Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1832
Gene name
LocationContig_1414:3184..4372
Strand-
Gene length (bp)1188
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 1.0E-26 6 124
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 6.2E-11 138 200
PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain 3.9E-05 30 120

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42896|YBQ3_SCHPO Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC115.03 PE=3 SV=1 9 348 7.0E-65
sp|P77376|YDGJ_ECOLI Uncharacterized oxidoreductase YdgJ OS=Escherichia coli (strain K12) GN=ydgJ PE=3 SV=2 8 354 1.0E-62
sp|O13991|YEG9_SCHPO Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.09c PE=2 SV=3 8 359 7.0E-61
sp|O32223|IOLW_BACSU scyllo-inositol 2-dehydrogenase (NADP(+)) OS=Bacillus subtilis (strain 168) GN=iolW PE=1 SV=1 5 359 3.0E-60
sp|P46853|YHHX_ECOLI Uncharacterized oxidoreductase YhhX OS=Escherichia coli (strain K12) GN=yhhX PE=1 SV=1 5 353 5.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42896|YBQ3_SCHPO Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC115.03 PE=3 SV=1 9 348 7.0E-65
sp|P77376|YDGJ_ECOLI Uncharacterized oxidoreductase YdgJ OS=Escherichia coli (strain K12) GN=ydgJ PE=3 SV=2 8 354 1.0E-62
sp|O13991|YEG9_SCHPO Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.09c PE=2 SV=3 8 359 7.0E-61
sp|O32223|IOLW_BACSU scyllo-inositol 2-dehydrogenase (NADP(+)) OS=Bacillus subtilis (strain 168) GN=iolW PE=1 SV=1 5 359 3.0E-60
sp|P46853|YHHX_ECOLI Uncharacterized oxidoreductase YhhX OS=Escherichia coli (strain K12) GN=yhhX PE=1 SV=1 5 353 5.0E-48
sp|P74041|Y816_SYNY3 Uncharacterized oxidoreductase sll0816 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0816 PE=3 SV=1 6 258 2.0E-17
sp|Q53TZ2|ARADH_AZOBR L-arabinose 1-dehydrogenase OS=Azospirillum brasilense GN=araA PE=1 SV=1 7 284 2.0E-14
sp|O05389|YRBE_BACSU Uncharacterized oxidoreductase YrbE OS=Bacillus subtilis (strain 168) GN=yrbE PE=3 SV=2 8 257 2.0E-13
sp|P77503|YCJS_ECOLI Uncharacterized oxidoreductase YcjS OS=Escherichia coli (strain K12) GN=ycjS PE=3 SV=1 1 198 8.0E-13
sp|Q44258|CBAC_COMTE 1-carboxy-3-chloro-3,4-dihydroxycyclo hexa-1,5-diene dehydrogenase OS=Comamonas testosteroni GN=cbaC PE=4 SV=2 8 194 3.0E-12
sp|P94437|YFII_BACSU Uncharacterized oxidoreductase YfiI OS=Bacillus subtilis (strain 168) GN=yfiI PE=3 SV=1 69 276 9.0E-12
sp|Q6DKE0|DHDH_XENLA Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus laevis GN=dhdh PE=2 SV=1 35 211 2.0E-11
sp|Q2I8V6|AFR_ENSAD 1,5-anhydro-D-fructose reductase OS=Ensifer adhaerens GN=afr PE=1 SV=1 36 258 4.0E-11
sp|Q6DF30|DHDH_XENTR Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus tropicalis GN=dhdh PE=2 SV=1 2 199 7.0E-11
sp|O05265|YULF_BACSU Uncharacterized oxidoreductase YulF OS=Bacillus subtilis (strain 168) GN=yulF PE=3 SV=2 31 211 1.0E-10
sp|D4GP30|XDH2_HALVD D-xylose 1-dehydrogenase (NADP(+)) 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_B0029 PE=1 SV=1 35 361 1.0E-10
sp|P49305|YMO1_RHIML Uncharacterized oxidoreductase ORF334 OS=Rhizobium meliloti PE=3 SV=1 9 357 2.0E-10
sp|Q9TV69|DHDH_PIG Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Sus scrofa GN=DHDH PE=1 SV=1 49 241 3.0E-10
sp|Q642M9|DHDH_DANRE Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Danio rerio GN=dhdh PE=2 SV=2 49 196 5.0E-10
sp|C5BYN4|IOLG_BEUC1 Inositol 2-dehydrogenase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=iolG PE=3 SV=1 54 196 2.0E-09
sp|Q8ZK57|IOLG_SALTY Inositol 2-dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=iolG PE=1 SV=1 53 239 2.0E-09
sp|A9N564|IOLG_SALPB Inositol 2-dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=iolG PE=3 SV=1 53 239 2.0E-09
sp|B5F3F4|IOLG_SALA4 Inositol 2-dehydrogenase OS=Salmonella agona (strain SL483) GN=iolG PE=3 SV=1 53 239 2.0E-09
sp|A6WFC5|IOLG_KINRD Inositol 2-dehydrogenase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=iolG PE=3 SV=2 59 196 2.0E-09
sp|Q07982|GFO_ZYMMO Glucose--fructose oxidoreductase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gfo PE=1 SV=2 6 360 3.0E-09
sp|Q05184|PHT4_PSEPU Putative 4,5-dihydroxyphthalate dehydrogenase OS=Pseudomonas putida GN=pht4 PE=2 SV=1 6 196 4.0E-09
sp|Q9TV68|DHDH_CANLF Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Canis lupus familiaris GN=DHDH PE=1 SV=1 49 256 4.0E-09
sp|P11886|GAL_PSEFL Galactose 1-dehydrogenase OS=Pseudomonas fluorescens GN=gal PE=1 SV=1 6 123 6.0E-09
sp|Q7JK39|DHDH_MACFU Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Macaca fuscata fuscata GN=DHDH PE=1 SV=1 5 196 7.0E-09
sp|Q9TQS6|DHDH_MACFA Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Macaca fascicularis GN=DHDH PE=1 SV=1 5 196 7.0E-09
sp|Q9TV70|DHDH_RABIT Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (Fragment) OS=Oryctolagus cuniculus GN=DHDH PE=1 SV=1 36 231 2.0E-08
sp|Q3B7J2|GFOD2_HUMAN Glucose-fructose oxidoreductase domain-containing protein 2 OS=Homo sapiens GN=GFOD2 PE=2 SV=1 8 205 2.0E-08
sp|Q7BUE1|RIFL_AMYMS Putative UDP-kanosamine synthase oxidoreductase subunit OS=Amycolatopsis mediterranei (strain S699) GN=rifL PE=1 SV=1 10 196 3.0E-08
sp|Q82NQ8|IOLG_STRAW Inositol 2-dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=iolG PE=3 SV=1 57 190 3.0E-08
sp|Q9X7U5|IOLG_STRCO Inositol 2-dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=iolG PE=3 SV=1 57 190 4.0E-08
sp|Q5R5J5|DHDH_PONAB Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Pongo abelii GN=DHDH PE=2 SV=1 5 196 4.0E-08
sp|Q5BIP5|GFOD2_BOVIN Glucose-fructose oxidoreductase domain-containing protein 2 OS=Bos taurus GN=GFOD2 PE=2 SV=1 8 205 4.0E-08
sp|Q9UQ10|DHDH_HUMAN Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Homo sapiens GN=DHDH PE=1 SV=1 5 196 4.0E-08
sp|Q04869|YM94_YEAST Uncharacterized protein YMR315W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR315W PE=1 SV=1 6 280 5.0E-08
sp|Q92KZ3|AFR_RHIME 1,5-anhydro-D-fructose reductase OS=Rhizobium meliloti (strain 1021) GN=afr PE=1 SV=1 36 258 5.0E-08
sp|A4FDY3|IOLG1_SACEN Inositol 2-dehydrogenase 1 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=iolG1 PE=3 SV=2 53 147 5.0E-08
sp|Q9CYH5|GFOD2_MOUSE Glucose-fructose oxidoreductase domain-containing protein 2 OS=Mus musculus GN=Gfod2 PE=2 SV=1 8 205 6.0E-08
sp|Q148L6|DHDH_BOVIN Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Bos taurus GN=DHDH PE=2 SV=1 49 231 6.0E-08
sp|P37168|YCEM_SALTY Putative oxidoreductase YceM OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yceM PE=1 SV=2 4 213 7.0E-08
sp|O07564|NTDC_BACSU Glucose-6-phosphate 3-dehydrogenase OS=Bacillus subtilis (strain 168) GN=ntdC PE=1 SV=2 55 195 1.0E-07
sp|P75931|YCEM_ECOLI Putative oxidoreductase YceM OS=Escherichia coli (strain K12) GN=yceM PE=1 SV=1 4 213 2.0E-07
sp|P55480|Y4HM_RHISN Uncharacterized oxidoreductase y4hM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03370 PE=3 SV=1 35 196 2.0E-07
sp|Q9DBB8|DHDH_MOUSE Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Mus musculus GN=Dhdh PE=1 SV=1 9 231 2.0E-07
sp|A4FK61|IOLG4_SACEN Inositol 2-dehydrogenase 4 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=iolG4 PE=3 SV=1 68 196 3.0E-07
sp|A9H5B7|IOLG_GLUDA Inositol 2-dehydrogenase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=iolG PE=3 SV=1 46 193 3.0E-07
sp|O34371|YTET_BACSU Putative oxidoreductase YteT OS=Bacillus subtilis (strain 168) GN=yteT PE=2 SV=1 9 289 4.0E-07
sp|A1B2N1|IOLG_PARDP Inositol 2-dehydrogenase OS=Paracoccus denitrificans (strain Pd 1222) GN=iolG PE=3 SV=1 6 143 7.0E-07
sp|P42599|YGJR_ECOLI Uncharacterized oxidoreductase YgjR OS=Escherichia coli (strain K12) GN=ygjR PE=3 SV=3 32 276 7.0E-07
sp|Q8GAK6|XDH_ARTNI D-xylose dehydrogenase OS=Arthrobacter nicotinovorans GN=xdh PE=1 SV=1 36 156 8.0E-07
sp|A7ZAH5|IOLG_BACMF Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=iolG PE=3 SV=1 6 196 2.0E-06
sp|P09400|STRI_STRGR Streptomycin biosynthesis protein StrI OS=Streptomyces griseus GN=strI PE=3 SV=1 6 264 2.0E-06
sp|C0ZWI9|IOLG_RHOE4 Inositol 2-dehydrogenase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=iolG PE=3 SV=1 64 148 2.0E-06
sp|A4FID1|IOLG2_SACEN Inositol 2-dehydrogenase 2 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=iolG2 PE=3 SV=1 6 154 2.0E-06
sp|Q9KAH1|IOLG_BACHD Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=iolG PE=3 SV=1 53 147 4.0E-06
sp|Q3UHD2|GFOD1_MOUSE Glucose-fructose oxidoreductase domain-containing protein 1 OS=Mus musculus GN=Gfod1 PE=1 SV=1 8 264 5.0E-06
sp|Q5WKY6|IOLG_BACSK Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase OS=Bacillus clausii (strain KSM-K16) GN=iolG PE=3 SV=1 53 147 6.0E-06
sp|Q9SZ83|Y4967_ARATH Uncharacterized oxidoreductase At4g09670 OS=Arabidopsis thaliana GN=At4g09670 PE=1 SV=1 25 112 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050661 NADP binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0050662 coenzyme binding No
GO:0008152 metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1832
MAGKVFNVGVVGYGLSAKVFHIPFIAVTPQLRLHGIVQRTPKQGNSAPQEHPEAKHYSDVEALLADPEVDVVIVT
TPPNNHFALTKAALEAGKHVLTEKPFVPTSAEADQLIAVARQKKRLICVYQNRRWDSDFLTVKHLLAKQALGRIV
EFNTHFDRFRATAPSTWKGELDISAGGSALFDLGTHLIDQVYVLFGMPRAVHGRLLSQRSGKLDLVNPDGVSAEL
TYPDGMLVYVRISVLSAETAQQRFWIRGSRGSFHKVGLDPQEDQLKAGGKPTDQGFGREDAGCMRLVLVSDDGAI
RQDKVPELEPETYRAFYAAFGKAVESGREEDVPVKAGEAKDVLRILEAIMESAKSGKDVHFG*
Coding >Hirsu2|1832
ATGGCGGGCAAGGTGTTCAACGTCGGCGTTGTCGGCTACGGGCTATCTGCCAAGGTCTTCCACATCCCCTTCATC
GCGGTGACGCCGCAGCTCAGGCTGCATGGCATAGTCCAGCGAACGCCCAAGCAAGGCAACTCGGCGCCTCAAGAG
CATCCCGAGGCCAAGCATTATAGCGACGTCGAGGCGCTGCTCGCCGATCCCGAGGTCGACGTCGTCATCGTGACA
ACACCCCCCAACAACCACTTCGCGCTCACCAAGGCCGCGCTCGAAGCGGGCAAACATGTGCTGACGGAGAAGCCG
TTCGTGCCGACCTCGGCCGAGGCGGACCAACTGATTGCTGTTGCCCGACAGAAGAAGCGCCTCATATGCGTCTAT
CAGAATCGGCGCTGGGACTCGGACTTTTTGACCGTCAAGCATTTGCTCGCCAAGCAAGCCTTGGGCCGCATCGTC
GAGTTCAACACGCACTTCGACCGCTTCCGCGCCACGGCCCCCTCCACATGGAAGGGCGAGCTGGACATTTCGGCC
GGCGGCAGCGCTCTCTTTGACTTGGGAACCCATCTCATCGACCAGGTTTACGTGCTCTTCGGTATGCCGCGAGCC
GTTCATGGACGACTCCTCTCGCAACGGTCCGGCAAACTGGATCTCGTGAACCCCGACGGCGTCTCGGCGGAGCTG
ACATACCCCGACGGCATGCTCGTATATGTGCGAATCAGCGTCCTCAGCGCAGAGACAGCCCAGCAGCGTTTTTGG
ATCCGCGGGTCGAGGGGAAGCTTCCACAAGGTCGGCCTCGACCCCCAGGAAGACCAGCTCAAGGCTGGCGGCAAG
CCAACGGACCAGGGCTTCGGCAGGGAGGACGCCGGATGCATGCGCCTGGTGCTGGTAAGCGACGACGGCGCCATA
AGGCAGGACAAGGTGCCGGAACTGGAGCCGGAGACGTACAGGGCTTTCTACGCTGCCTTTGGCAAGGCTGTCGAG
AGCGGCAGAGAGGAGGATGTACCGGTCAAAGCGGGCGAGGCCAAGGACGTGCTGCGAATTCTCGAGGCCATCATG
GAGAGCGCCAAATCTGGCAAGGACGTCCACTTCGGCTGA
Transcript >Hirsu2|1832
ATGGCGGGCAAGGTGTTCAACGTCGGCGTTGTCGGCTACGGGCTATCTGCCAAGGTCTTCCACATCCCCTTCATC
GCGGTGACGCCGCAGCTCAGGCTGCATGGCATAGTCCAGCGAACGCCCAAGCAAGGCAACTCGGCGCCTCAAGAG
CATCCCGAGGCCAAGCATTATAGCGACGTCGAGGCGCTGCTCGCCGATCCCGAGGTCGACGTCGTCATCGTGACA
ACACCCCCCAACAACCACTTCGCGCTCACCAAGGCCGCGCTCGAAGCGGGCAAACATGTGCTGACGGAGAAGCCG
TTCGTGCCGACCTCGGCCGAGGCGGACCAACTGATTGCTGTTGCCCGACAGAAGAAGCGCCTCATATGCGTCTAT
CAGAATCGGCGCTGGGACTCGGACTTTTTGACCGTCAAGCATTTGCTCGCCAAGCAAGCCTTGGGCCGCATCGTC
GAGTTCAACACGCACTTCGACCGCTTCCGCGCCACGGCCCCCTCCACATGGAAGGGCGAGCTGGACATTTCGGCC
GGCGGCAGCGCTCTCTTTGACTTGGGAACCCATCTCATCGACCAGGTTTACGTGCTCTTCGGTATGCCGCGAGCC
GTTCATGGACGACTCCTCTCGCAACGGTCCGGCAAACTGGATCTCGTGAACCCCGACGGCGTCTCGGCGGAGCTG
ACATACCCCGACGGCATGCTCGTATATGTGCGAATCAGCGTCCTCAGCGCAGAGACAGCCCAGCAGCGTTTTTGG
ATCCGCGGGTCGAGGGGAAGCTTCCACAAGGTCGGCCTCGACCCCCAGGAAGACCAGCTCAAGGCTGGCGGCAAG
CCAACGGACCAGGGCTTCGGCAGGGAGGACGCCGGATGCATGCGCCTGGTGCTGGTAAGCGACGACGGCGCCATA
AGGCAGGACAAGGTGCCGGAACTGGAGCCGGAGACGTACAGGGCTTTCTACGCTGCCTTTGGCAAGGCTGTCGAG
AGCGGCAGAGAGGAGGATGTACCGGTCAAAGCGGGCGAGGCCAAGGACGTGCTGCGAATTCTCGAGGCCATCATG
GAGAGCGCCAAATCTGGCAAGGACGTCCACTTCGGCTGA
Gene >Hirsu2|1832
ATGGCGGGCAAGGTGTTCAACGTCGGCGTTGTCGGCTACGGGTAGGTCGCGGCGACAGACCCCTCCTTTCCCCTC
TCTCGCCATGGCCGGCTGCTACGCGACGCTGGCCGTGACGATGTCGTTGACGCCGTGTCGCCCAGGCTATCTGCC
AAGGTCTTCCACATCCCCTTCATCGCGGTGACGCCGCAGCTCAGGCTGCATGGCATAGTCCAGCGAACGCCCAAG
CAAGGCAACTCGGCGCCTCAAGAGCATCCCGAGGCCAAGCATTATAGCGACGTCGAGGCGCTGCTCGCCGATCCC
GAGGTCGACGTCGTCATCGTGACAACACCCCCCAACAACCACTTCGCGCTCACCAAGGCCGCGCTCGAAGCGGGC
AAACATGTGCTGACGGAGAAGCCGTTCGTGCCGACCTCGGCCGAGGCGGACCAACTGATTGCTGTTGCCCGACAG
AAGAAGCGCCTCATATGCGTCTATCAGAATCGGCGCTGGGACTCGGACTTTTTGACCGTCAAGCATTTGCTCGCC
AAGCAAGCCTTGGGCCGCATCGTCGAGTTCAACACGCACTTCGACCGCTTCCGCGCCACGGCCCCCTCCACATGG
AAGGGCGAGCTGGACATTTCGGCCGGCGGCAGCGCTCTCTTTGACTTGGGAACCCATCTCATCGACCAGGTTTAC
GTGCTCTTCGGTATGCCGCGAGCCGTTCATGGACGACTCCTCTCGCAACGGTCCGGCAAACTGGATCTCGTGAAC
CCCGACGGCGTCTCGGCGGAGCTGACATACCCCGACGGCATGCTCGTATATGTGCGAATCAGCGTCCTCAGCGCA
GAGACAGCCCAGCAGCGTTTTTGGATCCGCGGGTCGAGGGGAAGCTTCCACAAGGTCGGCCTCGACCCCCAGGAA
GACCAGCTCAAGGCTGGCGGCAAGCCAACGGACCAGGGCTTCGGCAGGGAGGACGCCGGATGCATGCGCCTGGTG
CTGGTAAGCGACGACGGCGCCATAAGGCAGGACAAGGTGCCGGAACTGGAGCCGGAGACGTACAGGGCTTTCTAC
GCTGCCTTTGGCAAGGCTGTCGAGAGCGGCAGAGAGGAGGATGTACCGGTCAAAGCGGGCGAGGCCAAGGACGTG
CTGCGAATTCTCGAGGCCATCATGGAGAGCGCCAAATCTGGCAAGGACGTCCACTTCGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail