© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|1816 |
| Gene name | |
| Location | Contig_141:19884..20706 |
| Strand | + |
| Gene length (bp) | 822 |
| Transcript length (bp) | 822 |
| Coding sequence length (bp) | 822 |
| Protein length (aa) | 274 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF08241 | Methyltransf_11 | Methyltransferase domain | 5.6E-22 | 66 | 164 |
| PF13649 | Methyltransf_25 | Methyltransferase domain | 5.3E-20 | 65 | 160 |
| PF13489 | Methyltransf_23 | Methyltransferase domain | 2.7E-17 | 56 | 212 |
| PF02353 | CMAS | Mycolic acid cyclopropane synthetase | 2.9E-17 | 7 | 234 |
| PF13847 | Methyltransf_31 | Methyltransferase domain | 2.5E-15 | 62 | 171 |
| PF08242 | Methyltransf_12 | Methyltransferase domain | 3.5E-13 | 66 | 162 |
| PF01209 | Ubie_methyltran | ubiE/COQ5 methyltransferase family | 9.3E-13 | 57 | 166 |
| PF00891 | Methyltransf_2 | O-methyltransferase domain | 1.1E-05 | 58 | 209 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q8KZ94|REBMT_NOCAE | Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 | 4 | 272 | 5.0E-53 |
| sp|Q9ZSK1|GTOMC_ARATH | Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 | 9 | 260 | 3.0E-22 |
| sp|Q6ZIX2|SMT1_ORYSJ | Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 | 9 | 177 | 2.0E-20 |
| sp|L7IP31|ERG6_MAGOY | Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 | 13 | 173 | 7.0E-20 |
| sp|P0CT10|ERG6_MAGO7 | Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 | 13 | 173 | 7.0E-20 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q8KZ94|REBMT_NOCAE | Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 | 4 | 272 | 5.0E-53 |
| sp|Q9ZSK1|GTOMC_ARATH | Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 | 9 | 260 | 3.0E-22 |
| sp|Q6ZIX2|SMT1_ORYSJ | Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 | 9 | 177 | 2.0E-20 |
| sp|L7IP31|ERG6_MAGOY | Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 | 13 | 173 | 7.0E-20 |
| sp|P0CT10|ERG6_MAGO7 | Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 | 13 | 173 | 7.0E-20 |
| sp|Q6ZIK0|GTOMC_ORYSJ | Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 | 9 | 237 | 1.0E-19 |
| sp|Q9P3R1|ERG6_NEUCR | Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 | 13 | 240 | 1.0E-19 |
| sp|Q39227|SMT2_ARATH | 24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana GN=SMT2 PE=1 SV=2 | 6 | 171 | 5.0E-19 |
| sp|Q9LM02|SMT1_ARATH | Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 | 9 | 159 | 6.0E-19 |
| sp|Q9KJ20|GSDMT_ACTHA | Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 | 18 | 259 | 1.0E-18 |
| sp|O82427|SMT2_ORYSJ | 24-methylenesterol C-methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Smt2-1 PE=2 SV=2 | 6 | 163 | 1.0E-18 |
| sp|Q6C2D9|ERG6_YARLI | Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 | 13 | 174 | 2.0E-18 |
| sp|Q9KJ21|SDMT_HALHR | Sarcosine/dimethylglycine N-methyltransferase OS=Halorhodospira halochloris PE=1 SV=1 | 18 | 250 | 3.0E-18 |
| sp|Q94JS4|SMT3B_ARATH | 24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana GN=SMT3 PE=2 SV=1 | 6 | 171 | 1.0E-17 |
| sp|Q6FRZ7|ERG6_CANGA | Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 | 8 | 230 | 1.0E-17 |
| sp|P74388|BQMT_SYNY3 | 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0418 PE=1 SV=1 | 5 | 167 | 2.0E-17 |
| sp|Q9TYP1|STRM1_CAEEL | Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans GN=strm-1 PE=3 SV=2 | 13 | 167 | 1.0E-16 |
| sp|Q6BRB7|ERG6_DEBHA | Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 | 13 | 171 | 2.0E-16 |
| sp|Q759S7|ERG6_ASHGO | Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 | 11 | 171 | 5.0E-16 |
| sp|P25087|ERG6_YEAST | Sterol 24-C-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG6 PE=1 SV=4 | 8 | 230 | 6.0E-16 |
| sp|O14321|ERG6_SCHPO | Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 | 7 | 171 | 1.0E-15 |
| sp|O74198|ERG6_CANAL | Sterol 24-C-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG6 PE=3 SV=1 | 13 | 160 | 1.0E-15 |
| sp|Q67LE6|MENG_SYMTH | Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 | 59 | 163 | 2.0E-15 |
| sp|Q9M571|PEAMT_SPIOL | Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 | 48 | 166 | 2.0E-15 |
| sp|Q96WX4|ERG6_PNECA | Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 | 13 | 160 | 3.0E-15 |
| sp|H2E7T5|SQMT1_BOTBR | Squalene methyltransferase 1 OS=Botryococcus braunii GN=TMT-1 PE=1 SV=1 | 13 | 185 | 4.0E-15 |
| sp|Q875K1|ERG6_CLAL4 | Sterol 24-C-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=ERG6 PE=3 SV=1 | 13 | 169 | 4.0E-15 |
| sp|Q6CYB3|ERG6_KLULA | Sterol 24-C-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERG6 PE=3 SV=1 | 11 | 225 | 5.0E-15 |
| sp|Q944H0|PEAM2_ARATH | Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 | 48 | 166 | 7.0E-15 |
| sp|Q9C6B9|PEAM3_ARATH | Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 | 57 | 166 | 8.0E-15 |
| sp|Q9FR44|PEAM1_ARATH | Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 | 48 | 166 | 1.0E-14 |
| sp|B9LZA9|UBIE_GEODF | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=ubiE PE=3 SV=1 | 56 | 167 | 1.0E-14 |
| sp|A4F7P5|ERYG_SACEN | Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryG PE=1 SV=1 | 13 | 225 | 3.0E-14 |
| sp|Q54I98|SMT1_DICDI | Probable cycloartenol-C-24-methyltransferase 1 OS=Dictyostelium discoideum GN=smt1 PE=1 SV=1 | 9 | 173 | 3.0E-14 |
| sp|H2E7T9|SMTL2_BOTBR | Sterol methyltransferase-like 2 OS=Botryococcus braunii GN=SMT-2 PE=2 SV=1 | 3 | 166 | 4.0E-14 |
| sp|H2E7T8|SMTL1_BOTBR | Sterol methyltransferase-like 1 OS=Botryococcus braunii GN=SMT-1 PE=2 SV=1 | 9 | 166 | 5.0E-14 |
| sp|H2E7U0|SMTL3_BOTBR | Sterol methyltransferase-like 3 OS=Botryococcus braunii GN=SMT-3 PE=2 SV=1 | 9 | 166 | 5.0E-14 |
| sp|H2E7T7|BOMT_BOTBR | Botryococcene C-methyltransferase OS=Botryococcus braunii GN=TMT-3 PE=1 SV=1 | 13 | 167 | 3.0E-13 |
| sp|P20187|YT37_STRFR | Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 | 60 | 166 | 1.0E-12 |
| sp|P0A9H7|CFA_ECOLI | Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 | 13 | 160 | 4.0E-12 |
| sp|P0A9H8|CFA_ECOL6 | Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 | 13 | 160 | 4.0E-12 |
| sp|H2E7T6|SQMT2_BOTBR | Squalene methyltransferase 2 OS=Botryococcus braunii GN=TMT-2 PE=1 SV=1 | 13 | 160 | 5.0E-12 |
| sp|A6TGL3|UBIE_KLEP7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiE PE=3 SV=1 | 59 | 210 | 1.0E-11 |
| sp|B5XYI1|UBIE_KLEP3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae (strain 342) GN=ubiE PE=3 SV=1 | 59 | 210 | 1.0E-11 |
| sp|C3LPS5|UBIE_VIBCM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiE PE=3 SV=1 | 60 | 210 | 1.0E-11 |
| sp|Q9KVQ6|UBIE_VIBCH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiE PE=3 SV=1 | 60 | 210 | 1.0E-11 |
| sp|A5F4E5|UBIE_VIBC3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiE PE=3 SV=1 | 60 | 210 | 1.0E-11 |
| sp|Q3YVD2|UBIE_SHISS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella sonnei (strain Ss046) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|P0A889|UBIE_SHIFL | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|Q0SZ25|UBIE_SHIF8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|Q32A11|UBIE_SHIDS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|Q31UF3|UBIE_SHIBS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B2TVI4|UBIE_SHIB3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B1LM21|UBIE_ECOSM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B6I4H5|UBIE_ECOSE | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SE11) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B7NFD6|UBIE_ECOLU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|P0A887|UBIE_ECOLI | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12) GN=ubiE PE=1 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B1IW72|UBIE_ECOLC | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|A8A6U0|UBIE_ECOHS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O9:H4 (strain HS) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B1XAJ7|UBIE_ECODH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / DH10B) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|C5A009|UBIE_ECOBW | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B7M638|UBIE_ECO8A | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O8 (strain IAI1) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B7NV33|UBIE_ECO7I | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B5YY82|UBIE_ECO5E | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|P0A888|UBIE_ECO57 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B7L996|UBIE_ECO55 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain 55989 / EAEC) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B7UNG3|UBIE_ECO27 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|A7ZU40|UBIE_ECO24 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|Q1R477|UBIE_ECOUT | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|Q8FBJ0|UBIE_ECOL6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|Q0TAM1|UBIE_ECOL5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|A1AI22|UBIE_ECOK1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O1:K1 / APEC GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B7N2E1|UBIE_ECO81 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O81 (strain ED1a) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|B7MHC0|UBIE_ECO45 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|A8ACY2|UBIE_CITK8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-11 |
| sp|P67064|MENG_TROWT | Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain Twist) GN=menG PE=3 SV=1 | 57 | 189 | 3.0E-11 |
| sp|P67065|MENG_TROW8 | Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=menG PE=3 SV=1 | 57 | 189 | 3.0E-11 |
| sp|C5BRL2|UBIE_TERTT | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ubiE PE=3 SV=1 | 18 | 210 | 3.0E-11 |
| sp|A9MIY3|UBIE_SALAR | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiE PE=3 SV=1 | 59 | 210 | 5.0E-11 |
| sp|B7LU01|UBIE_ESCF3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiE PE=3 SV=1 | 59 | 210 | 6.0E-11 |
| sp|P0A2K5|UBIE_SALTY | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|P0A2K6|UBIE_SALTI | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhi GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|B4TNX9|UBIE_SALSV | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|B5BIX9|UBIE_SALPK | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|C0Q3E1|UBIE_SALPC | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi C (strain RKS4594) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|A9MY97|UBIE_SALPB | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|Q5PKP4|UBIE_SALPA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|B4SZ73|UBIE_SALNS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella newport (strain SL254) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|B4TBR3|UBIE_SALHS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella heidelberg (strain SL476) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|B5RFM8|UBIE_SALG2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|B5QW73|UBIE_SALEP | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|B5FNW6|UBIE_SALDC | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella dublin (strain CT_02021853) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|Q57HN8|UBIE_SALCH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella choleraesuis (strain SC-B67) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|B5EZU8|UBIE_SALA4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella agona (strain SL483) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-11 |
| sp|A4WFY5|UBIE_ENT38 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Enterobacter sp. (strain 638) GN=ubiE PE=3 SV=1 | 59 | 210 | 8.0E-11 |
| sp|Q74EU2|UBIE_GEOSL | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ubiE PE=3 SV=1 | 62 | 167 | 8.0E-11 |
| sp|A7MTX1|UBIE_VIBCB | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiE PE=3 SV=1 | 29 | 210 | 1.0E-10 |
| sp|Q87TH4|UBIE_VIBPA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiE PE=3 SV=1 | 60 | 210 | 1.0E-10 |
| sp|A1SRS4|UBIE_PSYIN | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Psychromonas ingrahamii (strain 37) GN=ubiE PE=3 SV=1 | 59 | 188 | 1.0E-10 |
| sp|Q24W96|MENG_DESHY | Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 | 60 | 167 | 1.0E-10 |
| sp|Q7MQ33|UBIE_VIBVY | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain YJ016) GN=ubiE PE=3 SV=1 | 60 | 210 | 2.0E-10 |
| sp|Q8DDP9|UBIE_VIBVU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain CMCP6) GN=ubiE PE=3 SV=1 | 60 | 210 | 2.0E-10 |
| sp|P59911|UBIE_HAEDU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiE PE=3 SV=1 | 59 | 217 | 2.0E-10 |
| sp|A1BAN1|UBIE_PARDP | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Paracoccus denitrificans (strain Pd 1222) GN=ubiE PE=3 SV=1 | 57 | 167 | 2.0E-10 |
| sp|B5EFL1|UBIE_GEOBB | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ubiE PE=3 SV=1 | 56 | 167 | 3.0E-10 |
| sp|A7MQL7|UBIE_CROS8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiE PE=3 SV=1 | 59 | 210 | 4.0E-10 |
| sp|C6E4U6|UBIE_GEOSM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter sp. (strain M21) GN=ubiE PE=3 SV=1 | 56 | 167 | 6.0E-10 |
| sp|B4EWC9|UBIE_PROMH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Proteus mirabilis (strain HI4320) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-10 |
| sp|Q9RRT0|MENG_DEIRA | Demethylmenaquinone methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=menG PE=3 SV=1 | 63 | 176 | 8.0E-10 |
| sp|Q8NT39|MENG_CORGL | Demethylmenaquinone methyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=menG PE=3 SV=1 | 56 | 167 | 1.0E-09 |
| sp|A4QBE5|MENG_CORGB | Demethylmenaquinone methyltransferase OS=Corynebacterium glutamicum (strain R) GN=menG PE=3 SV=1 | 56 | 167 | 1.0E-09 |
| sp|B2VG41|UBIE_ERWT9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiE PE=3 SV=1 | 21 | 210 | 2.0E-09 |
| sp|Q47LE2|MENG_THEFY | Demethylmenaquinone methyltransferase OS=Thermobifida fusca (strain YX) GN=menG PE=3 SV=1 | 6 | 167 | 2.0E-09 |
| sp|P46326|YXBB_BACSU | Uncharacterized protein YxbB OS=Bacillus subtilis (strain 168) GN=yxbB PE=3 SV=1 | 49 | 227 | 3.0E-09 |
| sp|A8G8B8|UBIE_SERP5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Serratia proteamaculans (strain 568) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-09 |
| sp|Q83WC3|SDMT_APHHA | Sarcosine/dimethylglycine N-methyltransferase OS=Aphanothece halophytica PE=1 SV=1 | 19 | 233 | 3.0E-09 |
| sp|Q88SI6|MENG_LACPL | Demethylmenaquinone methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=menG PE=3 SV=1 | 55 | 189 | 3.0E-09 |
| sp|Q6GGU0|MENG_STAAR | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 | 57 | 163 | 4.0E-09 |
| sp|C5C0T0|MENG_BEUC1 | Demethylmenaquinone methyltransferase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=menG PE=3 SV=1 | 57 | 179 | 5.0E-09 |
| sp|A6VTA1|UBIE_MARMS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Marinomonas sp. (strain MWYL1) GN=ubiE PE=3 SV=1 | 4 | 174 | 6.0E-09 |
| sp|P67063|MENG_STAAW | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 | 57 | 163 | 8.0E-09 |
| sp|A8Z450|MENG_STAAT | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 | 57 | 163 | 8.0E-09 |
| sp|Q6G992|MENG_STAAS | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 | 57 | 163 | 8.0E-09 |
| sp|P67062|MENG_STAAN | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 | 57 | 163 | 8.0E-09 |
| sp|P67061|MENG_STAAM | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 | 57 | 163 | 8.0E-09 |
| sp|A6QH20|MENG_STAAE | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 | 57 | 163 | 8.0E-09 |
| sp|Q5HFV2|MENG_STAAC | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 | 57 | 163 | 8.0E-09 |
| sp|A5ISZ9|MENG_STAA9 | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 | 57 | 163 | 8.0E-09 |
| sp|A6U1T9|MENG_STAA2 | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 | 57 | 163 | 8.0E-09 |
| sp|A7X2H6|MENG_STAA1 | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 | 57 | 163 | 8.0E-09 |
| sp|Q2YY85|MENG_STAAB | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 | 57 | 163 | 8.0E-09 |
| sp|Q9CBA8|MENG_MYCLE | Demethylmenaquinone methyltransferase OS=Mycobacterium leprae (strain TN) GN=menG PE=3 SV=2 | 54 | 167 | 8.0E-09 |
| sp|C4LL93|MENG_CORK4 | Demethylmenaquinone methyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=menG PE=3 SV=1 | 56 | 167 | 1.0E-08 |
| sp|A5GA37|UBIE_GEOUR | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter uraniireducens (strain Rf4) GN=ubiE PE=3 SV=1 | 22 | 167 | 1.0E-08 |
| sp|Q5YPB0|MENG_NOCFA | Demethylmenaquinone methyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=menG PE=3 SV=1 | 6 | 167 | 2.0E-08 |
| sp|Q2KUG1|UBIE_BORA1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella avium (strain 197N) GN=ubiE PE=3 SV=1 | 55 | 167 | 2.0E-08 |
| sp|Q5GZB5|UBIG_XANOR | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiG PE=3 SV=1 | 2 | 167 | 2.0E-08 |
| sp|B2SHS9|UBIG_XANOP | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiG PE=3 SV=1 | 2 | 167 | 2.0E-08 |
| sp|Q2P2C4|UBIG_XANOM | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiG PE=3 SV=1 | 2 | 167 | 2.0E-08 |
| sp|Q72HI4|MENG_THET2 | Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 | 63 | 177 | 2.0E-08 |
| sp|B1JP75|UBIE_YERPY | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-08 |
| sp|Q66FT0|UBIE_YERPS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-08 |
| sp|A4TR39|UBIE_YERPP | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis (strain Pestoides F) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-08 |
| sp|Q1CNB4|UBIE_YERPN | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-08 |
| sp|A9R431|UBIE_YERPG | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-08 |
| sp|Q8D1I3|UBIE_YERPE | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-08 |
| sp|B2K0Y4|UBIE_YERPB | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-08 |
| sp|A7FDE0|UBIE_YERP3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-08 |
| sp|Q7MZ81|UBIE_PHOLL | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-08 |
| sp|O66128|MENG_MICLU | Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 | 40 | 166 | 2.0E-08 |
| sp|Q21H69|UBIE_SACD2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ubiE PE=3 SV=1 | 18 | 210 | 2.0E-08 |
| sp|Q1CBG0|UBIE_YERPA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-08 |
| sp|A1JIF2|UBIE_YERE8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-08 |
| sp|Q8FSB3|MENG_COREF | Demethylmenaquinone methyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=menG PE=3 SV=2 | 57 | 167 | 3.0E-08 |
| sp|Q73AY2|MENG_BACC1 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menG PE=3 SV=1 | 1 | 163 | 3.0E-08 |
| sp|Q9RMN9|MTF2_MYCS2 | Fatty-acid O-methyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtf2 PE=3 SV=1 | 62 | 166 | 3.0E-08 |
| sp|O13871|YE16_SCHPO | Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 | 59 | 166 | 3.0E-08 |
| sp|Q6ANL3|UBIE_DESPS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=ubiE PE=3 SV=1 | 61 | 174 | 4.0E-08 |
| sp|O31474|YCGJ_BACSU | Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 | 51 | 173 | 4.0E-08 |
| sp|Q8P8H2|UBIG_XANCP | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiG PE=3 SV=1 | 3 | 265 | 4.0E-08 |
| sp|B0RS27|UBIG_XANCB | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiG PE=3 SV=1 | 3 | 265 | 4.0E-08 |
| sp|Q4UVL4|UBIG_XANC8 | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiG PE=3 SV=1 | 3 | 265 | 4.0E-08 |
| sp|A1SAJ8|UBIE_SHEAM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiE PE=3 SV=1 | 60 | 164 | 5.0E-08 |
| sp|B1VEN4|MENG_CORU7 | Demethylmenaquinone methyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=menG PE=3 SV=1 | 57 | 167 | 5.0E-08 |
| sp|Q7W0H1|UBIE_BORPE | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ubiE PE=3 SV=1 | 55 | 167 | 6.0E-08 |
| sp|Q7W3N6|UBIE_BORPA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ubiE PE=3 SV=1 | 55 | 167 | 6.0E-08 |
| sp|Q7WF12|UBIE_BORBR | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ubiE PE=3 SV=1 | 55 | 167 | 6.0E-08 |
| sp|A9VMC2|MENG_BACWK | Demethylmenaquinone methyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menG PE=3 SV=1 | 1 | 163 | 6.0E-08 |
| sp|A9WRT1|MENG_RENSM | Demethylmenaquinone methyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=menG PE=3 SV=1 | 46 | 167 | 6.0E-08 |
| sp|P31049|FAMT_PSEPU | Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 | 8 | 149 | 6.0E-08 |
| sp|A9M0C4|UBIG_NEIM0 | Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ubiG PE=3 SV=1 | 32 | 227 | 6.0E-08 |
| sp|Q9CKD6|UBIE_PASMU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pasteurella multocida (strain Pm70) GN=ubiE PE=3 SV=1 | 59 | 210 | 7.0E-08 |
| sp|Q6HL42|MENG_BACHK | Demethylmenaquinone methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menG PE=3 SV=1 | 1 | 163 | 8.0E-08 |
| sp|Q63DL9|MENG_BACCZ | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=menG PE=3 SV=1 | 1 | 163 | 8.0E-08 |
| sp|B9IVN5|MENG_BACCQ | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain Q1) GN=menG PE=3 SV=1 | 1 | 163 | 8.0E-08 |
| sp|B7HL23|MENG_BACC7 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH187) GN=menG PE=3 SV=1 | 1 | 163 | 8.0E-08 |
| sp|C1EN10|MENG_BACC3 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain 03BB102) GN=menG PE=3 SV=1 | 1 | 163 | 8.0E-08 |
| sp|B7JGZ8|MENG_BACC0 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH820) GN=menG PE=3 SV=1 | 1 | 163 | 8.0E-08 |
| sp|Q81SW0|MENG_BACAN | Demethylmenaquinone methyltransferase OS=Bacillus anthracis GN=menG PE=3 SV=1 | 1 | 163 | 8.0E-08 |
| sp|C3L8S6|MENG_BACAC | Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menG PE=3 SV=1 | 1 | 163 | 8.0E-08 |
| sp|C3P5A0|MENG_BACAA | Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain A0248) GN=menG PE=3 SV=1 | 1 | 163 | 8.0E-08 |
| sp|P30866|YAFE_ECOLI | Uncharacterized protein YafE OS=Escherichia coli (strain K12) GN=yafE PE=3 SV=1 | 102 | 177 | 8.0E-08 |
| sp|P9WPB6|CMAS1_MYCTO | Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 | 3 | 159 | 8.0E-08 |
| sp|P9WPB7|CMAS1_MYCTU | Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 | 3 | 159 | 9.0E-08 |
| sp|A5U866|CMAS1_MYCTA | Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 | 3 | 159 | 9.0E-08 |
| sp|B8CI06|UBIE_SHEPW | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ubiE PE=3 SV=1 | 60 | 164 | 9.0E-08 |
| sp|B0TJ16|UBIE_SHEHH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiE PE=3 SV=1 | 60 | 164 | 9.0E-08 |
| sp|Q5N4X9|MENG_SYNP6 | 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=menG PE=3 SV=1 | 1 | 167 | 9.0E-08 |
| sp|Q31P90|MENG_SYNE7 | 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=menG PE=3 SV=1 | 1 | 167 | 9.0E-08 |
| sp|A4XPM7|UBIE_PSEMY | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas mendocina (strain ymp) GN=ubiE PE=3 SV=1 | 18 | 167 | 1.0E-07 |
| sp|C3PKL1|MENG_CORA7 | Demethylmenaquinone methyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=menG PE=3 SV=1 | 52 | 167 | 1.0E-07 |
| sp|Q8CSH9|MENG_STAES | Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 | 53 | 163 | 1.0E-07 |
| sp|Q5HP74|MENG_STAEQ | Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 | 53 | 163 | 1.0E-07 |
| sp|Q55423|Y829_SYNY3 | Uncharacterized methyltransferase sll0829 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0829 PE=3 SV=1 | 56 | 212 | 1.0E-07 |
| sp|Q9HUC0|UBIE_PSEAE | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiE PE=3 SV=1 | 18 | 210 | 1.0E-07 |
| sp|Q02EV4|UBIE_PSEAB | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiE PE=3 SV=1 | 18 | 210 | 1.0E-07 |
| sp|B7V3F6|UBIE_PSEA8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiE PE=3 SV=1 | 18 | 210 | 1.0E-07 |
| sp|Q81FQ6|MENG_BACCR | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menG PE=3 SV=1 | 1 | 163 | 1.0E-07 |
| sp|B7HHR7|MENG_BACC4 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain B4264) GN=menG PE=3 SV=1 | 1 | 163 | 1.0E-07 |
| sp|B7IP91|MENG_BACC2 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain G9842) GN=menG PE=3 SV=1 | 1 | 163 | 1.0E-07 |
| sp|Q49XS5|MENG_STAS1 | Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 | 53 | 163 | 1.0E-07 |
| sp|A0Q549|UBIE_FRATN | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. novicida (strain U112) GN=ubiE PE=3 SV=1 | 56 | 167 | 1.0E-07 |
| sp|Q8YLP4|MENG_NOSS1 | 2-phytyl-1,4-naphtoquinone methyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=menG PE=3 SV=1 | 60 | 167 | 1.0E-07 |
| sp|Q0BNE2|UBIE_FRATO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=ubiE PE=3 SV=1 | 56 | 167 | 1.0E-07 |
| sp|Q2A524|UBIE_FRATH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain LVS) GN=ubiE PE=3 SV=1 | 56 | 167 | 1.0E-07 |
| sp|A7NAA1|UBIE_FRATF | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=ubiE PE=3 SV=1 | 56 | 167 | 1.0E-07 |
| sp|B0TZP1|UBIE_FRAP2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ubiE PE=3 SV=1 | 56 | 167 | 1.0E-07 |
| sp|P94298|MENG_BACPE | Demethylmenaquinone methyltransferase OS=Bacillus pseudofirmus (strain OF4) GN=menG PE=3 SV=2 | 56 | 163 | 1.0E-07 |
| sp|B2SFA2|UBIE_FRATM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ubiE PE=3 SV=1 | 56 | 167 | 2.0E-07 |
| sp|B3PH48|UBIE_CELJU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cellvibrio japonicus (strain Ueda107) GN=ubiE PE=3 SV=1 | 18 | 210 | 2.0E-07 |
| sp|A3QIE1|UBIE_SHELP | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiE PE=3 SV=1 | 60 | 167 | 2.0E-07 |
| sp|A8H966|UBIE_SHEPA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiE PE=3 SV=1 | 60 | 164 | 2.0E-07 |
| sp|A0PQX0|PHMT1_MYCUA | Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2377 PE=3 SV=1 | 62 | 167 | 2.0E-07 |
| sp|Q98GV1|UBIE_RHILO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium loti (strain MAFF303099) GN=ubiE PE=3 SV=1 | 60 | 188 | 2.0E-07 |
| sp|C5BCA4|UBIE_EDWI9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Edwardsiella ictaluri (strain 93-146) GN=ubiE PE=3 SV=1 | 59 | 210 | 2.0E-07 |
| sp|Q9KCC4|MENG_BACHD | Demethylmenaquinone methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=menG PE=3 SV=1 | 56 | 163 | 3.0E-07 |
| sp|Q6MX39|UMAA_MYCTU | S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 | 3 | 146 | 3.0E-07 |
| sp|A0PLV5|MENG_MYCUA | Demethylmenaquinone methyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=menG PE=3 SV=1 | 54 | 167 | 3.0E-07 |
| sp|Q5QYG2|UBIE_IDILO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 | 59 | 164 | 3.0E-07 |
| sp|Q2T139|UBIE_BURTA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-07 |
| sp|Q63XA0|UBIE_BURPS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain K96243) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-07 |
| sp|A3N5U8|UBIE_BURP6 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 668) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-07 |
| sp|Q3JVZ6|UBIE_BURP1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1710b) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-07 |
| sp|A3NRJ4|UBIE_BURP0 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1106a) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-07 |
| sp|A1V753|UBIE_BURMS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain SAVP1) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-07 |
| sp|Q62MP4|UBIE_BURMA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain ATCC 23344) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-07 |
| sp|A2S8L1|UBIE_BURM9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10229) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-07 |
| sp|A3MNT8|UBIE_BURM7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10247) GN=ubiE PE=3 SV=1 | 59 | 210 | 3.0E-07 |
| sp|Q9JWE6|UBIG_NEIMA | Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ubiG PE=3 SV=1 | 32 | 227 | 3.0E-07 |
| sp|A4VGE5|UBIE_PSEU5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas stutzeri (strain A1501) GN=ubiE PE=3 SV=1 | 18 | 210 | 3.0E-07 |
| sp|Q3MD91|MENG_ANAVT | 2-phytyl-1,4-naphtoquinone methyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=menG PE=3 SV=1 | 60 | 167 | 3.0E-07 |
| sp|Q1LRG9|UBIE_CUPMC | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ubiE PE=3 SV=1 | 59 | 167 | 3.0E-07 |
| sp|A9KGL7|UBIG_COXBN | Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiG PE=3 SV=1 | 32 | 167 | 3.0E-07 |
| sp|B6J5Y2|UBIG_COXB1 | Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiG PE=3 SV=1 | 32 | 167 | 3.0E-07 |
| sp|B2HRQ2|MENG_MYCMM | Demethylmenaquinone methyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=menG PE=3 SV=1 | 54 | 167 | 4.0E-07 |
| sp|Q2SBD7|BIOC_HAHCH | Malonyl-[acyl-carrier protein] O-methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=bioC PE=3 SV=1 | 63 | 168 | 4.0E-07 |
| sp|Q3ED65|MENG_ARATH | 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=MENG PE=1 SV=2 | 60 | 167 | 4.0E-07 |
| sp|A6VDI6|UBIE_PSEA7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain PA7) GN=ubiE PE=3 SV=1 | 18 | 167 | 4.0E-07 |
| sp|Q820B5|UBIG_COXBU | Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiG PE=3 SV=1 | 32 | 167 | 4.0E-07 |
| sp|A9NBI0|UBIG_COXBR | Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiG PE=3 SV=1 | 32 | 167 | 4.0E-07 |
| sp|B6J1W2|UBIG_COXB2 | Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiG PE=3 SV=1 | 32 | 167 | 4.0E-07 |
| sp|Q0HZP7|UBIE_SHESR | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-7) GN=ubiE PE=3 SV=1 | 60 | 167 | 4.0E-07 |
| sp|Q0HEA1|UBIE_SHESM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-4) GN=ubiE PE=3 SV=1 | 60 | 167 | 4.0E-07 |
| sp|A0L1M4|UBIE_SHESA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain ANA-3) GN=ubiE PE=3 SV=1 | 60 | 167 | 4.0E-07 |
| sp|Q12S23|UBIE_SHEDO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiE PE=3 SV=1 | 58 | 229 | 4.0E-07 |
| sp|B1KR07|UBIE_SHEWM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiE PE=3 SV=1 | 60 | 164 | 5.0E-07 |
| sp|B0RCZ0|MENG_CLAMS | Demethylmenaquinone methyltransferase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=menG PE=3 SV=1 | 5 | 229 | 5.0E-07 |
| sp|Q0KEH6|UBIE_CUPNH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ubiE PE=3 SV=1 | 59 | 229 | 5.0E-07 |
| sp|Q3KJC5|UBIE_PSEPF | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiE PE=3 SV=1 | 18 | 210 | 5.0E-07 |
| sp|Q7NZD3|UBIE_CHRVO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiE PE=3 SV=2 | 27 | 210 | 6.0E-07 |
| sp|Q475X0|UBIE_CUPPJ | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ubiE PE=3 SV=1 | 59 | 229 | 7.0E-07 |
| sp|Q4ZZG3|UBIE_PSEU2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiE PE=3 SV=1 | 27 | 210 | 7.0E-07 |
| sp|Q48PJ4|UBIE_PSE14 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiE PE=3 SV=1 | 27 | 210 | 7.0E-07 |
| sp|Q8Y278|UBIE_RALSO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia solanacearum (strain GMI1000) GN=ubiE PE=3 SV=1 | 58 | 229 | 8.0E-07 |
| sp|Q87UZ2|UBIE_PSESM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiE PE=3 SV=1 | 27 | 210 | 8.0E-07 |
| sp|Q9JXI7|UBIG_NEIMB | Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ubiG PE=3 SV=2 | 32 | 227 | 8.0E-07 |
| sp|A1SE26|MENG_NOCSJ | Demethylmenaquinone methyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=menG PE=3 SV=1 | 61 | 167 | 9.0E-07 |
| sp|A9AFC0|UBIE_BURM1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ubiE PE=3 SV=1 | 59 | 210 | 9.0E-07 |
| sp|B4EBC4|UBIE_BURCJ | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ubiE PE=3 SV=1 | 59 | 217 | 9.0E-07 |
| sp|B1JYJ6|UBIE_BURCC | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain MC0-3) GN=ubiE PE=3 SV=1 | 59 | 217 | 9.0E-07 |
| sp|Q9XAP8|MENG_STRCO | Demethylmenaquinone methyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=menG PE=3 SV=1 | 60 | 167 | 9.0E-07 |
| sp|C1DHS2|UBIE_AZOVD | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiE PE=3 SV=1 | 18 | 210 | 1.0E-06 |
| sp|B1HTA6|MENG_LYSSC | Demethylmenaquinone methyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=menG PE=3 SV=1 | 57 | 173 | 1.0E-06 |
| sp|A4JHS6|UBIE_BURVG | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ubiE PE=3 SV=1 | 59 | 217 | 1.0E-06 |
| sp|Q3IJV7|UBIE_PSEHT | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ubiE PE=3 SV=1 | 59 | 167 | 1.0E-06 |
| sp|Q5NFE1|UBIE_FRATT | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ubiE PE=3 SV=1 | 56 | 167 | 1.0E-06 |
| sp|Q14GU4|UBIE_FRAT1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ubiE PE=3 SV=1 | 56 | 167 | 1.0E-06 |
| sp|A1T3S1|MENG_MYCVP | Demethylmenaquinone methyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=menG PE=3 SV=1 | 57 | 167 | 1.0E-06 |
| sp|Q0BBY4|UBIE_BURCM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ubiE PE=3 SV=1 | 59 | 222 | 1.0E-06 |
| sp|B1YWF9|UBIE_BURA4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain MC40-6) GN=ubiE PE=3 SV=1 | 59 | 222 | 1.0E-06 |
| sp|A4IXH9|UBIE_FRATW | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ubiE PE=3 SV=1 | 56 | 167 | 1.0E-06 |
| sp|A8G0S7|UBIE_SHESH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sediminis (strain HAW-EB3) GN=ubiE PE=3 SV=1 | 60 | 164 | 1.0E-06 |
| sp|B2SX35|UBIE_BURPP | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ubiE PE=3 SV=1 | 29 | 167 | 1.0E-06 |
| sp|A0KAF5|UBIE_BURCH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain HI2424) GN=ubiE PE=3 SV=1 | 59 | 217 | 1.0E-06 |
| sp|Q1BTN4|UBIE_BURCA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain AU 1054) GN=ubiE PE=3 SV=1 | 59 | 217 | 1.0E-06 |
| sp|B2AH07|UBIE_CUPTR | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ubiE PE=3 SV=1 | 59 | 229 | 1.0E-06 |
| sp|A1R990|MENG_ARTAT | Demethylmenaquinone methyltransferase OS=Arthrobacter aurescens (strain TC1) GN=menG PE=3 SV=1 | 46 | 167 | 1.0E-06 |
| sp|Q145P0|UBIE_BURXL | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia xenovorans (strain LB400) GN=ubiE PE=3 SV=1 | 29 | 167 | 1.0E-06 |
| sp|Q9PAM5|UBIG_XYLFA | Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=ubiG PE=3 SV=1 | 31 | 167 | 2.0E-06 |
| sp|Q87BG5|UBIG_XYLFT | Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ubiG PE=3 SV=1 | 14 | 167 | 2.0E-06 |
| sp|B2I705|UBIG_XYLF2 | Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=ubiG PE=3 SV=1 | 14 | 167 | 2.0E-06 |
| sp|Q088H8|UBIE_SHEFN | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiE PE=3 SV=1 | 58 | 164 | 2.0E-06 |
| sp|Q9P272|K1456_HUMAN | Probable tRNA methyltransferase 9-like protein OS=Homo sapiens GN=KIAA1456 PE=2 SV=3 | 60 | 164 | 2.0E-06 |
| sp|Q73SL8|MENG_MYCPA | Demethylmenaquinone methyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=menG PE=3 SV=2 | 57 | 167 | 2.0E-06 |
| sp|P72818|MENG_SYNY3 | 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=menG PE=3 SV=1 | 1 | 167 | 2.0E-06 |
| sp|B8E6B6|UBIE_SHEB2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS223) GN=ubiE PE=3 SV=1 | 60 | 167 | 2.0E-06 |
| sp|A9KYL8|UBIE_SHEB9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS195) GN=ubiE PE=3 SV=1 | 60 | 164 | 2.0E-06 |
| sp|A6WIE9|UBIE_SHEB8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS185) GN=ubiE PE=3 SV=1 | 60 | 164 | 2.0E-06 |
| sp|A3D9F2|UBIE_SHEB5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiE PE=3 SV=1 | 60 | 164 | 2.0E-06 |
| sp|B2IUM7|MENG_NOSP7 | 2-phytyl-1,4-naphtoquinone methyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=menG PE=3 SV=1 | 58 | 200 | 2.0E-06 |
| sp|B0U3W1|UBIG_XYLFM | Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M12) GN=ubiG PE=3 SV=1 | 31 | 167 | 2.0E-06 |
| sp|A1RP78|UBIE_SHESW | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain W3-18-1) GN=ubiE PE=3 SV=1 | 60 | 164 | 2.0E-06 |
| sp|A4Y2Q5|UBIE_SHEPC | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiE PE=3 SV=1 | 60 | 164 | 2.0E-06 |
| sp|Q88D17|UBIE_PSEPK | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain KT2440) GN=ubiE PE=3 SV=1 | 27 | 167 | 3.0E-06 |
| sp|A5WA45|UBIE_PSEP1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiE PE=3 SV=1 | 27 | 167 | 3.0E-06 |
| sp|Q39D13|UBIE_BURL3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ubiE PE=3 SV=1 | 59 | 217 | 3.0E-06 |
| sp|B2UFG8|UBIE_RALPJ | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia pickettii (strain 12J) GN=ubiE PE=3 SV=1 | 58 | 229 | 3.0E-06 |
| sp|P59912|MENG_RHOBA | Demethylmenaquinone methyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=menG PE=3 SV=1 | 57 | 164 | 3.0E-06 |
| sp|A4T183|MENG_MYCGI | Demethylmenaquinone methyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=menG PE=3 SV=1 | 57 | 167 | 3.0E-06 |
| sp|Q8E9R7|UBIE_SHEON | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella oneidensis (strain MR-1) GN=ubiE PE=3 SV=1 | 60 | 164 | 4.0E-06 |
| sp|P64842|Y1440_MYCBO | Uncharacterized protein Mb1440c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1440c PE=3 SV=1 | 61 | 164 | 4.0E-06 |
| sp|P9WLY7|Y1405_MYCTU | Uncharacterized protein Rv1405c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1405c PE=1 SV=1 | 61 | 164 | 4.0E-06 |
| sp|P9WLY6|Y1405_MYCTO | Uncharacterized protein MT1449 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1449 PE=3 SV=1 | 61 | 164 | 4.0E-06 |
| sp|Q3BSF8|UBIG_XANC5 | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiG PE=3 SV=1 | 33 | 167 | 4.0E-06 |
| sp|P9WFR3|MENG_MYCTU | Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menG PE=1 SV=1 | 54 | 167 | 5.0E-06 |
| sp|P9WFR2|MENG_MYCTO | Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menG PE=3 SV=1 | 54 | 167 | 5.0E-06 |
| sp|A5TZT8|MENG_MYCTA | Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=menG PE=3 SV=1 | 54 | 167 | 5.0E-06 |
| sp|C1AKN8|MENG_MYCBT | Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=menG PE=3 SV=1 | 54 | 167 | 5.0E-06 |
| sp|A1KG35|MENG_MYCBP | Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=menG PE=3 SV=1 | 54 | 167 | 5.0E-06 |
| sp|P0A639|MENG_MYCBO | Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=menG PE=3 SV=1 | 54 | 167 | 5.0E-06 |
| sp|D8MPW4|BIOC_ERWBE | Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia billingiae (strain Eb661) GN=bioC PE=3 SV=1 | 60 | 234 | 5.0E-06 |
| sp|B4RC42|UBIE_PHEZH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Phenylobacterium zucineum (strain HLK1) GN=ubiE PE=3 SV=1 | 5 | 185 | 5.0E-06 |
| sp|Q0AA73|UBIG_ALKEH | Ubiquinone biosynthesis O-methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ubiG PE=3 SV=1 | 32 | 180 | 5.0E-06 |
| sp|C1DCV3|UBIE_LARHH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Laribacter hongkongensis (strain HLHK9) GN=ubiE PE=3 SV=1 | 59 | 167 | 7.0E-06 |
| sp|Q74LY0|MENG_LACJO | Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 | 62 | 205 | 9.0E-06 |
| sp|B1J2S8|UBIE_PSEPW | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain W619) GN=ubiE PE=3 SV=1 | 27 | 167 | 9.0E-06 |
| sp|Q1I3T0|UBIE_PSEE4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas entomophila (strain L48) GN=ubiE PE=3 SV=1 | 27 | 167 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0008168 | methyltransferase activity | Yes |
| GO:0008171 | O-methyltransferase activity | Yes |
| GO:0016740 | transferase activity | No |
| GO:0003824 | catalytic activity | No |
| GO:0003674 | molecular_function | No |
| GO:0016741 | transferase activity, transferring one-carbon groups | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm | Nuclear export signal | 0.7624 | 0.3962 | 0.0304 | 0.0652 | 0.1057 | 0.0143 | 0.1119 | 0.2841 | 0.2398 | 0.025 |
| Orthofinder run ID | 4 |
| Orthogroup | 6541 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|1816 MTQPSPAAVGAVYDQFTDFFADLLGGCIHFGYWDDADDGQTVRAATDQLTGLVAGRLALRPGQHILDVGCGSGKP AMQIATAHDVRVTGVTVSNRQIELARAQPGGVEQLGQVCFQLADAMDLPFADGTFDGAYAIESLVHMHDKSAALA NIARVLRPGGRLVVADMFLDEPPSGGHDAQALASICRLFQISVILTVDEYRRLLHQAGLHVVDFADVRHNVLPTY GIVAEALRQKALCLDGELGEQMRAGASDIEHMGTMTELGYALIVASRA* |
| Coding | >Hirsu2|1816 ATGACGCAACCAAGCCCTGCCGCAGTCGGCGCCGTGTACGACCAATTCACCGACTTCTTTGCCGACTTGCTGGGC GGATGCATCCATTTTGGCTACTGGGACGACGCCGACGATGGCCAGACGGTAAGGGCGGCCACCGATCAACTGACC GGCTTGGTCGCCGGCCGGCTTGCCCTCAGGCCGGGGCAGCATATCCTCGACGTCGGGTGCGGCAGCGGCAAGCCG GCGATGCAGATCGCCACCGCGCATGACGTCCGCGTTACGGGCGTCACCGTCAGCAACCGCCAGATCGAGCTCGCC CGCGCCCAGCCCGGAGGCGTCGAGCAGCTCGGACAAGTCTGCTTCCAGCTCGCCGATGCCATGGACCTGCCGTTC GCTGACGGCACGTTCGACGGCGCGTACGCCATCGAATCTCTGGTGCACATGCACGATAAGAGTGCTGCCCTGGCC AACATCGCACGTGTGCTTCGTCCCGGGGGCCGACTGGTCGTCGCCGACATGTTCCTCGACGAACCGCCCAGCGGC GGCCACGACGCTCAAGCCTTGGCGAGCATATGCCGGCTCTTTCAAATCTCCGTCATCCTCACCGTCGACGAATAC AGGCGTCTCTTGCACCAGGCCGGGCTGCACGTGGTCGACTTCGCCGACGTGCGGCACAACGTCCTGCCCACCTAC GGCATCGTTGCAGAGGCACTGCGCCAGAAGGCGCTCTGCCTCGACGGCGAACTCGGCGAACAGATGCGCGCCGGG GCATCTGATATAGAGCATATGGGCACCATGACAGAACTCGGCTACGCCCTGATTGTCGCCTCGCGCGCGTGA |
| Transcript | >Hirsu2|1816 ATGACGCAACCAAGCCCTGCCGCAGTCGGCGCCGTGTACGACCAATTCACCGACTTCTTTGCCGACTTGCTGGGC GGATGCATCCATTTTGGCTACTGGGACGACGCCGACGATGGCCAGACGGTAAGGGCGGCCACCGATCAACTGACC GGCTTGGTCGCCGGCCGGCTTGCCCTCAGGCCGGGGCAGCATATCCTCGACGTCGGGTGCGGCAGCGGCAAGCCG GCGATGCAGATCGCCACCGCGCATGACGTCCGCGTTACGGGCGTCACCGTCAGCAACCGCCAGATCGAGCTCGCC CGCGCCCAGCCCGGAGGCGTCGAGCAGCTCGGACAAGTCTGCTTCCAGCTCGCCGATGCCATGGACCTGCCGTTC GCTGACGGCACGTTCGACGGCGCGTACGCCATCGAATCTCTGGTGCACATGCACGATAAGAGTGCTGCCCTGGCC AACATCGCACGTGTGCTTCGTCCCGGGGGCCGACTGGTCGTCGCCGACATGTTCCTCGACGAACCGCCCAGCGGC GGCCACGACGCTCAAGCCTTGGCGAGCATATGCCGGCTCTTTCAAATCTCCGTCATCCTCACCGTCGACGAATAC AGGCGTCTCTTGCACCAGGCCGGGCTGCACGTGGTCGACTTCGCCGACGTGCGGCACAACGTCCTGCCCACCTAC GGCATCGTTGCAGAGGCACTGCGCCAGAAGGCGCTCTGCCTCGACGGCGAACTCGGCGAACAGATGCGCGCCGGG GCATCTGATATAGAGCATATGGGCACCATGACAGAACTCGGCTACGCCCTGATTGTCGCCTCGCGCGCGTGA |
| Gene | >Hirsu2|1816 ATGACGCAACCAAGCCCTGCCGCAGTCGGCGCCGTGTACGACCAATTCACCGACTTCTTTGCCGACTTGCTGGGC GGATGCATCCATTTTGGCTACTGGGACGACGCCGACGATGGCCAGACGGTAAGGGCGGCCACCGATCAACTGACC GGCTTGGTCGCCGGCCGGCTTGCCCTCAGGCCGGGGCAGCATATCCTCGACGTCGGGTGCGGCAGCGGCAAGCCG GCGATGCAGATCGCCACCGCGCATGACGTCCGCGTTACGGGCGTCACCGTCAGCAACCGCCAGATCGAGCTCGCC CGCGCCCAGCCCGGAGGCGTCGAGCAGCTCGGACAAGTCTGCTTCCAGCTCGCCGATGCCATGGACCTGCCGTTC GCTGACGGCACGTTCGACGGCGCGTACGCCATCGAATCTCTGGTGCACATGCACGATAAGAGTGCTGCCCTGGCC AACATCGCACGTGTGCTTCGTCCCGGGGGCCGACTGGTCGTCGCCGACATGTTCCTCGACGAACCGCCCAGCGGC GGCCACGACGCTCAAGCCTTGGCGAGCATATGCCGGCTCTTTCAAATCTCCGTCATCCTCACCGTCGACGAATAC AGGCGTCTCTTGCACCAGGCCGGGCTGCACGTGGTCGACTTCGCCGACGTGCGGCACAACGTCCTGCCCACCTAC GGCATCGTTGCAGAGGCACTGCGCCAGAAGGCGCTCTGCCTCGACGGCGAACTCGGCGAACAGATGCGCGCCGGG GCATCTGATATAGAGCATATGGGCACCATGACAGAACTCGGCTACGCCCTGATTGTCGCCTCGCGCGCGTGA |