Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1821
Gene name
LocationContig_141:31472..32923
Strand-
Gene length (bp)1451
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02797 Chal_sti_synt_C Chalcone and stilbene synthases, C-terminal domain 8.5E-20 241 384
PF00195 Chal_sti_synt_N Chalcone and stilbene synthases, N-terminal domain 6.5E-18 71 219

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22927|CHSG_PETHY Chalcone synthase G OS=Petunia hybrida GN=CHSG PE=2 SV=2 71 383 2.0E-31
sp|P51069|THS3_ARAHY Stilbene synthase 3 OS=Arachis hypogaea PE=2 SV=1 75 384 2.0E-31
sp|P20077|THS2_ARAHY Putative stilbene synthase 2 (Fragment) OS=Arachis hypogaea PE=5 SV=1 75 384 3.0E-30
sp|P48391|2PS_GERHY 2-pyrone synthase OS=Gerbera hybrida GN=2PS PE=1 SV=2 13 384 5.0E-30
sp|Q8H4L3|CHS2_ORYSJ Chalcone synthase 2 OS=Oryza sativa subsp. japonica GN=CHS2 PE=3 SV=1 36 383 8.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22927|CHSG_PETHY Chalcone synthase G OS=Petunia hybrida GN=CHSG PE=2 SV=2 71 383 2.0E-31
sp|P51069|THS3_ARAHY Stilbene synthase 3 OS=Arachis hypogaea PE=2 SV=1 75 384 2.0E-31
sp|P20077|THS2_ARAHY Putative stilbene synthase 2 (Fragment) OS=Arachis hypogaea PE=5 SV=1 75 384 3.0E-30
sp|P48391|2PS_GERHY 2-pyrone synthase OS=Gerbera hybrida GN=2PS PE=1 SV=2 13 384 5.0E-30
sp|Q8H4L3|CHS2_ORYSJ Chalcone synthase 2 OS=Oryza sativa subsp. japonica GN=CHS2 PE=3 SV=1 36 383 8.0E-30
sp|P48398|CHSB_IPOPU Chalcone synthase B OS=Ipomoea purpurea GN=CHSB PE=3 SV=1 83 384 1.0E-29
sp|Q9SBL7|CHS2_SORBI Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=3 SV=1 64 383 2.0E-29
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 14 384 2.0E-29
sp|Q9SBL5|CHS4_SORBI Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=3 SV=1 64 383 3.0E-29
sp|L7NCQ3|TBSYN_GARMA 2,4,6-trihydroxybenzophenone synthase OS=Garcinia mangostana GN=BPS PE=1 SV=1 84 384 3.0E-29
sp|Q9SBL3|CHS6_SORBI Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=3 SV=1 64 383 5.0E-29
sp|P48397|CHSA_IPOPU Chalcone synthase A OS=Ipomoea purpurea GN=CHSA PE=3 SV=2 83 384 5.0E-29
sp|Q9SBL4|CHS5_SORBI Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=3 SV=1 64 383 5.0E-29
sp|P30080|CHS6_SOYBN Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV=1 93 384 6.0E-29
sp|P30075|CHS4_MEDSA Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=2 SV=2 71 384 7.0E-29
sp|P23569|CHSY_PUEML Chalcone synthase OS=Pueraria montana var. lobata GN=CHS PE=2 SV=1 93 384 8.0E-29
sp|F1LKH9|PKSG5_CANSA Polyketide synthase 5 OS=Cannabis sativa GN=PKSG5 PE=2 SV=1 84 384 9.0E-29
sp|O22586|CHSY_ONOVI Chalcone synthase OS=Onobrychis viciifolia GN=CHS PE=2 SV=1 71 388 1.0E-28
sp|P20178|THS1_ARAHY Stilbene synthase 1 OS=Arachis hypogaea PE=2 SV=1 75 384 1.0E-28
sp|Q9SBL6|CHS3_SORBI Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=3 SV=1 64 383 1.0E-28
sp|Q2R3A1|CHS1_ORYSJ Chalcone synthase 1 OS=Oryza sativa subsp. japonica GN=CHS1 PE=2 SV=1 77 383 1.0E-28
sp|Q01286|CHS1_PEA Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 SV=1 93 383 1.0E-28
sp|A2ZEX7|CHS1_ORYSI Chalcone synthase 1 OS=Oryza sativa subsp. indica GN=CHS1 PE=2 SV=1 77 383 1.0E-28
sp|P13416|CHS1_SINAL Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 SV=1 77 383 2.0E-28
sp|F1LKH7|PKSG2_CANSA Polyketide synthase 2 OS=Cannabis sativa GN=PKSG2 PE=2 SV=1 84 384 2.0E-28
sp|O22652|CHSY_RAPSA Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 SV=1 93 383 2.0E-28
sp|Q9XGX2|CHS1_SORBI Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=3 SV=1 64 383 3.0E-28
sp|F1LKH8|PKSG4_CANSA Polyketide synthase 4 OS=Cannabis sativa GN=PKSG4 PE=2 SV=1 84 384 3.0E-28
sp|Q9XJ58|CHS1_CITSI Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=2 SV=1 91 383 3.0E-28
sp|P13114|CHSY_ARATH Chalcone synthase OS=Arabidopsis thaliana GN=CHS PE=1 SV=1 77 383 3.0E-28
sp|P17818|CHSY_MATIN Chalcone synthase OS=Matthiola incana GN=CHS PE=2 SV=1 93 384 3.0E-28
sp|Q01287|CHS2_PEA Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 SV=1 93 384 3.0E-28
sp|P30076|CHS8_MEDSA Chalcone synthase 8 OS=Medicago sativa GN=CHS8 PE=2 SV=1 71 384 3.0E-28
sp|P48406|CHS5_SOYBN Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV=1 77 384 3.0E-28
sp|P24826|CHS1_SOYBN Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV=1 93 384 4.0E-28
sp|P48388|CHS3_CAMSI Chalcone synthase 3 OS=Camellia sinensis GN=CHS3 PE=2 SV=1 67 383 4.0E-28
sp|P19168|CHS3_SOYBN Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV=1 93 384 4.0E-28
sp|Q9XGX1|CHS7_SORBI Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=3 SV=1 64 383 5.0E-28
sp|P51078|CHS5_MEDSA Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2 PE=2 SV=1 71 384 6.0E-28
sp|C6KI62|CHSL1_CANSA Chalcone synthase-like protein 1 OS=Cannabis sativa GN=CAN383 PE=2 SV=1 13 384 6.0E-28
sp|Q58VP7|PCS_ALOAR 5,7-dihydroxy-2-methylchromone synthase OS=Aloe arborescens PE=1 SV=1 13 384 6.0E-28
sp|Q9ZRS4|CHSY_CATRO Chalcone synthase OS=Catharanthus roseus GN=CHS PE=2 SV=1 77 383 7.0E-28
sp|O81305|PKSC_ARATH Type III polyketide synthase C OS=Arabidopsis thaliana GN=At4g00040 PE=2 SV=1 13 384 7.0E-28
sp|P13417|CHS3_SINAL Chalcone synthase 3 OS=Sinapis alba GN=CHS3 PE=2 SV=1 93 383 9.0E-28
sp|Q9SLX9|VPS_PSINU Phloroisovalerophenone synthase OS=Psilotum nudum GN=VPS PE=2 SV=1 77 384 9.0E-28
sp|Q27Z07|BIPS1_SORAU 3,5-dihydroxybiphenyl synthase OS=Sorbus aucuparia GN=BIS1 PE=1 SV=1 11 384 1.0E-27
sp|F1LKH6|PKSG1_CANSA Polyketide synthase 1 OS=Cannabis sativa GN=PKSG1 PE=2 SV=1 84 384 1.0E-27
sp|F1LKH5|PKSF3_CANSA Polyketide synthase 3 OS=Cannabis sativa GN=PKSF3 PE=2 SV=1 84 384 1.0E-27
sp|Q96562|CHS2_HORVU Chalcone synthase 2 OS=Hordeum vulgare GN=CHS2 PE=2 SV=1 78 383 2.0E-27
sp|P51083|CHS1_TRISU Chalcone synthase 1 OS=Trifolium subterraneum GN=CHS1 PE=3 SV=1 71 383 2.0E-27
sp|P30074|CHS2_MEDSA Chalcone synthase 2 OS=Medicago sativa GN=CHS2 PE=1 SV=1 71 384 2.0E-27
sp|Q43163|CHSB_SOLTU Chalcone synthase 1B OS=Solanum tuberosum GN=CHS1B PE=2 SV=1 93 383 2.0E-27
sp|P53415|CHS2_SECCE Chalcone synthase 2 OS=Secale cereale GN=CHS2 PE=2 SV=1 77 383 2.0E-27
sp|Q9SEP2|CHSY_CARAN Chalcone synthase OS=Cardamine amara GN=CHS PE=3 SV=1 93 383 2.0E-27
sp|Q9SML4|CHS1_CICAR Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=2 SV=1 71 383 2.0E-27
sp|O23884|CHS5_PEA Chalcone synthase 5 OS=Pisum sativum GN=CHS5 PE=3 SV=1 71 383 2.0E-27
sp|C0SVZ6|CURS1_CURLO Curcumin synthase 1 OS=Curcuma longa GN=CURS1 PE=1 SV=1 83 384 2.0E-27
sp|O23882|CHS4_PEA Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 SV=1 71 383 2.0E-27
sp|P53414|CHS1_SECCE Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3 SV=1 77 383 2.0E-27
sp|P22925|CHSD_PETHY Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=3 SV=2 71 383 2.0E-27
sp|Q41436|CHSA_SOLTU Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A PE=2 SV=1 93 383 2.0E-27
sp|P30081|CHS7_SOYBN Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV=1 93 383 3.0E-27
sp|Q9FSC1|ACS4_RUTGR Probable acridone synthase 4 OS=Ruta graveolens GN=ACS4 PE=2 SV=1 93 384 3.0E-27
sp|Q9SEP4|CHSY_ARAAL Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=1 77 383 3.0E-27
sp|P22928|CHSJ_PETHY Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=2 SV=2 71 383 3.0E-27
sp|Q9FUB7|CHSY_HYPAN Chalcone synthase OS=Hypericum androsaemum PE=1 SV=1 93 383 3.0E-27
sp|Q9FSC2|ACS3_RUTGR Probable acridone synthase 3 OS=Ruta graveolens GN=ACS3 PE=2 SV=1 93 384 3.0E-27
sp|Q01288|CHS6_PEA Chalcone synthase 6 OS=Pisum sativum GN=CHS6 PE=2 SV=1 93 383 3.0E-27
sp|P51079|CHS6_MEDSA Chalcone synthase 6-4 (Fragment) OS=Medicago sativa GN=CHS6-4 PE=2 SV=1 93 384 4.0E-27
sp|O23883|CHS3_PEA Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 SV=1 71 383 4.0E-27
sp|B1Q2B6|OLIS_CANSA 3,5,7-trioxododecanoyl-CoA synthase OS=Cannabis sativa GN=OLS PE=1 SV=1 84 384 4.0E-27
sp|P48386|CHS1_CAMSI Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 PE=2 SV=1 67 383 4.0E-27
sp|Q8SAS8|TBSYN_HYPAN 2,4,6-trihydroxybenzophenone synthase OS=Hypericum androsaemum GN=BPS PE=1 SV=1 84 384 5.0E-27
sp|O23731|CHS8_BROFI Chalcone synthase 8 OS=Bromheadia finlaysoniana GN=CHS8 PE=2 SV=1 77 384 5.0E-27
sp|C4NF91|PKS5_ALOAR Octaketide synthase 3 OS=Aloe arborescens GN=PKS5 PE=1 SV=1 13 384 5.0E-27
sp|Q8LDM2|PKSB_ARATH Type III polyketide synthase B OS=Arabidopsis thaliana GN=PKSB PE=1 SV=1 13 387 5.0E-27
sp|P48401|CHSA_IPOTF Chalcone synthase A (Fragment) OS=Ipomoea trifida GN=CHSA PE=3 SV=1 57 352 5.0E-27
sp|P24825|CHS2_MAIZE Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1 77 383 6.0E-27
sp|O23729|CHS3_BROFI Chalcone synthase 3 OS=Bromheadia finlaysoniana GN=CHS3 PE=2 SV=1 77 384 6.0E-27
sp|Q9M5M0|CHS7_PICMA Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 SV=1 71 384 6.0E-27
sp|D2DRC4|BIPS2_SORAU 4-hydroxycoumarin synthase 1 OS=Sorbus aucuparia GN=BIS2 PE=1 SV=1 11 387 6.0E-27
sp|P26018|CHS1_HORVU Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=3 SV=1 93 383 7.0E-27
sp|Q9FSB8|CHS2_RUTGR Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=2 SV=1 77 384 7.0E-27
sp|P51081|CHSA_PEA Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE=3 SV=1 93 383 9.0E-27
sp|P30073|CHS1_MEDSA Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=2 SV=1 67 383 1.0E-26
sp|P48403|CHSA_IPOTR Chalcone synthase A (Fragment) OS=Ipomoea triloba GN=CHSA PE=3 SV=1 61 352 1.0E-26
sp|P48394|CHSB_IPOCO Chalcone synthase B (Fragment) OS=Ipomoea cordatotriloba GN=CHSB PE=3 SV=1 11 352 1.0E-26
sp|D2DRC5|BIPS3_SORAU 4-hydroxycoumarin synthase 2 OS=Sorbus aucuparia GN=BIS3 PE=1 SV=1 11 384 1.0E-26
sp|O23730|CHS4_BROFI Chalcone synthase 4 OS=Bromheadia finlaysoniana GN=CHS4 PE=2 SV=1 77 384 1.0E-26
sp|P51087|CHS5_TRISU Chalcone synthase 5 OS=Trifolium subterraneum GN=CHS5 PE=2 SV=1 71 383 1.0E-26
sp|O22046|CHSE_IPONI Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV=1 93 383 1.0E-26
sp|O22047|CHSE_IPOPU Chalcone synthase E OS=Ipomoea purpurea GN=CHSE PE=2 SV=1 93 383 2.0E-26
sp|P51084|CHS2_TRISU Chalcone synthase 2 OS=Trifolium subterraneum GN=CHS2 PE=3 SV=1 71 383 2.0E-26
sp|P51077|CHS3_MEDSA Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1 PE=2 SV=1 71 383 2.0E-26
sp|P51085|CHS3_TRISU Chalcone synthase 3 OS=Trifolium subterraneum GN=CHS3 PE=2 SV=1 93 383 2.0E-26
sp|P51088|CHS6_TRISU Chalcone synthase 6 OS=Trifolium subterraneum GN=CHS6 PE=2 SV=1 93 383 2.0E-26
sp|P53416|BBS_PHASS Bibenzyl synthase OS=Phalaenopsis sp. GN=BIBSY212 PE=2 SV=1 13 384 2.0E-26
sp|P30077|CHS9_MEDSA Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=2 SV=1 71 383 2.0E-26
sp|P51075|CHSY_BETPN Chalcone synthase OS=Betula pendula GN=CHS PE=2 SV=2 84 383 2.0E-26
sp|P17957|CHS2_SOYBN Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV=1 77 384 2.0E-26
sp|Q3L7F5|OKS_ALOAR Octaketide synthase 1 OS=Aloe arborescens PE=1 SV=1 13 383 2.0E-26
sp|Q9ZS40|CHS2_DAUCA Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 SV=1 93 383 2.0E-26
sp|P49440|CHSY_PHAVU Chalcone synthase 17 OS=Phaseolus vulgaris GN=CHS17 PE=2 SV=1 93 383 2.0E-26
sp|P16107|CHSY_PETCR Chalcone synthase OS=Petroselinum crispum GN=CHS PE=3 SV=1 93 383 3.0E-26
sp|Q9FSB9|CHS1_RUTGR Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=2 SV=1 77 384 3.0E-26
sp|P48407|DPS1_PINST Pinosylvin synthase 1 OS=Pinus strobus GN=STS1 PE=1 SV=1 13 384 3.0E-26
sp|P48392|CHS3_GERHY Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=2 SV=1 93 383 3.0E-26
sp|Q9ZRR8|CHS1_CASGL Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2 SV=1 93 383 3.0E-26
sp|P06515|CHSY_ANTMA Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3 SV=1 93 383 4.0E-26
sp|P23419|CHS2_SOLLC Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS2 PE=2 SV=2 71 383 4.0E-26
sp|O22045|CHSD_IPONI Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV=1 93 384 4.0E-26
sp|C4NF90|PKS4_ALOAR Octaketide synthase 2 OS=Aloe arborescens GN=PKS4 PE=1 SV=1 13 383 4.0E-26
sp|P48402|CHSB_IPOTF Chalcone synthase B (Fragment) OS=Ipomoea trifida GN=CHSB PE=3 SV=1 57 352 4.0E-26
sp|Q9XJ57|CHS2_CITSI Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=2 SV=1 93 383 4.0E-26
sp|O65872|CHSY_PINST Chalcone synthase OS=Pinus strobus GN=CHS PE=2 SV=1 93 384 5.0E-26
sp|A5C9M2|THS5_VITVI Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT00007357001 PE=3 SV=1 77 384 6.0E-26
sp|P48396|CHSB_IPONI Chalcone synthase B (Fragment) OS=Ipomoea nil GN=CHSB PE=3 SV=1 74 352 7.0E-26
sp|C6L7V9|CURS3_CURLO Curcumin synthase 3 OS=Curcuma longa GN=CURS3 PE=1 SV=1 77 384 8.0E-26
sp|P48408|DPS2_PINST Pinosylvin synthase 2 OS=Pinus strobus GN=STS2 PE=1 SV=1 13 384 8.0E-26
sp|P30079|CHSY_PINSY Chalcone synthase OS=Pinus sylvestris GN=CHS PE=3 SV=1 71 384 8.0E-26
sp|P48385|CHSY_CALCH Chalcone synthase OS=Callistephus chinensis GN=CHS PE=2 SV=2 64 383 9.0E-26
sp|P08894|CHSA_PETHY Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=2 SV=1 93 383 9.0E-26
sp|P51080|CHS7_MEDSA Chalcone synthase (Fragment) OS=Medicago sativa GN=CHSII PE=2 SV=1 112 384 1.0E-25
sp|P28343|THS1_VITVI Stilbene synthase 1 OS=Vitis vinifera GN=VINST1 PE=1 SV=2 77 383 1.0E-25
sp|A2ICC6|THS7_VITVI Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 SV=1 77 383 1.0E-25
sp|Q9FSC0|ACS2_RUTGR Acridone synthase 2 OS=Ruta graveolens GN=ACS2 PE=1 SV=1 97 384 1.0E-25
sp|O82144|CHSY_HYDMC Chalcone synthase OS=Hydrangea macrophylla GN=CHS PE=2 SV=1 93 383 2.0E-25
sp|Q43188|CHS2_SOLTU Chalcone synthase 2 OS=Solanum tuberosum GN=CHS2 PE=2 SV=1 71 383 2.0E-25
sp|P23418|CHS1_SOLLC Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS1 PE=2 SV=2 99 383 2.0E-25
sp|O04111|CHSY_PERFR Chalcone synthase OS=Perilla frutescens GN=CHS PE=2 SV=1 93 383 2.0E-25
sp|Q8RVK9|CHS_CANSA Naringenin-chalcone synthase OS=Cannabis sativa GN=CHS PE=1 SV=1 93 383 3.0E-25
sp|P51070|THS2_VITVI Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT00004047001 PE=2 SV=2 77 384 3.0E-25
sp|P51082|CHSB_PEA Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE=3 SV=1 71 383 5.0E-25
sp|P48390|CHS1_GERHY Chalcone synthase 1 OS=Gerbera hybrida GN=CHS1 PE=2 SV=1 93 383 5.0E-25
sp|A5AEM3|THS4_VITVI Stilbene synthase 4 OS=Vitis vinifera GN=GSVIVT00005194001 PE=3 SV=1 77 384 5.0E-25
sp|P48400|CHSA_IPOPL Chalcone synthase A (Fragment) OS=Ipomoea platensis GN=CHSA PE=2 SV=1 78 352 6.0E-25
sp|C4MBZ5|PKS3_ALOAR Aloesone synthase OS=Aloe arborescens GN=PKS3 PE=1 SV=1 13 384 6.0E-25
sp|Q9AU11|PKS1_RUBID Polyketide synthase 1 OS=Rubus idaeus GN=PKS1 PE=1 SV=1 93 383 7.0E-25
sp|P48404|CHSB_IPOTR Chalcone synthase B (Fragment) OS=Ipomoea triloba GN=CHSB PE=3 SV=1 74 352 7.0E-25
sp|Q9MB41|CHS2_IPOBA Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF2 PE=2 SV=1 93 384 7.0E-25
sp|P22926|CHSF_PETHY Chalcone synthase F OS=Petunia hybrida GN=CHSF PE=2 SV=2 71 384 8.0E-25
sp|Q02323|DPSS_PINSY Pinosylvin synthase OS=Pinus sylvestris PE=1 SV=1 13 384 8.0E-25
sp|P48387|CHS2_CAMSI Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 PE=2 SV=1 93 383 1.0E-24
sp|Q9AU09|PKS3_RUBID Polyketide synthase 3 OS=Rubus idaeus GN=PKS3 PE=1 SV=1 93 383 1.0E-24
sp|P51071|THS3_VITVI Stilbene synthase 3 OS=Vitis vinifera GN=VIT_16s0100g01030 PE=2 SV=2 77 384 1.0E-24
sp|B0LDU6|PKS5_RUBID Polyketide synthase 5 OS=Rubus idaeus GN=PKS5 PE=1 SV=1 93 383 1.0E-24
sp|Q9AU10|PKS2_RUBID Inactive polyketide synthase 2 OS=Rubus idaeus GN=PKS2 PE=3 SV=1 93 383 1.0E-24
sp|Q9MB38|CHS6_IPOBA Chalcone synthase DII OS=Ipomoea batatas GN=CHS-DII PE=2 SV=1 93 387 2.0E-24
sp|Q9MB36|CHS8_IPOBA Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DIV PE=2 SV=1 93 384 2.0E-24
sp|Q9MB39|CHS4_IPOBA Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF4 PE=2 SV=1 93 384 2.0E-24
sp|P51090|CHSY_VITVI Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV=1 93 389 2.0E-24
sp|Q9MB33|CHS1_IPOBA Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF1 PE=2 SV=1 93 384 2.0E-24
sp|P22924|CHSB_PETHY Chalcone synthase B OS=Petunia hybrida GN=CHSB PE=2 SV=1 77 384 2.0E-24
sp|P48393|CHSA_IPOCO Chalcone synthase A (Fragment) OS=Ipomoea cordatotriloba GN=CHSA PE=3 SV=1 57 352 4.0E-24
sp|Q9LKP7|CHSY_DIAMO Chalcone synthase OS=Dianthus monspessulanus GN=CHS PE=2 SV=1 93 383 4.0E-24
sp|Q9MB40|CHS3_IPOBA Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF3 PE=2 SV=1 93 384 5.0E-24
sp|Q9MB37|CHS7_IPOBA Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-DIII PE=2 SV=1 93 384 5.0E-24
sp|Q9MBB1|CHSY_EQUAR Chalcone synthase OS=Equisetum arvense GN=CHS PE=2 SV=1 93 384 9.0E-24
sp|Q9FSB7|CHS3_RUTGR Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=2 SV=1 77 384 1.0E-23
sp|C6L7V8|CURS2_CURLO Curcumin synthase 2 OS=Curcuma longa GN=CURS2 PE=1 SV=1 77 384 2.0E-23
sp|P48399|CHSC_IPOPU Chalcone synthase C (Fragment) OS=Ipomoea purpurea GN=CHSC PE=3 SV=1 5 343 4.0E-23
sp|C0SVZ5|DCS_CURLO Phenylpropanoylacetyl-CoA synthase OS=Curcuma longa GN=DCS PE=1 SV=1 84 383 6.0E-23
sp|P51089|CHSY_VIGUN Chalcone synthase OS=Vigna unguiculata GN=CHS PE=2 SV=1 93 384 1.0E-22
sp|P48389|CHSY_DIACA Chalcone synthase OS=Dianthus caryophyllus GN=CHS PE=2 SV=1 93 383 1.0E-22
sp|Q9ZS41|CHS1_DAUCA Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 SV=1 74 383 2.0E-22
sp|O04220|CHSY_CHRAE Chalcone synthase OS=Chrysosplenium americanum GN=CHS PE=2 SV=1 77 383 2.0E-22
sp|Q94FV7|BAS_RHEPA Polyketide synthase BAS OS=Rheum palmatum GN=BAS PE=1 SV=1 71 384 2.0E-22
sp|Q9SB26|CHS9_DAUCA Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 SV=1 74 383 6.0E-22
sp|O80400|VPS_HUMLU Phloroisovalerophenone synthase OS=Humulus lupulus GN=VPS PE=2 SV=1 71 384 6.0E-22
sp|P48395|CHSA_IPONI Chalcone synthase A (Fragment) OS=Ipomoea nil GN=CHSA PE=3 SV=1 84 340 1.0E-21
sp|P24824|CHS1_MAIZE Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV=1 77 383 3.0E-21
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 95 384 2.0E-20
sp|O23674|PKSA_ARATH Type III polyketide synthase A OS=Arabidopsis thaliana GN=PKSA PE=1 SV=1 13 384 3.0E-20
sp|P9WPF1|PKS18_MYCTU Alpha-pyrone synthesis polyketide synthase-like Pks18 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks18 PE=1 SV=1 71 379 5.0E-20
sp|P9WPF0|PKS18_MYCTO Alpha-pyrone synthesis polyketide synthase-like Pks18 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks18 PE=3 SV=1 71 379 5.0E-20
sp|Q7U064|PKS18_MYCBO Alpha-pyrone synthesis polyketide synthase-like Pks18 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks18 PE=3 SV=1 71 379 5.0E-20
sp|B0LDU5|PKS4_RUBID Polyketide synthase 4 OS=Rubus idaeus GN=PKS4 PE=1 SV=1 71 352 9.0E-20
sp|Q8LIL0|CUS_ORYSJ Bisdemethoxycurcumin synthase OS=Oryza sativa subsp. japonica GN=Os07g0271500 PE=1 SV=2 110 383 6.0E-19
sp|Q9FCA7|RPPA_STRCO 1,3,6,8-tetrahydroxynaphthalene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO1206 PE=1 SV=1 34 382 2.0E-17
sp|P30078|CHSY_MALDO Chalcone synthase (Fragment) OS=Malus domestica GN=CHS PE=2 SV=1 146 384 2.0E-17
sp|P54157|BCSA_BACSU Putative chalcone synthase OS=Bacillus subtilis (strain 168) GN=bcsA PE=3 SV=1 14 388 6.0E-17
sp|P9WPF3|PKS11_MYCTU Alpha-pyrone synthesis polyketide synthase-like Pks11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks11 PE=1 SV=1 74 384 1.0E-14
sp|P9WPF2|PKS11_MYCTO Alpha-pyrone synthesis polyketide synthase-like Pks11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks11 PE=3 SV=1 74 384 1.0E-14
sp|Q7VEU7|PKS11_MYCBO Alpha-pyrone synthesis polyketide synthase-like Pks11 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks11 PE=3 SV=1 74 384 1.0E-14
sp|Q54240|RPPA_STRGR 1,3,6,8-tetrahydroxynaphthalene synthase OS=Streptomyces griseus GN=rppA PE=1 SV=2 34 382 2.0E-13
sp|P51086|CHS4_TRISU Chalcone synthase 4 (Fragment) OS=Trifolium subterraneum GN=CHS4 PE=2 SV=1 71 310 6.0E-13
sp|B0FYK7|RPPA_STRC0 1,3,6,8-tetrahydroxynaphthalene synthase OS=Streptomyces peucetius subsp. caesius GN=rppA PE=1 SV=1 79 384 6.0E-13
sp|P9WPF5|PKS10_MYCTU Polyketide synthase-like Pks10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks10 PE=1 SV=1 74 384 2.0E-09
sp|P9WPF4|PKS10_MYCTO Polyketide synthase-like Pks10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks10 PE=3 SV=1 74 384 2.0E-09
sp|Q7VEV2|PKS10_MYCBO Polyketide synthase-like Pks10 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks10 PE=3 SV=1 74 384 2.0E-09
sp|Q9ZU06|CHSY_PERAE Chalcone synthase OS=Persea americana GN=CHS PE=2 SV=1 100 383 2.0E-08
sp|P51076|CHSY_FRAAN Chalcone synthase RJ5 (Fragment) OS=Fragaria ananassa PE=2 SV=1 300 384 1.0E-07
sp|Q4V3C9|KCS8_ARATH 3-ketoacyl-CoA synthase 8 OS=Arabidopsis thaliana GN=KCS8 PE=2 SV=1 97 346 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1821
MAASKTFDNLHLSIIGLGTQYPAQSLGSDAIDILSRKHYPSSPTLDKVLSINRTTGIDARPSVWAADDALVSQQR
TPSISELHQTFLRDGVPLAVAAADKAVREAMIDISQITHIVSVTCTDSANPGFDHFVAKGLGITHPVEKVLLHGV
GCSGGLAALRTGANLALGCTALGRPARVLCLSLEITSVLVRSELDSINDGQEVRIGVCLFSDCASALVLSNGIGS
PQSRAVYDILGWDHSVVPGTEDDLGFDVDPSGWKVILTPRVPRLTKSVVSPTFERLKASLRQLPPGLELAGDFDW
AMHPGGATVLSGAEEALGISPEHMRASYDVYIRHGNSSSATIFSVLDRLRSREMDKLAPDGGRRQHIVGCAFGPG
VTVEMCMLRRNLGPEDGGAAGLETPPATASDDVADAALEPGRDDADKRPAVIVEALEQLELAG*
Coding >Hirsu2|1821
ATGGCAGCGTCGAAAACCTTTGACAACTTGCACCTCTCCATCATCGGGCTGGGCACACAGTACCCGGCCCAGTCG
CTCGGAAGCGATGCGATAGACATCCTGAGCAGAAAACACTACCCTAGCTCTCCTACCCTAGACAAGGTCCTCTCG
ATCAACAGAACCACCGGCATCGACGCTCGCCCATCCGTCTGGGCGGCCGACGACGCTCTGGTCAGCCAACAGCGG
ACCCCGTCCATATCGGAACTCCACCAGACGTTCCTTCGCGATGGCGTGCCGCTGGCGGTCGCCGCAGCAGACAAG
GCCGTCCGCGAAGCGATGATCGACATCAGCCAAATAACGCACATCGTCTCGGTAACATGCACCGATAGCGCCAAC
CCGGGATTCGACCATTTCGTCGCCAAAGGCTTGGGCATCACCCATCCGGTAGAGAAGGTCTTGCTTCACGGAGTA
GGCTGTAGCGGCGGCCTCGCCGCCCTTCGAACGGGCGCGAACCTCGCTCTCGGGTGCACGGCCTTGGGGCGGCCG
GCGAGAGTGCTGTGCCTGTCGTTGGAGATCACCTCGGTCTTGGTGAGGAGCGAGCTGGACAGCATCAACGACGGC
CAGGAGGTGAGAATAGGCGTCTGCTTGTTCTCCGACTGCGCAAGCGCCCTCGTACTCAGTAACGGCATCGGCTCG
CCGCAATCGAGAGCGGTATACGATATCCTGGGATGGGATCACTCCGTCGTTCCAGGGACCGAGGACGACCTCGGC
TTCGACGTTGATCCGTCAGGCTGGAAGGTCATCCTGACTCCGCGGGTCCCTCGGCTCACCAAATCGGTCGTCTCG
CCGACGTTCGAGCGTCTCAAGGCCTCGCTCCGCCAGCTGCCGCCCGGTCTCGAGCTCGCGGGCGACTTCGACTGG
GCGATGCACCCCGGAGGCGCCACCGTCCTCTCCGGCGCGGAGGAGGCGCTGGGAATCTCGCCCGAGCACATGCGC
GCGAGCTACGACGTCTACATCCGCCACGGCAACTCGAGCTCGGCCACCATCTTCAGCGTCCTCGACCGCCTGCGC
TCCCGGGAGATGGACAAGCTGGCTCCCGATGGCGGCAGGCGGCAGCACATCGTCGGCTGCGCATTCGGCCCCGGC
GTCACCGTCGAGATGTGCATGCTCAGGCGCAACCTCGGCCCCGAAGACGGCGGAGCCGCCGGCCTGGAAACGCCG
CCGGCCACGGCGAGTGACGACGTCGCCGACGCGGCCCTTGAGCCCGGACGTGACGATGCGGACAAGCGTCCTGCA
GTCATCGTCGAGGCACTTGAGCAGCTTGAGTTGGCGGGATAG
Transcript >Hirsu2|1821
ATGGCAGCGTCGAAAACCTTTGACAACTTGCACCTCTCCATCATCGGGCTGGGCACACAGTACCCGGCCCAGTCG
CTCGGAAGCGATGCGATAGACATCCTGAGCAGAAAACACTACCCTAGCTCTCCTACCCTAGACAAGGTCCTCTCG
ATCAACAGAACCACCGGCATCGACGCTCGCCCATCCGTCTGGGCGGCCGACGACGCTCTGGTCAGCCAACAGCGG
ACCCCGTCCATATCGGAACTCCACCAGACGTTCCTTCGCGATGGCGTGCCGCTGGCGGTCGCCGCAGCAGACAAG
GCCGTCCGCGAAGCGATGATCGACATCAGCCAAATAACGCACATCGTCTCGGTAACATGCACCGATAGCGCCAAC
CCGGGATTCGACCATTTCGTCGCCAAAGGCTTGGGCATCACCCATCCGGTAGAGAAGGTCTTGCTTCACGGAGTA
GGCTGTAGCGGCGGCCTCGCCGCCCTTCGAACGGGCGCGAACCTCGCTCTCGGGTGCACGGCCTTGGGGCGGCCG
GCGAGAGTGCTGTGCCTGTCGTTGGAGATCACCTCGGTCTTGGTGAGGAGCGAGCTGGACAGCATCAACGACGGC
CAGGAGGTGAGAATAGGCGTCTGCTTGTTCTCCGACTGCGCAAGCGCCCTCGTACTCAGTAACGGCATCGGCTCG
CCGCAATCGAGAGCGGTATACGATATCCTGGGATGGGATCACTCCGTCGTTCCAGGGACCGAGGACGACCTCGGC
TTCGACGTTGATCCGTCAGGCTGGAAGGTCATCCTGACTCCGCGGGTCCCTCGGCTCACCAAATCGGTCGTCTCG
CCGACGTTCGAGCGTCTCAAGGCCTCGCTCCGCCAGCTGCCGCCCGGTCTCGAGCTCGCGGGCGACTTCGACTGG
GCGATGCACCCCGGAGGCGCCACCGTCCTCTCCGGCGCGGAGGAGGCGCTGGGAATCTCGCCCGAGCACATGCGC
GCGAGCTACGACGTCTACATCCGCCACGGCAACTCGAGCTCGGCCACCATCTTCAGCGTCCTCGACCGCCTGCGC
TCCCGGGAGATGGACAAGCTGGCTCCCGATGGCGGCAGGCGGCAGCACATCGTCGGCTGCGCATTCGGCCCCGGC
GTCACCGTCGAGATGTGCATGCTCAGGCGCAACCTCGGCCCCGAAGACGGCGGAGCCGCCGGCCTGGAAACGCCG
CCGGCCACGGCGAGTGACGACGTCGCCGACGCGGCCCTTGAGCCCGGACGTGACGATGCGGACAAGCGTCCTGCA
GTCATCGTCGAGGCACTTGAGCAGCTTGAGTTGGCGGGATAG
Gene >Hirsu2|1821
ATGGCAGCGTCGAAAACCTTTGACAACTTGCACCTCTCCATCATCGGGCTGGGCACACAGTACCCGGCCCAGTCG
CTCGGAAGCGATGCGATAGACATCCTGAGCAGAAAACACTACCCTAGCTCTCCTACGTATGTATTCAAGTCTCCC
TGGAGTTGCAGAGGCCGACGACGGGCGGGCCCTGGCTCACATATACATGTACCCGGCAGCCTAGACAAGGTCCTC
TCGATCAACAGAACCACCGGCATCGACGCTCGCCCATCCGTCTGGGCGGCCGACGACGCTCTGGTCAGCCAACAG
CGGACCCCGTCCATATCGGAACTCCACCAGACGTTCCTTCGCGATGGCGTGCCGCTGGCGGTCGCCGCAGCAGAC
AAGGCCGTCCGCGAAGCGATGATCGACATCAGCCAAATAACGCACATCGTCTCGGTAACATGCACCGATAGCGCC
AACCCGGGATTCGACCATTTCGTCGCCAAAGGCTTGGGCATCACCCATCCGGTAGAGAAGGTCTTGCTTCACGGA
GTAGGCTGTAGCGGCGGCCTCGCCGCCCTTCGAACGGGCGCGAACCTCGCTCTCGGGTGCACGGCCTTGGGGCGG
CCGGCGAGAGTGCTGTGCCTGTCGTTGGAGATCACCTCGGTCTTGGTGAGGAGCGAGCTGGACAGCATCAACGAC
GGCCAGGAGGTGAGAATAGGCGTCTGCTTGTTCTCCGACTGCGCAAGCGCCCTCGTACTCAGTAACGGCATCGGC
TCGCCGCAATCGAGAGCGGTATACGATATCCTGGGATGGGATCACTCCGTCGTTCCAGGGACCGAGGACGACCTC
GGCTTCGACGTTGATCCGTCAGGTAAGACATGGACATGTCCGCCCTCGGGGAGCCGCTCGGGAACTCACTTGTGG
TAGGCTGGAAGGTCATCCTGACTCCGCGGGTCCCTCGGCTCACCAAATCGGTCGTCTCGCCGACGTTCGAGCGTC
TCAAGGCCTCGCTCCGCCAGCTGCCGCCCGGTCTCGAGCTCGCGGGCGACTTCGACTGGGCGATGCACCCCGGAG
GCGCCACCGTCCTCTCCGGCGCGGAGGAGGCGCTGGGAATCTCGCCCGAGCACATGCGCGCGAGCTACGACGTCT
ACATCCGCCACGGCAACTCGAGCTCGGCCACCATCTTCAGCGTCCTCGACCGCCTGCGCTCCCGGGAGATGGACA
AGCTGGCTCCCGATGGCGGCAGGCGGCAGCACATCGTCGGCTGCGCATTCGGCCCCGGCGTCACCGTCGAGATGT
GCATGCTCAGGCGCAACCTCGGCCCCGAAGACGGCGGAGCCGCCGGCCTGGAAACGCCGCCGGCCACGGCGAGTG
ACGACGTCGCCGACGCGGCCCTTGAGCCCGGACGTGACGATGCGGACAAGCGTCCTGCAGTCATCGTCGAGGCAC
TTGAGCAGCTTGAGTTGGCGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail