Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|183
Gene name
LocationContig_103:21442..23324
Strand+
Gene length (bp)1882
Transcript length (bp)1824
Coding sequence length (bp)1824
Protein length (aa) 608

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 2.1E-61 120 569
PF00324 AA_permease Amino acid permease 4.0E-28 128 449

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BGK6|YLAT2_MOUSE Y+L amino acid transporter 2 OS=Mus musculus GN=Slc7a6 PE=1 SV=1 112 581 5.0E-84
sp|Q59I64|YLAT2_DANRE Y+L amino acid transporter 2 OS=Danio rerio GN=slc7a6 PE=2 SV=1 113 593 8.0E-83
sp|Q92536|YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens GN=SLC7A6 PE=1 SV=3 112 581 1.0E-82
sp|Q28I80|YLAT2_XENTR Y+L amino acid transporter 2 OS=Xenopus tropicalis GN=slc7a6 PE=2 SV=1 101 584 4.0E-81
sp|Q9R0S5|YLAT1_RAT Y+L amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a7 PE=1 SV=1 102 585 2.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BGK6|YLAT2_MOUSE Y+L amino acid transporter 2 OS=Mus musculus GN=Slc7a6 PE=1 SV=1 112 581 5.0E-84
sp|Q59I64|YLAT2_DANRE Y+L amino acid transporter 2 OS=Danio rerio GN=slc7a6 PE=2 SV=1 113 593 8.0E-83
sp|Q92536|YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens GN=SLC7A6 PE=1 SV=3 112 581 1.0E-82
sp|Q28I80|YLAT2_XENTR Y+L amino acid transporter 2 OS=Xenopus tropicalis GN=slc7a6 PE=2 SV=1 101 584 4.0E-81
sp|Q9R0S5|YLAT1_RAT Y+L amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a7 PE=1 SV=1 102 585 2.0E-80
sp|Q9UM01|YLAT1_HUMAN Y+L amino acid transporter 1 OS=Homo sapiens GN=SLC7A7 PE=1 SV=2 105 585 2.0E-79
sp|Q9Z1K8|YLAT1_MOUSE Y+L amino acid transporter 1 OS=Mus musculus GN=Slc7a7 PE=1 SV=1 105 585 3.0E-79
sp|A1L3M3|YLAT2_XENLA Y+L amino acid transporter 2 OS=Xenopus laevis GN=slc7a6 PE=2 SV=1 112 593 1.0E-78
sp|P82251|BAT1_HUMAN b(0,+)-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A9 PE=1 SV=1 116 592 2.0E-78
sp|Q9QXA6|BAT1_MOUSE b(0,+)-type amino acid transporter 1 OS=Mus musculus GN=Slc7a9 PE=1 SV=1 108 581 1.0E-77
sp|Q9N1R6|BAT1_RABIT b(0,+)-type amino acid transporter 1 OS=Oryctolagus cuniculus GN=SLC7A9 PE=1 SV=1 112 592 4.0E-77
sp|Q9WTR6|XCT_MOUSE Cystine/glutamate transporter OS=Mus musculus GN=Slc7a11 PE=1 SV=1 84 592 1.0E-74
sp|Q5RAE3|LAT2_PONAB Large neutral amino acids transporter small subunit 2 OS=Pongo abelii GN=SLC7A8 PE=2 SV=2 98 581 3.0E-74
sp|Q9UHI5|LAT2_HUMAN Large neutral amino acids transporter small subunit 2 OS=Homo sapiens GN=SLC7A8 PE=1 SV=1 98 581 4.0E-74
sp|P82252|BAT1_RAT b(0,+)-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a9 PE=1 SV=1 112 595 8.0E-74
sp|Q01650|LAT1_HUMAN Large neutral amino acids transporter small subunit 1 OS=Homo sapiens GN=SLC7A5 PE=1 SV=2 102 589 4.0E-72
sp|Q9N1Q4|LAT2_RABIT Large neutral amino acids transporter small subunit 2 OS=Oryctolagus cuniculus GN=SLC7A8 PE=1 SV=1 104 581 2.0E-71
sp|Q9QXW9|LAT2_MOUSE Large neutral amino acids transporter small subunit 2 OS=Mus musculus GN=Slc7a8 PE=1 SV=1 109 581 3.0E-71
sp|Q9WVR6|LAT2_RAT Large neutral amino acids transporter small subunit 2 OS=Rattus norvegicus GN=Slc7a8 PE=1 SV=1 109 581 7.0E-71
sp|Q7YQK4|LAT1_RABIT Large neutral amino acids transporter small subunit 1 OS=Oryctolagus cuniculus GN=SLC7A5 PE=1 SV=1 116 589 3.0E-69
sp|Q9Z127|LAT1_MOUSE Large neutral amino acids transporter small subunit 1 OS=Mus musculus GN=Slc7a5 PE=1 SV=2 116 589 4.0E-69
sp|Q63016|LAT1_RAT Large neutral amino acids transporter small subunit 1 OS=Rattus norvegicus GN=Slc7a5 PE=1 SV=2 116 589 4.0E-69
sp|Q9UPY5|XCT_HUMAN Cystine/glutamate transporter OS=Homo sapiens GN=SLC7A11 PE=1 SV=1 84 584 3.0E-67
sp|Q5RAG7|XCT_PONAB Cystine/glutamate transporter OS=Pongo abelii GN=SLC7A11 PE=2 SV=1 84 584 4.0E-67
sp|P63116|AAA1_RAT Asc-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a10 PE=2 SV=1 140 602 1.0E-56
sp|P63115|AAA1_MOUSE Asc-type amino acid transporter 1 OS=Mus musculus GN=Slc7a10 PE=1 SV=1 140 602 1.0E-56
sp|Q9NS82|AAA1_HUMAN Asc-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A10 PE=2 SV=1 89 599 2.0E-52
sp|Q5RKI7|S7A13_RAT Solute carrier family 7 member 13 OS=Rattus norvegicus GN=Slc7a13 PE=2 SV=1 116 547 1.0E-38
sp|Q91WN3|S7A13_MOUSE Solute carrier family 7 member 13 OS=Mus musculus GN=Slc7a13 PE=1 SV=1 109 564 1.0E-36
sp|Q8TCU3|S7A13_HUMAN Solute carrier family 7 member 13 OS=Homo sapiens GN=SLC7A13 PE=2 SV=1 108 545 1.0E-33
sp|P50276|MUP1_YEAST High-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP1 PE=1 SV=1 114 438 6.0E-32
sp|O34739|STET_BACSU Serine/threonine exchanger SteT OS=Bacillus subtilis (strain 168) GN=steT PE=1 SV=1 116 596 2.0E-30
sp|Q8MH63|LAT1N_HUMAN Putative L-type amino acid transporter 1-like protein MLAS OS=Homo sapiens GN=SLC7A5P1 PE=5 SV=1 116 229 7.0E-21
sp|P38734|MUP3_YEAST Low-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP3 PE=1 SV=1 127 585 4.0E-19
sp|Q9GIP4|LAT1L_HUMAN Putative L-type amino acid transporter 1-like protein IMAA OS=Homo sapiens GN=SLC7A5P2 PE=5 SV=2 119 232 2.0E-17
sp|Q8X845|FRLA_ECO57 Putative fructoselysine transporter FrlA OS=Escherichia coli O157:H7 GN=frlA PE=3 SV=2 111 588 6.0E-16
sp|P45539|FRLA_ECOLI Putative fructoselysine transporter FrlA OS=Escherichia coli (strain K12) GN=frlA PE=3 SV=2 111 588 7.0E-15
sp|P60066|ADIC_SALTY Arginine/agmatine antiporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=adiC PE=1 SV=1 127 449 3.0E-14
sp|P60065|ADIC_SALTI Arginine/agmatine antiporter OS=Salmonella typhi GN=adiC PE=3 SV=1 127 449 3.0E-14
sp|O34560|YECA_BACSU Uncharacterized amino acid permease YecA OS=Bacillus subtilis (strain 168) GN=yecA PE=3 SV=2 114 447 5.0E-14
sp|Q797A7|YFNA_BACSU Uncharacterized amino acid permease YfnA OS=Bacillus subtilis (strain 168) GN=yfnA PE=3 SV=1 117 592 2.0E-13
sp|P60064|ADIC_SHIFL Arginine/agmatine antiporter OS=Shigella flexneri GN=adiC PE=3 SV=1 127 449 3.0E-13
sp|P60061|ADIC_ECOLI Arginine/agmatine antiporter OS=Escherichia coli (strain K12) GN=adiC PE=1 SV=1 127 449 3.0E-13
sp|P60062|ADIC_ECOL6 Arginine/agmatine antiporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=adiC PE=3 SV=1 127 449 3.0E-13
sp|P60063|ADIC_ECO57 Arginine/agmatine antiporter OS=Escherichia coli O157:H7 GN=adiC PE=1 SV=1 127 449 3.0E-13
sp|Q8ZGS9|ADIC_YERPE Arginine/agmatine antiporter OS=Yersinia pestis GN=adiC PE=3 SV=1 127 448 1.0E-10
sp|Q84MA5|CAAT1_ARATH Cationic amino acid transporter 1 OS=Arabidopsis thaliana GN=CAT1 PE=1 SV=1 109 394 2.0E-10
sp|Q6DCE8|CTR2_XENLA Cationic amino acid transporter 2 OS=Xenopus laevis GN=slc7a2 PE=2 SV=1 109 446 5.0E-10
sp|Q9LZ20|CAAT6_ARATH Cationic amino acid transporter 6, chloroplastic OS=Arabidopsis thaliana GN=CAT6 PE=2 SV=1 114 560 6.0E-10
sp|Q47689|MMUP_ECOLI Probable S-methylmethionine permease OS=Escherichia coli (strain K12) GN=mmuP PE=3 SV=2 116 448 1.0E-09
sp|Q45577|YBEC_BACSU Probable amino acid-proton symporter YbeC OS=Bacillus subtilis (strain 168) GN=ybeC PE=3 SV=3 114 588 5.0E-09
sp|Q9SQZ0|CAAT7_ARATH Cationic amino acid transporter 7, chloroplastic OS=Arabidopsis thaliana GN=CAT7 PE=3 SV=1 151 444 6.0E-09
sp|Q8W4K3|CAAT4_ARATH Cationic amino acid transporter 4, vacuolar OS=Arabidopsis thaliana GN=CAT4 PE=2 SV=1 111 444 9.0E-09
sp|P44768|POTE_HAEIN Putrescine-ornithine antiporter OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potE PE=3 SV=1 132 444 3.0E-08
sp|O34618|YTNA_BACSU Uncharacterized amino acid permease YtnA OS=Bacillus subtilis (strain 168) GN=ytnA PE=3 SV=1 108 448 3.0E-08
sp|Q9ASS7|CAAT2_ARATH Cationic amino acid transporter 2, vacuolar OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=1 117 444 3.0E-07
sp|P0AAE0|CYCA_ECOLI D-serine/D-alanine/glycine transporter OS=Escherichia coli (strain K12) GN=cycA PE=1 SV=1 246 592 3.0E-07
sp|P0AAE1|CYCA_ECO57 D-serine/D-alanine/glycine transporter OS=Escherichia coli O157:H7 GN=cycA PE=3 SV=1 246 592 3.0E-07
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 101 448 4.0E-07
sp|Q46065|AROP_CORGL Aromatic amino acid transport protein AroP OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aroP PE=3 SV=1 107 447 1.0E-06
sp|O64759|CAAT5_ARATH Cationic amino acid transporter 5 OS=Arabidopsis thaliana GN=CAT5 PE=1 SV=1 114 444 1.0E-06
sp|P06775|HIP1_YEAST Histidine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIP1 PE=1 SV=2 52 449 1.0E-06
sp|Q8BLQ7|CTR4_MOUSE Cationic amino acid transporter 4 OS=Mus musculus GN=Slc7a4 PE=1 SV=1 108 444 2.0E-06
sp|Q46170|ARCD_CLOPE Arginine/ornithine antiporter OS=Clostridium perfringens (strain 13 / Type A) GN=arcD PE=3 SV=2 114 452 2.0E-06
sp|O07002|ASPP_BACSU Aspartate-proton symporter OS=Bacillus subtilis (strain 168) GN=yveA PE=1 SV=1 116 466 4.0E-06
sp|P0AAF1|POTE_ECOLI Putrescine-ornithine antiporter OS=Escherichia coli (strain K12) GN=potE PE=1 SV=1 132 444 4.0E-06
sp|P0AAF2|POTE_ECOL6 Putrescine-ornithine antiporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=potE PE=3 SV=1 132 444 4.0E-06
sp|P24207|PHEP_ECOLI Phenylalanine-specific permease OS=Escherichia coli (strain K12) GN=pheP PE=1 SV=1 108 448 4.0E-06
sp|Q58026|Y609_METJA Uncharacterized protein MJ0609 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0609 PE=1 SV=1 115 443 8.0E-06
sp|Q7VEQ4|ANSP1_MYCBO L-asparagine permease 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP1 PE=3 SV=1 145 452 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 119 138 19
2 148 170 22
3 198 220 22
4 240 259 19
5 272 294 22
6 309 331 22
7 354 376 22
8 396 418 22
9 475 494 19
10 504 526 22
11 539 561 22
12 565 584 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|183
MPSHAGAHPQARDSLELASLASSSLVDDGVISQASSRPSVSSSRRLSFIEEDPLDDENPARRAGMHHRSYSVSSA
FDFAGSMFPLSSTTGTGGYAPIGAPTSAPGGGLGRGSLEKHKTLTYLNGLSLIVGLIIGSGIFSSPSQVSSKVGS
AGAALVVWVVAGFLAWTGAASYAELGGAIPLNGGSQVYLAKTFGEMAGFLFTWVAVLVLKPGSAAIIAIIMGEYF
VRAIIGTEVETADPWLNKSVALAGIALVTLLNCVSTRVGTRVNDLLMFLKFVALLGVTVTGIVVAITGYTLKGDK
DNVWNAHDWFNGTSTDLSNWAVALYAGLWAFDGWDNTNYVVGEFRNPSRDLPRVIHTAMPLVILSYVLANVAYFL
VLPVEVVNGSNTVAVMFGSRVLGRVGAILVALTVSASCFGALNSSSFTAGRLVYVAGKEGYIPGVFGRIGASGED
HGPATQPRRDWCSRKLRGCFGDDDVGLFYTPIYALVLNGVLTAGYCVVGEFATLLTFYGVAGYTFYFVTVLGLIV
LRVKEPQLERPYKTWIVTPIVFCCVSLFLLSKAVFAQPLQTLTVVAFVITGIPVYFWRIRGRDRVSKRESSAGEG
RWWRFWK*
Coding >Hirsu2|183
ATGCCTTCCCACGCCGGCGCGCACCCGCAGGCGCGAGACTCGCTGGAGCTCGCGTCGCTGGCGAGCTCGAGCCTG
GTCGACGACGGCGTGATATCCCAGGCGTCGTCGCGGCCGAGCGTCTCGTCCTCGCGCAGGCTGTCCTTCATCGAG
GAGGACCCCCTGGACGACGAGAACCCGGCACGGAGGGCAGGCATGCACCACCGGTCGTATTCCGTCTCGTCGGCC
TTCGACTTTGCCGGCAGCATGTTCCCCTTGAGCTCTACGACCGGCACCGGGGGCTATGCGCCCATCGGCGCGCCC
ACGTCTGCGCCCGGCGGCGGCCTGGGCCGAGGCTCGCTGGAGAAGCACAAGACGTTGACGTACCTCAACGGGCTG
TCGCTCATCGTCGGCCTCATCATCGGCTCCGGCATCTTCTCCTCGCCCAGCCAGGTCAGCTCCAAGGTCGGCTCC
GCCGGCGCCGCCCTGGTCGTCTGGGTCGTCGCCGGCTTTCTGGCCTGGACGGGCGCCGCCTCGTACGCCGAGCTT
GGCGGCGCCATCCCCCTCAACGGCGGCTCGCAGGTCTACCTGGCCAAGACCTTTGGCGAGATGGCCGGCTTTCTC
TTCACCTGGGTCGCGGTCCTGGTCCTCAAGCCGGGCAGCGCCGCCATCATCGCCATCATCATGGGTGAATACTTT
GTGCGGGCCATCATCGGGACCGAGGTCGAGACGGCCGATCCGTGGCTCAACAAGTCGGTCGCCCTTGCCGGGATC
GCCCTGGTGACGCTGCTGAACTGCGTCTCCACGCGCGTCGGCACGCGAGTCAACGACCTGCTCATGTTTCTCAAG
TTCGTCGCCCTGCTGGGCGTCACGGTCACGGGCATCGTCGTGGCCATCACCGGCTACACCTTGAAGGGCGACAAG
GACAATGTGTGGAATGCGCACGACTGGTTCAACGGGACGTCGACGGACCTGTCGAACTGGGCCGTCGCCCTGTAT
GCCGGTCTGTGGGCCTTTGACGGATGGGACAACACCAACTACGTGGTGGGCGAGTTTCGCAACCCGAGCCGGGAC
CTGCCGCGGGTCATCCATACGGCCATGCCGCTCGTCATCCTCAGTTACGTCCTCGCCAACGTGGCCTATTTCCTC
GTGCTCCCGGTGGAAGTCGTCAACGGGTCCAACACGGTGGCCGTCATGTTCGGGTCCAGGGTCCTGGGCCGCGTG
GGCGCCATCCTCGTGGCGCTGACGGTCAGCGCCAGCTGCTTCGGCGCCCTCAACTCGTCGAGCTTCACGGCCGGT
CGGCTGGTTTACGTGGCGGGCAAGGAGGGCTACATCCCGGGCGTCTTCGGCCGCATCGGCGCGTCGGGCGAGGAC
CACGGCCCGGCGACGCAGCCGAGGCGCGACTGGTGCTCGCGGAAGCTGCGCGGCTGCTTCGGGGACGACGACGTG
GGCCTCTTCTACACGCCCATCTACGCCCTGGTCCTCAACGGAGTGCTCACGGCCGGCTACTGCGTCGTGGGCGAG
TTCGCGACGCTGCTCACCTTCTACGGCGTGGCCGGCTACACCTTCTACTTCGTGACGGTGCTGGGGCTCATCGTG
CTGCGCGTCAAGGAGCCGCAGCTGGAGCGGCCGTACAAGACGTGGATAGTGACACCCATCGTCTTCTGCTGCGTC
AGCCTCTTCCTGCTCAGCAAGGCCGTGTTCGCGCAGCCGCTGCAGACGCTGACGGTCGTGGCGTTTGTCATTACG
GGCATCCCCGTCTACTTTTGGCGCATACGCGGGAGGGATCGGGTGTCGAAGAGGGAATCGAGCGCGGGCGAGGGG
CGGTGGTGGCGTTTCTGGAAATGA
Transcript >Hirsu2|183
ATGCCTTCCCACGCCGGCGCGCACCCGCAGGCGCGAGACTCGCTGGAGCTCGCGTCGCTGGCGAGCTCGAGCCTG
GTCGACGACGGCGTGATATCCCAGGCGTCGTCGCGGCCGAGCGTCTCGTCCTCGCGCAGGCTGTCCTTCATCGAG
GAGGACCCCCTGGACGACGAGAACCCGGCACGGAGGGCAGGCATGCACCACCGGTCGTATTCCGTCTCGTCGGCC
TTCGACTTTGCCGGCAGCATGTTCCCCTTGAGCTCTACGACCGGCACCGGGGGCTATGCGCCCATCGGCGCGCCC
ACGTCTGCGCCCGGCGGCGGCCTGGGCCGAGGCTCGCTGGAGAAGCACAAGACGTTGACGTACCTCAACGGGCTG
TCGCTCATCGTCGGCCTCATCATCGGCTCCGGCATCTTCTCCTCGCCCAGCCAGGTCAGCTCCAAGGTCGGCTCC
GCCGGCGCCGCCCTGGTCGTCTGGGTCGTCGCCGGCTTTCTGGCCTGGACGGGCGCCGCCTCGTACGCCGAGCTT
GGCGGCGCCATCCCCCTCAACGGCGGCTCGCAGGTCTACCTGGCCAAGACCTTTGGCGAGATGGCCGGCTTTCTC
TTCACCTGGGTCGCGGTCCTGGTCCTCAAGCCGGGCAGCGCCGCCATCATCGCCATCATCATGGGTGAATACTTT
GTGCGGGCCATCATCGGGACCGAGGTCGAGACGGCCGATCCGTGGCTCAACAAGTCGGTCGCCCTTGCCGGGATC
GCCCTGGTGACGCTGCTGAACTGCGTCTCCACGCGCGTCGGCACGCGAGTCAACGACCTGCTCATGTTTCTCAAG
TTCGTCGCCCTGCTGGGCGTCACGGTCACGGGCATCGTCGTGGCCATCACCGGCTACACCTTGAAGGGCGACAAG
GACAATGTGTGGAATGCGCACGACTGGTTCAACGGGACGTCGACGGACCTGTCGAACTGGGCCGTCGCCCTGTAT
GCCGGTCTGTGGGCCTTTGACGGATGGGACAACACCAACTACGTGGTGGGCGAGTTTCGCAACCCGAGCCGGGAC
CTGCCGCGGGTCATCCATACGGCCATGCCGCTCGTCATCCTCAGTTACGTCCTCGCCAACGTGGCCTATTTCCTC
GTGCTCCCGGTGGAAGTCGTCAACGGGTCCAACACGGTGGCCGTCATGTTCGGGTCCAGGGTCCTGGGCCGCGTG
GGCGCCATCCTCGTGGCGCTGACGGTCAGCGCCAGCTGCTTCGGCGCCCTCAACTCGTCGAGCTTCACGGCCGGT
CGGCTGGTTTACGTGGCGGGCAAGGAGGGCTACATCCCGGGCGTCTTCGGCCGCATCGGCGCGTCGGGCGAGGAC
CACGGCCCGGCGACGCAGCCGAGGCGCGACTGGTGCTCGCGGAAGCTGCGCGGCTGCTTCGGGGACGACGACGTG
GGCCTCTTCTACACGCCCATCTACGCCCTGGTCCTCAACGGAGTGCTCACGGCCGGCTACTGCGTCGTGGGCGAG
TTCGCGACGCTGCTCACCTTCTACGGCGTGGCCGGCTACACCTTCTACTTCGTGACGGTGCTGGGGCTCATCGTG
CTGCGCGTCAAGGAGCCGCAGCTGGAGCGGCCGTACAAGACGTGGATAGTGACACCCATCGTCTTCTGCTGCGTC
AGCCTCTTCCTGCTCAGCAAGGCCGTGTTCGCGCAGCCGCTGCAGACGCTGACGGTCGTGGCGTTTGTCATTACG
GGCATCCCCGTCTACTTTTGGCGCATACGCGGGAGGGATCGGGTGTCGAAGAGGGAATCGAGCGCGGGCGAGGGG
CGGTGGTGGCGTTTCTGGAAATGA
Gene >Hirsu2|183
ATGCCTTCCCACGCCGGCGCGCACCCGCAGGCGCGAGACTCGCTGGAGCTCGCGTCGCTGGCGAGCTCGAGCCTG
GTCGACGACGGCGTGATATCCCAGGCGTCGTCGCGGCCGAGCGTCTCGTCCTCGCGCAGGCTGTCCTTCATCGAG
GAGGACCCCCTGGACGACGAGAACCCGGCACGGAGGGCAGGCATGCACCACCGGTCGTATTCCGTCTCGTCGGCC
TTCGACTTTGCCGGCAGCATGTTCCCCTTGAGCTCTACGACCGGCACCGGGGGCTATGCGCCCATCGGCGCGCCC
ACGTCTGCGCCCGGCGGCGGCCTGGGCCGAGGCTCGCTGGAGAAGCACAAGACGTTGACGTACCTCAACGGGCTG
TCGCTCATCGTCGGCCTCATCATCGGCTCCGGCATCTTCTCCTCGCCCAGCCAGGTCAGCTCCAAGGTCGGCTCC
GCCGGCGCCGCCCTGGTCGTCTGGGTCGTCGCCGGCTTTCTGGCCTGGACGGGCGCCGCCTCGTACGCCGAGCTT
GGCGGCGCCATCCCCCTCAACGGCGGCTCGCAGGTCTACCTGGCCAAGACCTTTGGCGAGATGGCCGGCTTTCTC
TTCACCTGGGTCGCGGTCCTGGTCCTCAAGCCGGGCAGCGCCGCCATCATCGCCATCATCATGGGTGAATACTTT
GTGCGGGCCATCATCGGGACCGAGGTCGAGACGGCCGATCCGTGGCTCAACAAGTCGGTCGCCCTTGCCGGGATC
GCCCTGGTGACGCTGCTGAACTGCGTCTCCACGCGCGTCGGCACGCGAGTCAACGACCTGCTCATGTTTCTCAAG
TTCGTCGCCCTGCTGGGCGTCACGGTCACGGGCATCGTCGTGGCCATCACCGGCTACACCTTGAAGGGCGACAAG
GACAATGTGTGGAATGCGCACGACTGGTTCAACGGGACGTCGACGGACCTGTCGAACTGGGCCGTCGCCCTGTAT
GCCGGTCTGTGGGCCTTTGACGGATGGGACAACGTGAGTTTCTCGACCGGGAGGGGGTGGGAGCCTGCTAACGAC
GTCTTGACGCGCGCAGACCAACTACGTGGTGGGCGAGTTTCGCAACCCGAGCCGGGACCTGCCGCGGGTCATCCA
TACGGCCATGCCGCTCGTCATCCTCAGTTACGTCCTCGCCAACGTGGCCTATTTCCTCGTGCTCCCGGTGGAAGT
CGTCAACGGGTCCAACACGGTGGCCGTCATGTTCGGGTCCAGGGTCCTGGGCCGCGTGGGCGCCATCCTCGTGGC
GCTGACGGTCAGCGCCAGCTGCTTCGGCGCCCTCAACTCGTCGAGCTTCACGGCCGGTCGGCTGGTTTACGTGGC
GGGCAAGGAGGGCTACATCCCGGGCGTCTTCGGCCGCATCGGCGCGTCGGGCGAGGACCACGGCCCGGCGACGCA
GCCGAGGCGCGACTGGTGCTCGCGGAAGCTGCGCGGCTGCTTCGGGGACGACGACGTGGGCCTCTTCTACACGCC
CATCTACGCCCTGGTCCTCAACGGAGTGCTCACGGCCGGCTACTGCGTCGTGGGCGAGTTCGCGACGCTGCTCAC
CTTCTACGGCGTGGCCGGCTACACCTTCTACTTCGTGACGGTGCTGGGGCTCATCGTGCTGCGCGTCAAGGAGCC
GCAGCTGGAGCGGCCGTACAAGACGTGGATAGTGACACCCATCGTCTTCTGCTGCGTCAGCCTCTTCCTGCTCAG
CAAGGCCGTGTTCGCGCAGCCGCTGCAGACGCTGACGGTCGTGGCGTTTGTCATTACGGGCATCCCCGTCTACTT
TTGGCGCATACGCGGGAGGGATCGGGTGTCGAAGAGGGAATCGAGCGCGGGCGAGGGGCGGTGGTGGCGTTTCTG
GAAATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail