Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1826
Gene name
LocationContig_1411:1717..2941
Strand-
Gene length (bp)1224
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6FNP6|YNF8_CANGA Vacuolar membrane protein CAGL0J10076g OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0J10076g PE=3 SV=1 152 272 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 10 27 17
2 171 193 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1826
MRPPSSLPPSALLLSTLASVAILSLPVMAQRVGNQPQLPAVSQSPAGLPAPSPTPASPQQASNPPSRPSSNGQRP
PSSDRQQPSPPSEASDPPTPTPVTPTPTPTPARATPSDDKANPTITGPSSVSSGSELGAFPTLTRTNAIPQYPEP
SVPPTQDAPFMQHSNLPDGTVFIVVGAVLGALGLSILLWRGIVSLLLHRSVKRAAMAQHTTNPKAGFPAPPAPFY
KYTDQESSMSLGAGAAGAVPGRGVRRTNRGPIPSATPSHSNLFFSPTAVPNAAGARNSAFLPSGFYAAGAGSPAV
NPANAISLHNLRPDSRGHYANASRHTLAGSPPDSPHYPARRDPSAMSTSSLHLNMPPGQQRAPSAYLEDLLADDP
GAFPPQHMPPTSNGPSSTASLAGRADSLPHRI*
Coding >Hirsu2|1826
ATGCGGCCGCCCAGCTCGTTGCCGCCCTCGGCTCTGCTGCTCTCGACTCTGGCCTCGGTCGCCATCTTGTCCCTC
CCCGTCATGGCTCAGAGAGTCGGCAACCAGCCTCAGCTCCCGGCCGTCAGCCAAAGCCCCGCCGGCTTGCCCGCC
CCGTCGCCTACTCCCGCGAGCCCGCAACAAGCGTCGAATCCGCCGTCCCGTCCGAGCAGCAACGGCCAGAGACCG
CCCAGCTCGGACCGGCAGCAGCCCTCGCCGCCGTCCGAGGCCTCGGACCCTCCGACGCCGACGCCCGTCACGCCG
ACGCCGACGCCGACGCCCGCCCGCGCCACGCCCAGCGACGACAAGGCGAACCCTACAATTACCGGCCCCAGCTCG
GTCAGCTCCGGCAGCGAACTCGGCGCCTTCCCGACCCTGACGAGGACCAACGCGATCCCCCAGTATCCCGAACCC
AGCGTCCCGCCCACCCAGGACGCCCCCTTTATGCAGCACTCCAATCTGCCCGACGGCACCGTCTTTATCGTCGTC
GGCGCCGTCCTCGGCGCCCTGGGACTCTCCATCCTGCTCTGGCGCGGCATCGTCAGCCTTCTCCTCCATCGGTCC
GTCAAACGCGCGGCCATGGCCCAACATACCACCAACCCCAAGGCCGGCTTCCCGGCGCCGCCCGCGCCCTTCTAC
AAGTACACCGACCAGGAATCCAGCATGTCGCTGGGCGCCGGCGCCGCCGGCGCCGTCCCCGGCCGCGGCGTTCGA
CGCACCAACCGGGGGCCCATTCCTTCCGCCACCCCGAGCCACTCCAACCTCTTCTTCTCGCCCACGGCCGTCCCC
AACGCCGCCGGCGCCCGCAACTCGGCCTTCCTGCCCTCGGGCTTCTACGCCGCCGGCGCCGGCTCGCCCGCCGTC
AACCCCGCCAACGCCATCAGCCTGCACAACCTGCGCCCGGATTCCAGGGGCCACTACGCCAATGCGTCCCGCCAC
ACGCTGGCGGGCTCGCCGCCCGACTCGCCCCATTATCCGGCGCGCCGGGACCCCAGCGCCATGAGCACCAGCTCT
CTGCACCTCAACATGCCGCCCGGCCAACAACGAGCACCTAGTGCGTACCTCGAAGACCTCCTGGCCGACGACCCG
GGCGCCTTCCCGCCGCAGCACATGCCGCCCACGTCCAACGGCCCGAGCAGCACGGCGAGCCTCGCGGGCAGGGCC
GACAGCCTGCCCCACCGGATTTGA
Transcript >Hirsu2|1826
ATGCGGCCGCCCAGCTCGTTGCCGCCCTCGGCTCTGCTGCTCTCGACTCTGGCCTCGGTCGCCATCTTGTCCCTC
CCCGTCATGGCTCAGAGAGTCGGCAACCAGCCTCAGCTCCCGGCCGTCAGCCAAAGCCCCGCCGGCTTGCCCGCC
CCGTCGCCTACTCCCGCGAGCCCGCAACAAGCGTCGAATCCGCCGTCCCGTCCGAGCAGCAACGGCCAGAGACCG
CCCAGCTCGGACCGGCAGCAGCCCTCGCCGCCGTCCGAGGCCTCGGACCCTCCGACGCCGACGCCCGTCACGCCG
ACGCCGACGCCGACGCCCGCCCGCGCCACGCCCAGCGACGACAAGGCGAACCCTACAATTACCGGCCCCAGCTCG
GTCAGCTCCGGCAGCGAACTCGGCGCCTTCCCGACCCTGACGAGGACCAACGCGATCCCCCAGTATCCCGAACCC
AGCGTCCCGCCCACCCAGGACGCCCCCTTTATGCAGCACTCCAATCTGCCCGACGGCACCGTCTTTATCGTCGTC
GGCGCCGTCCTCGGCGCCCTGGGACTCTCCATCCTGCTCTGGCGCGGCATCGTCAGCCTTCTCCTCCATCGGTCC
GTCAAACGCGCGGCCATGGCCCAACATACCACCAACCCCAAGGCCGGCTTCCCGGCGCCGCCCGCGCCCTTCTAC
AAGTACACCGACCAGGAATCCAGCATGTCGCTGGGCGCCGGCGCCGCCGGCGCCGTCCCCGGCCGCGGCGTTCGA
CGCACCAACCGGGGGCCCATTCCTTCCGCCACCCCGAGCCACTCCAACCTCTTCTTCTCGCCCACGGCCGTCCCC
AACGCCGCCGGCGCCCGCAACTCGGCCTTCCTGCCCTCGGGCTTCTACGCCGCCGGCGCCGGCTCGCCCGCCGTC
AACCCCGCCAACGCCATCAGCCTGCACAACCTGCGCCCGGATTCCAGGGGCCACTACGCCAATGCGTCCCGCCAC
ACGCTGGCGGGCTCGCCGCCCGACTCGCCCCATTATCCGGCGCGCCGGGACCCCAGCGCCATGAGCACCAGCTCT
CTGCACCTCAACATGCCGCCCGGCCAACAACGAGCACCTAGTGCGTACCTCGAAGACCTCCTGGCCGACGACCCG
GGCGCCTTCCCGCCGCAGCACATGCCGCCCACGTCCAACGGCCCGAGCAGCACGGCGAGCCTCGCGGGCAGGGCC
GACAGCCTGCCCCACCGGATTTGA
Gene >Hirsu2|1826
ATGCGGCCGCCCAGCTCGTTGCCGCCCTCGGCTCTGCTGCTCTCGACTCTGGCCTCGGTCGCCATCTTGTCCCTC
CCCGTCATGGCTCAGAGAGTCGGCAACCAGCCTCAGCTCCCGGCCGTCAGCCAAAGCCCCGCCGGCTTGCCCGCC
CCGTCGCCTACTCCCGCGAGCCCGCAACAAGCGTCGAATCCGCCGTCCCGTCCGAGCAGCAACGGCCAGAGACCG
CCCAGCTCGGACCGGCAGCAGCCCTCGCCGCCGTCCGAGGCCTCGGACCCTCCGACGCCGACGCCCGTCACGCCG
ACGCCGACGCCGACGCCCGCCCGCGCCACGCCCAGCGACGACAAGGCGAACCCTACAATTACCGGCCCCAGCTCG
GTCAGCTCCGGCAGCGAACTCGGCGCCTTCCCGACCCTGACGAGGACCAACGCGATCCCCCAGTATCCCGAACCC
AGCGTCCCGCCCACCCAGGACGCCCCCTTTATGCAGCACTCCAATCTGCCCGACGGCACCGTCTTTATCGTCGTC
GGCGCCGTCCTCGGCGCCCTGGGACTCTCCATCCTGCTCTGGCGCGGCATCGTCAGCCTTCTCCTCCATCGGTCC
GTCAAACGCGCGGCCATGGCCCAACATACCACCAACCCCAAGGCCGGCTTCCCGGCGCCGCCCGCGCCCTTCTAC
AAGTACACCGACCAGGAATCCAGCATGTCGCTGGGCGCCGGCGCCGCCGGCGCCGTCCCCGGCCGCGGCGTTCGA
CGCACCAACCGGGGGCCCATTCCTTCCGCCACCCCGAGCCACTCCAACCTCTTCTTCTCGCCCACGGCCGTCCCC
AACGCCGCCGGCGCCCGCAACTCGGCCTTCCTGCCCTCGGGCTTCTACGCCGCCGGCGCCGGCTCGCCCGCCGTC
AACCCCGCCAACGCCATCAGCCTGCACAACCTGCGCCCGGATTCCAGGGGCCACTACGCCAATGCGTCCCGCCAC
ACGCTGGCGGGCTCGCCGCCCGACTCGCCCCATTATCCGGCGCGCCGGGACCCCAGCGCCATGAGCACCAGCTCT
CTGCACCTCAACATGCCGCCCGGCCAACAACGAGCACCTAGTGCGTACCTCGAAGACCTCCTGGCCGACGACCCG
GGCGCCTTCCCGCCGCAGCACATGCCGCCCACGTCCAACGGCCCGAGCAGCACGGCGAGCCTCGCGGGCAGGGCC
GACAGCCTGCCCCACCGGATTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail