCGGTT
GACATCTTCACCGTCTTGAACCTGGTCGTATTCGCCTACCAGGATACAACCATCCCGGTGTGGCGTTATACCCGC
GACGCCCCGTCGGAGGCCTATCGATTCCGCCAAGTTCGGACCGAACTGATGAAGATGGCGACGAAGCTTCAAATG
CCGAAGCTCGAGGCGGCCGCTCGGCTGCAGGCCGGAGTGGAGCGGTCGCTGGATGTCGACCTGAGGGACGCCGTC
GCCGACCCTTCGTTTTTCGAGGACGGGGATATCGTCGTCCAGCTCGACGGGGCGGATGTCGTGGTACACAGCCAG
CTCGTGTGCCAGCGATGCCCCTTTTTCCAGGGCATGTTTCACGGGCGATCGCAGGGCCAGTGGTTGTCCCAGCGA
CGCGGCGAATCACCCTCCACAGAACAGGTGCGCATCGACCTGAGGCACATCAACGTCGACACGTTTCGGTACGTG
CTGCAGTATCTCTATGCCGACCTGGGCGAGGACATGTTCCACGACGTCGCATTGCCGACCATCGACGACTTCTCC
GAGCTCGTCCTGGATGTCATGGGTGCTGCGAATGAGTTGATGCTCGATCGACTATCCCAGGTCTGCCAGTCTGTG
ATCGGCAAGTTCGTCACGACCCGGAACATTTCCAATCTTCTCAACGAGATCAGCCCTTGCTCGGTGGCCGAATTC
AAGGACGCCGGGTTGGAATACATGTGTGTGCAGCTGGAATGCATGCTGGAAAATCACCTCCTCGACGGTCTCGAG
GAAGAGCTCTTGTGGGACCTGGACCAGGTGGTCCGCGACAACCAACTGGCGAGGTTCCCCATCGCCCGGAGCGGA
AGGGCCGATTTACTGTTGCACGAGAGGTACCCTGACCTGGTGATGGACATCGACGAGGAACGTCAGCGTCGGGTC
AGGCAGATGGCCTTTAAAGTGGCGCAGAGGGACGAGGAGAGGAGATTGTCCTCGTCCGGCAAGAGCCGAATGGGA
AGCCTCGACGACGGCATGACGGCCGTGCCGATGCCGGAGAGGCCACGTCCAGGCCCCAAAGCCAGCCGCAGCGAG
CAAGCCAGCCCGACTCTACGTCCAAGGCGATCGCAGGGAGACATGATCTTCAGCATGGACGAGGATGCGTGCGAG
ACTCGTAGTCCCTTGTCACCCGGCCTCGAGGGTCCCGGGCCTCACCAGGAGATGGACCTGCACCACATGCCGCAG
TCGCCCCCGGCGTGGCGAAATGGCAAAGGCAAGACTTCGGCAGACTCGACGGGCCCGTCTCCGTCTCAGCTGGCG
GCCCAGAGTACAGGGACCGTTCATGAACTGGATGGGTCTCCTGAGCTGCAGCTTCCGGCGAGAAGAGTCGGTGGG
CCGTGGGCACCGCCGGCCTTGCCGACGGCGAAATTGGACCTCAAGAACATCATGTCGGAAGCGTCTTCCAAGTCG
GCCCTCACTTCGGGCCTGGCGGCACAGGCCAACAAGAGCGCGGCGGCGGGCAAGGCGCCCGTCAGGATGTCTCAG
AAGGAGCGCAAGAAACACCTTCAAATGCAGGCGGAGGCGGCCGCACAGTTCGAGCAGGCCAAACAAACGTCGGAA
AAGCCGAGGCAGAGCAGCAGCAGCCGGCCTTCGCCGTGGAAGGCGGCAGGACAGGCCCCGAACACGTCGCTGAGG
GAGGCGATGCTGTCGGAGATGGCGCTGGCAGACGTGGCGCCGCCGGTCAAGACCAAAGCACTCACGGCCCCGGAG
GCAGAGACGCACCTGAGCCGGAGACGGACGGCGTCGCCCGACACCAGGTTTCCGGGACAGGGGCGCGCGCCTTGT
TCGGCGGCGGCGGCCACTGGGGGAGGAGGAGGAGGAGGAGGCTTGGCGGCGACGCCAAAGAAGCCGCTGGTGCCG
CACTCTAAGTCGTACATGAGGCCGGCGCCCAAGGCCGAGCCCGCGATTGGGGCCAGCATGGCGGACATCATTGGG
CAGCAGAAACGCGAGCAAGAGCTGGTGAGGGAGGCCGTGGCCAAGCGGTCACTGCAGGAGATCCAGCAGGAACAA
GCGTTCCAGGAGTGGTGGGATCAGGAGAGCCGACGGGCCCAGGAGGAGGAGGCAAGGCGGCAGGCGGCCAAAGGG
CAGGACAAGGGAGGGCCGGGGAACAGCCGGCGCGGCGGCCGCAAGACGAGGGGAGCAGCCAAGGCAACGGCGGCC
AAGGCGAGCGACGAAGCTGCTGGCACCAGCGGAGAAGCTGGCTCGGGGCCCAGCGGGCCGAGGGGGCCCAGCGGC
ACGGCGGCACGGCGAGGCAAAGCCGTGAGGGGAGGAAAAGGGCGGCAGGGCGTGCTTGGGGCTTGA
Gene >Hirsu2|1847
ATGAGTCATCTGCTGTGGAAATATTACTGGGAAAACGATGTCGACAGGTTTCGGCGTCTGCTGGCCCCGGCCGGC
CCCAACGCCGCCCATGCCGCCTCCAAGAGCCCGGCGATAGGGGGACCTGGCGGAGGCCATCTCGGCGCCAGCCCC
GGCGGGCCGGGCGGGACCTCGCCCCGGAACAACCCCAAGACGCGCAGAGCTTCCGGCTACGCCGCGACCCACGCG
AGATCCCGCGACGGCGCCTCGGGCCTGAGTCGAGCCGAGCTGAACAGCCGCGATCACGCCGGGCTGACGCTCTTG
CTGCGTGCCGCCTCGTCCACCGACCCCGGCGCCCGCGACTTTGTACAGGCTCTCATCGAGCATCCCTCCATCGAT
CTCTACGCCCAAGACCCCGAGTCCGGCTGGAATGCCCTGCACAGGGCCCTGTATTTTGGCAACATCTCCATCGCC
CGACTCCTCCTGGCCAAGGAACGCAGCGATCTGACGAACCCTGCGCTCTATCCCGTGAGCAAGGTCGGCCAGCTC
ATCAAGACCAAGGACCATGAGGGGAACAGCCCGTTCGACGTCTACAACTCGACCATCGCCACCAGAGCCTCGACG
AAGCCGCAAGACCAGGGCTCATCAGAGTCTGGGTCCGACAACAGTGATAGCGAAGACGAAATGGCGCAAATGTTC
GTCCAAGCCCCCCGCTCTGCCCCCATCTCTACGCCATCTGACCACGTCCCAGATCCGCCAGCGTGTCCCAGTCCA
TGTATCATTCGACTGAGGGCGGCGAGCTCTACATGTTCGGAAGCAACAAAAACCTTTCCCTCGGCGTCGGCGATG
AGGACGACCGGCAATTCCCGGAGCGCATCATGCTCCAACGACCAGACGAGCTCCTCTACCGCTTCTACGATGCAT
ATCTCGAAGACCAGGCCCTGGAAGCGCTGCCTTCTCCCCAGGACGTCGATGGAATCCCCAACTTGATACGCAACC
GTCCACTCCTCATCCAGGATGTTGCCATGTCCAAGCTTCATACCGCCGTTCTGACCACAGACCCGGTGTCCAACC
TTTACGTGTGCGGTGTCGGAAGAGGTGGGCGGCTGGGGCTGGGCGATGAGAACACACAGTTCAGGTTTGTGCCCG
TGCAAGGTCCGTTCGCAGATCGCAAGATACGGCAAGTTGCTCTTGGCCAAAACCACACCATGGCTGTTGCCGGGA
ACGGCGAGCTATGGACGTTTGGGTTGAACTCGCATGCCCAGCTCGGCTACGTGCTGCCGCCCCCCGCCCGGGTTG
ACGAGGAGCCCATGAGCTTGACGCCGCGTCAAGTGTTTGGCACCCTGAAGAAGGAAGTTGTTGTCGGCGTCGCGG
CGTCCGCCATCCATTCAGTCGCCCATACGGGGACGTGTCTGTACTGCTGGGGAAAGAACGTCGGTCAGCTGGCGC
TCATGGACGCCGATTCGAGGTCGTTGGATACCCAGCCGACCCCTCGTAGGGTTGCGGCATCACTCCTGTCGGCGC
CCATTGAGATGGTCTCTGCCATCGACAAGGCCACCACGTGCCTGCTGTCGAACTTTACCGTCTGGGTCTTCACCA
ACTACGGGTACAACCTCGTCAAGTTTCCGGTCCCCGATATCCTGACCAACCATGGCCTGGCCGCGAGCTCCTTCT
CCAACAGGCTCAGCCCCGGCTGGAAGGAAATCAAGTACATCGCGTCGGGGGGTGAAACGATCGCGGCCGTCACGG
CCCGCGGGGACCTGTTCACCATGCAGCTCAACCACAAGGAAGACGCCAACCCGCCCGCCGGCTCGACCACGAACC
CGGTCAAGATAAAGAGCGCCGTGACGCAGCCTCAGTGCGTGTGGGACTCGAGAAATGACGGCGTCACTTCGGTCA
GCGTCGGGGAGCACGAGTCGGTCATCCTGTGCACCGAGTCTGGCGCCGTCTGGAAACGGGTCAAGCGGATCAAAG
GCAAGGCCGCGGGCTTTGCCGGATCCCAAGATGCAAAGAAGAAGGCCTTTAAATTTCAACGAGTGCCGTACATCA
GCGGCTGCGTCAATGTGCGCAGCTCCACCTACGGAGCGTTTGCCGCCGTCAGGAGGGACAAGAGTGTCTTGTCGC
AGAAGATTGGCATCGCCGAGCAGTCGCTCTGGGGGGACGTGGGCTCTCTCCTGTGTCTGCGGGACTTGTCTGCTT
CCCGGCCTGCCGGCGACGCCGGAGCCTCTCGCGGGTCTTGGGAGGCCGCGATTGCGAGAGAAAGGCCCGGTTCGG
TGCCCCACGAGATCTTGCGTTGCACAGACGTCGAGCAGGAACTGGTTCGGTGGCTGCACAGCCACGGCCCCCAAC
ACGGCGACATGGACATGGAAGTGCGTACCACGGCATCACCCGAGATCAGGATACCGGTACATGGCTGGATCCTCG
CCGGGCGGAGCTGCGTTCTGCGAGAGGCGTTTGCCGCCTTCCGCCGGTCCGTGGTGGATGCCGCGAACTCGGACA
GTTTCCTGCTCGAAAACACGGGCGGTGGGAAGCGCGTTCTCACCTTCCCAGCGGTTGACATCTTCACCGTCTTGA
ACCTGGTCGTATTCGCCTACCAGGATACAACCATCCCGGTGTGGCGTTATACCCGCGACGCCCCGTCGGAGGCCT
ATCGATTCCGCCAAGTTCGGACCGAACTGATGAAGATGGCGACGAAGCTTCAAATGCCGAAGCTCGAGGCGGCCG
CTCGGCTGCAGGCCGGAGTGGAGCGGTCGCTGGATGTCGACCTGAGGGACGCCGTCGCCGACCCTTCGTTTTTCG
AGGACGGGGATATCGTCGTCCAGCTCGACGGGGCGGATGTCGTGGTACACAGCCAGCTCGTGTGCCAGCGATGCC
CCTTTTTCCAGGGCATGTTTCACGGGCGATCGCAGGGCCAGTGGTTGTCCCAGCGACGCGGCGAATCACCCTCCA
CAGAACAGGTGCGCATCGACCTGAGGCACATCAACGTCGACACGTTTCGGTACGTGCTGCAGTATCTCTATGCCG
ACCTGGGCGAGGACATGTTCCACGACGTCGCATTGCCGACCATCGACGACTTCTCCGAGCTCGTCCTGGATGTCA
TGGGTGCTGCGAATGAGTTGATGCTCGATCGACTATCCCAGGTCTGCCAGTCTGTGATCGGCAAGTTCGTCACGA
CCCGGAACATTTCCAATCTTCTCAACGAGATCAGCCCTTGCTCGGTGGCCGAATTCAAGGACGCCGGGTTGGAAT
ACATGTGTGTGCAGCTGGAATGCATGCTGGAAAATCACCTCCTCGACGGTCTCGAGGAAGAGCTCTTGTGGGACC
TGGACCAGGTGGTCCGCGACAACCAACTGGCGAGGTTCCCCATCGCCCGGAGCGGAAGGGCCGATTTACTGTTGC
ACGAGAGGTACCCTGACCTGGTGATGGACATCGACGAGGAACGTCAGCGTCGGGTCAGGCAGATGGCCTTTAAAG
TGGCGCAGAGGGACGAGGAGAGGAGATTGTCCTCGTCCGGCAAGAGCCGAATGGGAAGCCTCGACGACGGCATGA
CGGCCGTGCCGATGCCGGAGAGGCCACGTCCAGGCCCCAAAGCCAGCCGCAGCGAGCAAGCCAGCCCGACTCTAC
GTCCAAGGCGATCGCAGGGAGACATGATCTTCAGCATGGACGAGGATGCGTGCGAGACTCGTAGTCCCTTGTCAC
CCGGCCTCGAGGGTCCCGGGCCTCACCAGGAGATGGACCTGCACCACATGCCGCAGTCGCCCCCGGCGTGGCGAA
ATGGCAAAGGCAAGACTTCGGCAGACTCGACGGGCCCGTCTCCGTCTCAGCTGGCGGCCCAGAGTACAGGGACCG
TTCATGAACTGGATGGGTCTCCTGAGCTGCAGCTTCCGGCGAGAAGAGTCGGTGGGCCGTGGGCACCGCCGGCCT
TGCCGACGGCGAAATTGGACCTCAAGAACATCATGTCGGAAGCGTCTTCCAAGTCGGCCCTCACTTCGGGCCTGG
CGGCACAGGCCAACAAGAGCGCGGCGGCGGGCAAGGCGCCCGTCAGGATGTCTCAGAAGGAGCGCAAGAAACACC
TTCAAATGCAGGCGGAGGCGGCCGCACAGTTCGAGCAGGCCAAACAAACGTCGGAAAAGCCGAGGCAGAGCAGCA
GCAGCCGGCCTTCGCCGTGGAAGGCGGCAGGACAGGCCCCGAACACGTCGCTGAGGGAGGCGATGCTGTCGGAGA
TGGCGCTGGCAGACGTGGCGCCGCCGGTCAAGACCAAAGCACTCACGGCCCCGGAGGCAGAGACGCACCTGAGCC
GGAGACGGACGGCGTCGCCCGACACCAGGTTTCCGGGACAGGGGCGCGCGCCTTGTTCGGCGGCGGCGGCCACTG
GGGGAGGAGGAGGAGGAGGAGGCTTGGCGGCGACGCCAAAGAAGCCGCTGGTGCCGCACTCTAAGTCGTACATGA
GGCCGGCGCCCAAGGCCGAGCCCGCGATTGGGGCCAGCATGGCGGACATCATTGGGCAGCAGAAACGCGAGCAAG
AGCTGGTGAGGGAGGCCGTGGCCAAGCGGTCACTGCAGGAGATCCAGCAGGAACAAGCGTTCCAGGAGTGGTGGG
ATCAGGAGAGCCGACGGGCCCAGGAGGAGGAGGCAAGGCGGCAGGCGGCCAAAGGGCAGGACAAGGGAGGGCCGG
GGAACAGCCGGCGCGGCGGCCGCAAGACGAGGGGAGCAGCCAAGGCAACGGCGGCCAAGGCGAGCGACGAAGCTG
CTGGCACCAGCGGAGAAGCTGGCTCGGGGCCCAGCGGGCCGAGGGGGCCCAGCGGCACGGCGGCACGGCGAGGCA
AAGCCGTGAGGGGAGGAAAAGGGCGGCAGGGCGTGCTTGGGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail