Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1816
Gene name
LocationContig_141:19884..20706
Strand+
Gene length (bp)822
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 5.1E-22 66 164
PF13649 Methyltransf_25 Methyltransferase domain 6.8E-20 65 160
PF13489 Methyltransf_23 Methyltransferase domain 2.5E-17 57 212
PF02353 CMAS Mycolic acid cyclopropane synthetase 2.7E-17 7 234
PF13847 Methyltransf_31 Methyltransferase domain 1.9E-16 62 187
PF08242 Methyltransf_12 Methyltransferase domain 3.2E-13 66 162
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 8.5E-13 57 166
PF00891 Methyltransf_2 O-methyltransferase domain 1.8E-05 58 209
PF05401 NodS Nodulation protein S (NodS) 8.4E-05 62 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 4 272 5.0E-53
sp|Q9ZSK1|GTOMC_ARATH Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 9 260 3.0E-22
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 9 177 2.0E-20
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 13 173 7.0E-20
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 13 173 7.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 4 272 5.0E-53
sp|Q9ZSK1|GTOMC_ARATH Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 9 260 3.0E-22
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 9 177 2.0E-20
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 13 173 7.0E-20
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 13 173 7.0E-20
sp|Q6ZIK0|GTOMC_ORYSJ Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 9 237 1.0E-19
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 13 240 1.0E-19
sp|Q39227|SMT2_ARATH 24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana GN=SMT2 PE=1 SV=2 6 171 5.0E-19
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 9 159 6.0E-19
sp|Q9KJ20|GSDMT_ACTHA Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 18 259 1.0E-18
sp|O82427|SMT2_ORYSJ 24-methylenesterol C-methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Smt2-1 PE=2 SV=2 6 163 1.0E-18
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 13 174 2.0E-18
sp|Q9KJ21|SDMT_HALHR Sarcosine/dimethylglycine N-methyltransferase OS=Halorhodospira halochloris PE=1 SV=1 18 250 3.0E-18
sp|Q94JS4|SMT3B_ARATH 24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana GN=SMT3 PE=2 SV=1 6 171 1.0E-17
sp|Q6FRZ7|ERG6_CANGA Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 8 230 1.0E-17
sp|P74388|BQMT_SYNY3 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0418 PE=1 SV=1 5 167 2.0E-17
sp|Q9TYP1|STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans GN=strm-1 PE=3 SV=2 13 167 1.0E-16
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 13 171 2.0E-16
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 11 171 5.0E-16
sp|P25087|ERG6_YEAST Sterol 24-C-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG6 PE=1 SV=4 8 230 6.0E-16
sp|O14321|ERG6_SCHPO Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 7 171 1.0E-15
sp|O74198|ERG6_CANAL Sterol 24-C-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG6 PE=3 SV=1 13 160 1.0E-15
sp|Q67LE6|MENG_SYMTH Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 59 163 2.0E-15
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 48 166 2.0E-15
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 13 160 3.0E-15
sp|H2E7T5|SQMT1_BOTBR Squalene methyltransferase 1 OS=Botryococcus braunii GN=TMT-1 PE=1 SV=1 13 185 4.0E-15
sp|Q875K1|ERG6_CLAL4 Sterol 24-C-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=ERG6 PE=3 SV=1 13 169 4.0E-15
sp|Q6CYB3|ERG6_KLULA Sterol 24-C-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERG6 PE=3 SV=1 11 225 5.0E-15
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 48 166 7.0E-15
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 57 166 8.0E-15
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 48 166 1.0E-14
sp|B9LZA9|UBIE_GEODF Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=ubiE PE=3 SV=1 56 167 1.0E-14
sp|A4F7P5|ERYG_SACEN Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryG PE=1 SV=1 13 225 3.0E-14
sp|Q54I98|SMT1_DICDI Probable cycloartenol-C-24-methyltransferase 1 OS=Dictyostelium discoideum GN=smt1 PE=1 SV=1 9 173 3.0E-14
sp|H2E7T9|SMTL2_BOTBR Sterol methyltransferase-like 2 OS=Botryococcus braunii GN=SMT-2 PE=2 SV=1 3 166 4.0E-14
sp|H2E7T8|SMTL1_BOTBR Sterol methyltransferase-like 1 OS=Botryococcus braunii GN=SMT-1 PE=2 SV=1 9 166 5.0E-14
sp|H2E7U0|SMTL3_BOTBR Sterol methyltransferase-like 3 OS=Botryococcus braunii GN=SMT-3 PE=2 SV=1 9 166 5.0E-14
sp|H2E7T7|BOMT_BOTBR Botryococcene C-methyltransferase OS=Botryococcus braunii GN=TMT-3 PE=1 SV=1 13 167 3.0E-13
sp|P20187|YT37_STRFR Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 60 166 1.0E-12
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 13 160 4.0E-12
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 13 160 4.0E-12
sp|H2E7T6|SQMT2_BOTBR Squalene methyltransferase 2 OS=Botryococcus braunii GN=TMT-2 PE=1 SV=1 13 160 5.0E-12
sp|A6TGL3|UBIE_KLEP7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiE PE=3 SV=1 59 210 1.0E-11
sp|B5XYI1|UBIE_KLEP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae (strain 342) GN=ubiE PE=3 SV=1 59 210 1.0E-11
sp|C3LPS5|UBIE_VIBCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiE PE=3 SV=1 60 210 1.0E-11
sp|Q9KVQ6|UBIE_VIBCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiE PE=3 SV=1 60 210 1.0E-11
sp|A5F4E5|UBIE_VIBC3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiE PE=3 SV=1 60 210 1.0E-11
sp|Q3YVD2|UBIE_SHISS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella sonnei (strain Ss046) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|P0A889|UBIE_SHIFL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|Q0SZ25|UBIE_SHIF8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|Q32A11|UBIE_SHIDS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|Q31UF3|UBIE_SHIBS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B2TVI4|UBIE_SHIB3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B1LM21|UBIE_ECOSM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B6I4H5|UBIE_ECOSE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SE11) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B7NFD6|UBIE_ECOLU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|P0A887|UBIE_ECOLI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12) GN=ubiE PE=1 SV=1 59 210 2.0E-11
sp|B1IW72|UBIE_ECOLC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|A8A6U0|UBIE_ECOHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O9:H4 (strain HS) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B1XAJ7|UBIE_ECODH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / DH10B) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|C5A009|UBIE_ECOBW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B7M638|UBIE_ECO8A Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O8 (strain IAI1) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B7NV33|UBIE_ECO7I Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B5YY82|UBIE_ECO5E Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|P0A888|UBIE_ECO57 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B7L996|UBIE_ECO55 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain 55989 / EAEC) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B7UNG3|UBIE_ECO27 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|A7ZU40|UBIE_ECO24 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|Q1R477|UBIE_ECOUT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|Q8FBJ0|UBIE_ECOL6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|Q0TAM1|UBIE_ECOL5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|A1AI22|UBIE_ECOK1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O1:K1 / APEC GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B7N2E1|UBIE_ECO81 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O81 (strain ED1a) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|B7MHC0|UBIE_ECO45 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|A8ACY2|UBIE_CITK8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiE PE=3 SV=1 59 210 2.0E-11
sp|P67064|MENG_TROWT Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain Twist) GN=menG PE=3 SV=1 57 189 3.0E-11
sp|P67065|MENG_TROW8 Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=menG PE=3 SV=1 57 189 3.0E-11
sp|C5BRL2|UBIE_TERTT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ubiE PE=3 SV=1 18 210 3.0E-11
sp|A9MIY3|UBIE_SALAR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiE PE=3 SV=1 59 210 5.0E-11
sp|B7LU01|UBIE_ESCF3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiE PE=3 SV=1 59 210 6.0E-11
sp|P0A2K5|UBIE_SALTY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|P0A2K6|UBIE_SALTI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhi GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|B4TNX9|UBIE_SALSV Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|B5BIX9|UBIE_SALPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|C0Q3E1|UBIE_SALPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi C (strain RKS4594) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|A9MY97|UBIE_SALPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|Q5PKP4|UBIE_SALPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|B4SZ73|UBIE_SALNS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella newport (strain SL254) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|B4TBR3|UBIE_SALHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella heidelberg (strain SL476) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|B5RFM8|UBIE_SALG2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|B5QW73|UBIE_SALEP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|B5FNW6|UBIE_SALDC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella dublin (strain CT_02021853) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|Q57HN8|UBIE_SALCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella choleraesuis (strain SC-B67) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|B5EZU8|UBIE_SALA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella agona (strain SL483) GN=ubiE PE=3 SV=1 59 210 7.0E-11
sp|A4WFY5|UBIE_ENT38 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Enterobacter sp. (strain 638) GN=ubiE PE=3 SV=1 59 210 8.0E-11
sp|Q74EU2|UBIE_GEOSL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ubiE PE=3 SV=1 62 167 8.0E-11
sp|A7MTX1|UBIE_VIBCB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiE PE=3 SV=1 29 210 1.0E-10
sp|Q87TH4|UBIE_VIBPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiE PE=3 SV=1 60 210 1.0E-10
sp|A1SRS4|UBIE_PSYIN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Psychromonas ingrahamii (strain 37) GN=ubiE PE=3 SV=1 59 188 1.0E-10
sp|Q24W96|MENG_DESHY Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 60 167 1.0E-10
sp|Q7MQ33|UBIE_VIBVY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain YJ016) GN=ubiE PE=3 SV=1 60 210 2.0E-10
sp|Q8DDP9|UBIE_VIBVU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain CMCP6) GN=ubiE PE=3 SV=1 60 210 2.0E-10
sp|P59911|UBIE_HAEDU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiE PE=3 SV=1 59 217 2.0E-10
sp|A1BAN1|UBIE_PARDP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Paracoccus denitrificans (strain Pd 1222) GN=ubiE PE=3 SV=1 57 167 2.0E-10
sp|B5EFL1|UBIE_GEOBB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ubiE PE=3 SV=1 56 167 3.0E-10
sp|A7MQL7|UBIE_CROS8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiE PE=3 SV=1 59 210 4.0E-10
sp|C6E4U6|UBIE_GEOSM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter sp. (strain M21) GN=ubiE PE=3 SV=1 56 167 6.0E-10
sp|B4EWC9|UBIE_PROMH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Proteus mirabilis (strain HI4320) GN=ubiE PE=3 SV=1 59 210 7.0E-10
sp|Q9RRT0|MENG_DEIRA Demethylmenaquinone methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=menG PE=3 SV=1 63 176 8.0E-10
sp|Q8NT39|MENG_CORGL Demethylmenaquinone methyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=menG PE=3 SV=1 56 167 1.0E-09
sp|A4QBE5|MENG_CORGB Demethylmenaquinone methyltransferase OS=Corynebacterium glutamicum (strain R) GN=menG PE=3 SV=1 56 167 1.0E-09
sp|B2VG41|UBIE_ERWT9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiE PE=3 SV=1 21 210 2.0E-09
sp|Q47LE2|MENG_THEFY Demethylmenaquinone methyltransferase OS=Thermobifida fusca (strain YX) GN=menG PE=3 SV=1 6 167 2.0E-09
sp|P46326|YXBB_BACSU Uncharacterized protein YxbB OS=Bacillus subtilis (strain 168) GN=yxbB PE=3 SV=1 49 227 3.0E-09
sp|A8G8B8|UBIE_SERP5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Serratia proteamaculans (strain 568) GN=ubiE PE=3 SV=1 59 210 3.0E-09
sp|Q83WC3|SDMT_APHHA Sarcosine/dimethylglycine N-methyltransferase OS=Aphanothece halophytica PE=1 SV=1 19 233 3.0E-09
sp|Q88SI6|MENG_LACPL Demethylmenaquinone methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=menG PE=3 SV=1 55 189 3.0E-09
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 57 163 4.0E-09
sp|C5C0T0|MENG_BEUC1 Demethylmenaquinone methyltransferase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=menG PE=3 SV=1 57 179 5.0E-09
sp|A6VTA1|UBIE_MARMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Marinomonas sp. (strain MWYL1) GN=ubiE PE=3 SV=1 4 174 6.0E-09
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 57 163 8.0E-09
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 57 163 8.0E-09
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 57 163 8.0E-09
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 57 163 8.0E-09
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 57 163 8.0E-09
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 57 163 8.0E-09
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 57 163 8.0E-09
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 57 163 8.0E-09
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 57 163 8.0E-09
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 57 163 8.0E-09
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 57 163 8.0E-09
sp|Q9CBA8|MENG_MYCLE Demethylmenaquinone methyltransferase OS=Mycobacterium leprae (strain TN) GN=menG PE=3 SV=2 54 167 8.0E-09
sp|C4LL93|MENG_CORK4 Demethylmenaquinone methyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=menG PE=3 SV=1 56 167 1.0E-08
sp|A5GA37|UBIE_GEOUR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter uraniireducens (strain Rf4) GN=ubiE PE=3 SV=1 22 167 1.0E-08
sp|Q5YPB0|MENG_NOCFA Demethylmenaquinone methyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=menG PE=3 SV=1 6 167 2.0E-08
sp|Q2KUG1|UBIE_BORA1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella avium (strain 197N) GN=ubiE PE=3 SV=1 55 167 2.0E-08
sp|Q5GZB5|UBIG_XANOR Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiG PE=3 SV=1 2 167 2.0E-08
sp|B2SHS9|UBIG_XANOP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiG PE=3 SV=1 2 167 2.0E-08
sp|Q2P2C4|UBIG_XANOM Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiG PE=3 SV=1 2 167 2.0E-08
sp|Q72HI4|MENG_THET2 Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 63 177 2.0E-08
sp|B1JP75|UBIE_YERPY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiE PE=3 SV=1 59 210 2.0E-08
sp|Q66FT0|UBIE_YERPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiE PE=3 SV=1 59 210 2.0E-08
sp|A4TR39|UBIE_YERPP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis (strain Pestoides F) GN=ubiE PE=3 SV=1 59 210 2.0E-08
sp|Q1CNB4|UBIE_YERPN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiE PE=3 SV=1 59 210 2.0E-08
sp|A9R431|UBIE_YERPG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiE PE=3 SV=1 59 210 2.0E-08
sp|Q8D1I3|UBIE_YERPE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis GN=ubiE PE=3 SV=1 59 210 2.0E-08
sp|B2K0Y4|UBIE_YERPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiE PE=3 SV=1 59 210 2.0E-08
sp|A7FDE0|UBIE_YERP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiE PE=3 SV=1 59 210 2.0E-08
sp|Q7MZ81|UBIE_PHOLL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiE PE=3 SV=1 59 210 2.0E-08
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 40 166 2.0E-08
sp|Q21H69|UBIE_SACD2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ubiE PE=3 SV=1 18 210 2.0E-08
sp|Q1CBG0|UBIE_YERPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiE PE=3 SV=1 59 210 3.0E-08
sp|A1JIF2|UBIE_YERE8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiE PE=3 SV=1 59 210 3.0E-08
sp|Q8FSB3|MENG_COREF Demethylmenaquinone methyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=menG PE=3 SV=2 57 167 3.0E-08
sp|Q73AY2|MENG_BACC1 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menG PE=3 SV=1 1 163 3.0E-08
sp|Q9RMN9|MTF2_MYCS2 Fatty-acid O-methyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtf2 PE=3 SV=1 62 166 3.0E-08
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 59 166 3.0E-08
sp|Q6ANL3|UBIE_DESPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=ubiE PE=3 SV=1 61 174 4.0E-08
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 51 173 4.0E-08
sp|Q8P8H2|UBIG_XANCP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiG PE=3 SV=1 3 265 4.0E-08
sp|B0RS27|UBIG_XANCB Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiG PE=3 SV=1 3 265 4.0E-08
sp|Q4UVL4|UBIG_XANC8 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiG PE=3 SV=1 3 265 4.0E-08
sp|A1SAJ8|UBIE_SHEAM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiE PE=3 SV=1 60 164 5.0E-08
sp|B1VEN4|MENG_CORU7 Demethylmenaquinone methyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=menG PE=3 SV=1 57 167 5.0E-08
sp|Q7W0H1|UBIE_BORPE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ubiE PE=3 SV=1 55 167 6.0E-08
sp|Q7W3N6|UBIE_BORPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ubiE PE=3 SV=1 55 167 6.0E-08
sp|Q7WF12|UBIE_BORBR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ubiE PE=3 SV=1 55 167 6.0E-08
sp|A9VMC2|MENG_BACWK Demethylmenaquinone methyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menG PE=3 SV=1 1 163 6.0E-08
sp|A9WRT1|MENG_RENSM Demethylmenaquinone methyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=menG PE=3 SV=1 46 167 6.0E-08
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 8 149 6.0E-08
sp|A9M0C4|UBIG_NEIM0 Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ubiG PE=3 SV=1 32 227 6.0E-08
sp|Q9CKD6|UBIE_PASMU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pasteurella multocida (strain Pm70) GN=ubiE PE=3 SV=1 59 210 7.0E-08
sp|Q6HL42|MENG_BACHK Demethylmenaquinone methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menG PE=3 SV=1 1 163 8.0E-08
sp|Q63DL9|MENG_BACCZ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=menG PE=3 SV=1 1 163 8.0E-08
sp|B9IVN5|MENG_BACCQ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain Q1) GN=menG PE=3 SV=1 1 163 8.0E-08
sp|B7HL23|MENG_BACC7 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH187) GN=menG PE=3 SV=1 1 163 8.0E-08
sp|C1EN10|MENG_BACC3 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain 03BB102) GN=menG PE=3 SV=1 1 163 8.0E-08
sp|B7JGZ8|MENG_BACC0 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH820) GN=menG PE=3 SV=1 1 163 8.0E-08
sp|Q81SW0|MENG_BACAN Demethylmenaquinone methyltransferase OS=Bacillus anthracis GN=menG PE=3 SV=1 1 163 8.0E-08
sp|C3L8S6|MENG_BACAC Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menG PE=3 SV=1 1 163 8.0E-08
sp|C3P5A0|MENG_BACAA Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain A0248) GN=menG PE=3 SV=1 1 163 8.0E-08
sp|P30866|YAFE_ECOLI Uncharacterized protein YafE OS=Escherichia coli (strain K12) GN=yafE PE=3 SV=1 102 177 8.0E-08
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 3 159 8.0E-08
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 3 159 9.0E-08
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 3 159 9.0E-08
sp|B8CI06|UBIE_SHEPW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ubiE PE=3 SV=1 60 164 9.0E-08
sp|B0TJ16|UBIE_SHEHH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiE PE=3 SV=1 60 164 9.0E-08
sp|Q5N4X9|MENG_SYNP6 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=menG PE=3 SV=1 1 167 9.0E-08
sp|Q31P90|MENG_SYNE7 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=menG PE=3 SV=1 1 167 9.0E-08
sp|A4XPM7|UBIE_PSEMY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas mendocina (strain ymp) GN=ubiE PE=3 SV=1 18 167 1.0E-07
sp|C3PKL1|MENG_CORA7 Demethylmenaquinone methyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=menG PE=3 SV=1 52 167 1.0E-07
sp|Q8CSH9|MENG_STAES Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 53 163 1.0E-07
sp|Q5HP74|MENG_STAEQ Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 53 163 1.0E-07
sp|Q55423|Y829_SYNY3 Uncharacterized methyltransferase sll0829 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0829 PE=3 SV=1 56 212 1.0E-07
sp|Q9HUC0|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiE PE=3 SV=1 18 210 1.0E-07
sp|Q02EV4|UBIE_PSEAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiE PE=3 SV=1 18 210 1.0E-07
sp|B7V3F6|UBIE_PSEA8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiE PE=3 SV=1 18 210 1.0E-07
sp|Q81FQ6|MENG_BACCR Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menG PE=3 SV=1 1 163 1.0E-07
sp|B7HHR7|MENG_BACC4 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain B4264) GN=menG PE=3 SV=1 1 163 1.0E-07
sp|B7IP91|MENG_BACC2 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain G9842) GN=menG PE=3 SV=1 1 163 1.0E-07
sp|Q49XS5|MENG_STAS1 Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 53 163 1.0E-07
sp|A0Q549|UBIE_FRATN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. novicida (strain U112) GN=ubiE PE=3 SV=1 56 167 1.0E-07
sp|Q8YLP4|MENG_NOSS1 2-phytyl-1,4-naphtoquinone methyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=menG PE=3 SV=1 60 167 1.0E-07
sp|Q0BNE2|UBIE_FRATO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=ubiE PE=3 SV=1 56 167 1.0E-07
sp|Q2A524|UBIE_FRATH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain LVS) GN=ubiE PE=3 SV=1 56 167 1.0E-07
sp|A7NAA1|UBIE_FRATF Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=ubiE PE=3 SV=1 56 167 1.0E-07
sp|B0TZP1|UBIE_FRAP2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ubiE PE=3 SV=1 56 167 1.0E-07
sp|P94298|MENG_BACPE Demethylmenaquinone methyltransferase OS=Bacillus pseudofirmus (strain OF4) GN=menG PE=3 SV=2 56 163 1.0E-07
sp|B2SFA2|UBIE_FRATM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ubiE PE=3 SV=1 56 167 2.0E-07
sp|B3PH48|UBIE_CELJU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cellvibrio japonicus (strain Ueda107) GN=ubiE PE=3 SV=1 18 210 2.0E-07
sp|A3QIE1|UBIE_SHELP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiE PE=3 SV=1 60 167 2.0E-07
sp|A8H966|UBIE_SHEPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiE PE=3 SV=1 60 164 2.0E-07
sp|A0PQX0|PHMT1_MYCUA Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2377 PE=3 SV=1 62 167 2.0E-07
sp|Q98GV1|UBIE_RHILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium loti (strain MAFF303099) GN=ubiE PE=3 SV=1 60 188 2.0E-07
sp|C5BCA4|UBIE_EDWI9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Edwardsiella ictaluri (strain 93-146) GN=ubiE PE=3 SV=1 59 210 2.0E-07
sp|Q9KCC4|MENG_BACHD Demethylmenaquinone methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=menG PE=3 SV=1 56 163 3.0E-07
sp|Q6MX39|UMAA_MYCTU S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 3 146 3.0E-07
sp|A0PLV5|MENG_MYCUA Demethylmenaquinone methyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=menG PE=3 SV=1 54 167 3.0E-07
sp|Q5QYG2|UBIE_IDILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 59 164 3.0E-07
sp|Q2T139|UBIE_BURTA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ubiE PE=3 SV=1 59 210 3.0E-07
sp|Q63XA0|UBIE_BURPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain K96243) GN=ubiE PE=3 SV=1 59 210 3.0E-07
sp|A3N5U8|UBIE_BURP6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 668) GN=ubiE PE=3 SV=1 59 210 3.0E-07
sp|Q3JVZ6|UBIE_BURP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1710b) GN=ubiE PE=3 SV=1 59 210 3.0E-07
sp|A3NRJ4|UBIE_BURP0 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1106a) GN=ubiE PE=3 SV=1 59 210 3.0E-07
sp|A1V753|UBIE_BURMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain SAVP1) GN=ubiE PE=3 SV=1 59 210 3.0E-07
sp|Q62MP4|UBIE_BURMA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain ATCC 23344) GN=ubiE PE=3 SV=1 59 210 3.0E-07
sp|A2S8L1|UBIE_BURM9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10229) GN=ubiE PE=3 SV=1 59 210 3.0E-07
sp|A3MNT8|UBIE_BURM7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10247) GN=ubiE PE=3 SV=1 59 210 3.0E-07
sp|Q9JWE6|UBIG_NEIMA Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ubiG PE=3 SV=1 32 227 3.0E-07
sp|A4VGE5|UBIE_PSEU5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas stutzeri (strain A1501) GN=ubiE PE=3 SV=1 18 210 3.0E-07
sp|Q3MD91|MENG_ANAVT 2-phytyl-1,4-naphtoquinone methyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=menG PE=3 SV=1 60 167 3.0E-07
sp|Q1LRG9|UBIE_CUPMC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ubiE PE=3 SV=1 59 167 3.0E-07
sp|A9KGL7|UBIG_COXBN Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiG PE=3 SV=1 32 167 3.0E-07
sp|B6J5Y2|UBIG_COXB1 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiG PE=3 SV=1 32 167 3.0E-07
sp|B2HRQ2|MENG_MYCMM Demethylmenaquinone methyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=menG PE=3 SV=1 54 167 4.0E-07
sp|Q2SBD7|BIOC_HAHCH Malonyl-[acyl-carrier protein] O-methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=bioC PE=3 SV=1 63 168 4.0E-07
sp|Q3ED65|MENG_ARATH 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=MENG PE=1 SV=2 60 167 4.0E-07
sp|A6VDI6|UBIE_PSEA7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain PA7) GN=ubiE PE=3 SV=1 18 167 4.0E-07
sp|Q820B5|UBIG_COXBU Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiG PE=3 SV=1 32 167 4.0E-07
sp|A9NBI0|UBIG_COXBR Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiG PE=3 SV=1 32 167 4.0E-07
sp|B6J1W2|UBIG_COXB2 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiG PE=3 SV=1 32 167 4.0E-07
sp|Q0HZP7|UBIE_SHESR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-7) GN=ubiE PE=3 SV=1 60 167 4.0E-07
sp|Q0HEA1|UBIE_SHESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-4) GN=ubiE PE=3 SV=1 60 167 4.0E-07
sp|A0L1M4|UBIE_SHESA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain ANA-3) GN=ubiE PE=3 SV=1 60 167 4.0E-07
sp|Q12S23|UBIE_SHEDO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiE PE=3 SV=1 58 229 4.0E-07
sp|B1KR07|UBIE_SHEWM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiE PE=3 SV=1 60 164 5.0E-07
sp|B0RCZ0|MENG_CLAMS Demethylmenaquinone methyltransferase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=menG PE=3 SV=1 5 229 5.0E-07
sp|Q0KEH6|UBIE_CUPNH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ubiE PE=3 SV=1 59 229 5.0E-07
sp|Q3KJC5|UBIE_PSEPF Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiE PE=3 SV=1 18 210 5.0E-07
sp|Q7NZD3|UBIE_CHRVO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiE PE=3 SV=2 27 210 6.0E-07
sp|Q475X0|UBIE_CUPPJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ubiE PE=3 SV=1 59 229 7.0E-07
sp|Q4ZZG3|UBIE_PSEU2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiE PE=3 SV=1 27 210 7.0E-07
sp|Q48PJ4|UBIE_PSE14 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiE PE=3 SV=1 27 210 7.0E-07
sp|Q8Y278|UBIE_RALSO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia solanacearum (strain GMI1000) GN=ubiE PE=3 SV=1 58 229 8.0E-07
sp|Q87UZ2|UBIE_PSESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiE PE=3 SV=1 27 210 8.0E-07
sp|Q9JXI7|UBIG_NEIMB Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ubiG PE=3 SV=2 32 227 8.0E-07
sp|A1SE26|MENG_NOCSJ Demethylmenaquinone methyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=menG PE=3 SV=1 61 167 9.0E-07
sp|A9AFC0|UBIE_BURM1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ubiE PE=3 SV=1 59 210 9.0E-07
sp|B4EBC4|UBIE_BURCJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ubiE PE=3 SV=1 59 217 9.0E-07
sp|B1JYJ6|UBIE_BURCC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain MC0-3) GN=ubiE PE=3 SV=1 59 217 9.0E-07
sp|Q9XAP8|MENG_STRCO Demethylmenaquinone methyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=menG PE=3 SV=1 60 167 9.0E-07
sp|C1DHS2|UBIE_AZOVD Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiE PE=3 SV=1 18 210 1.0E-06
sp|B1HTA6|MENG_LYSSC Demethylmenaquinone methyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=menG PE=3 SV=1 57 173 1.0E-06
sp|A4JHS6|UBIE_BURVG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ubiE PE=3 SV=1 59 217 1.0E-06
sp|Q3IJV7|UBIE_PSEHT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ubiE PE=3 SV=1 59 167 1.0E-06
sp|Q5NFE1|UBIE_FRATT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ubiE PE=3 SV=1 56 167 1.0E-06
sp|Q14GU4|UBIE_FRAT1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ubiE PE=3 SV=1 56 167 1.0E-06
sp|A1T3S1|MENG_MYCVP Demethylmenaquinone methyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=menG PE=3 SV=1 57 167 1.0E-06
sp|Q0BBY4|UBIE_BURCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ubiE PE=3 SV=1 59 222 1.0E-06
sp|B1YWF9|UBIE_BURA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain MC40-6) GN=ubiE PE=3 SV=1 59 222 1.0E-06
sp|A4IXH9|UBIE_FRATW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ubiE PE=3 SV=1 56 167 1.0E-06
sp|A8G0S7|UBIE_SHESH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sediminis (strain HAW-EB3) GN=ubiE PE=3 SV=1 60 164 1.0E-06
sp|B2SX35|UBIE_BURPP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ubiE PE=3 SV=1 29 167 1.0E-06
sp|A0KAF5|UBIE_BURCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain HI2424) GN=ubiE PE=3 SV=1 59 217 1.0E-06
sp|Q1BTN4|UBIE_BURCA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain AU 1054) GN=ubiE PE=3 SV=1 59 217 1.0E-06
sp|B2AH07|UBIE_CUPTR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ubiE PE=3 SV=1 59 229 1.0E-06
sp|A1R990|MENG_ARTAT Demethylmenaquinone methyltransferase OS=Arthrobacter aurescens (strain TC1) GN=menG PE=3 SV=1 46 167 1.0E-06
sp|Q145P0|UBIE_BURXL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia xenovorans (strain LB400) GN=ubiE PE=3 SV=1 29 167 1.0E-06
sp|Q9PAM5|UBIG_XYLFA Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=ubiG PE=3 SV=1 31 167 2.0E-06
sp|Q87BG5|UBIG_XYLFT Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ubiG PE=3 SV=1 14 167 2.0E-06
sp|B2I705|UBIG_XYLF2 Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=ubiG PE=3 SV=1 14 167 2.0E-06
sp|Q088H8|UBIE_SHEFN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiE PE=3 SV=1 58 164 2.0E-06
sp|Q9P272|K1456_HUMAN Probable tRNA methyltransferase 9-like protein OS=Homo sapiens GN=KIAA1456 PE=2 SV=3 60 164 2.0E-06
sp|Q73SL8|MENG_MYCPA Demethylmenaquinone methyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=menG PE=3 SV=2 57 167 2.0E-06
sp|P72818|MENG_SYNY3 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=menG PE=3 SV=1 1 167 2.0E-06
sp|B8E6B6|UBIE_SHEB2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS223) GN=ubiE PE=3 SV=1 60 167 2.0E-06
sp|A9KYL8|UBIE_SHEB9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS195) GN=ubiE PE=3 SV=1 60 164 2.0E-06
sp|A6WIE9|UBIE_SHEB8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS185) GN=ubiE PE=3 SV=1 60 164 2.0E-06
sp|A3D9F2|UBIE_SHEB5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiE PE=3 SV=1 60 164 2.0E-06
sp|B2IUM7|MENG_NOSP7 2-phytyl-1,4-naphtoquinone methyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=menG PE=3 SV=1 58 200 2.0E-06
sp|B0U3W1|UBIG_XYLFM Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M12) GN=ubiG PE=3 SV=1 31 167 2.0E-06
sp|A1RP78|UBIE_SHESW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain W3-18-1) GN=ubiE PE=3 SV=1 60 164 2.0E-06
sp|A4Y2Q5|UBIE_SHEPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiE PE=3 SV=1 60 164 2.0E-06
sp|Q88D17|UBIE_PSEPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain KT2440) GN=ubiE PE=3 SV=1 27 167 3.0E-06
sp|A5WA45|UBIE_PSEP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiE PE=3 SV=1 27 167 3.0E-06
sp|Q39D13|UBIE_BURL3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ubiE PE=3 SV=1 59 217 3.0E-06
sp|B2UFG8|UBIE_RALPJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia pickettii (strain 12J) GN=ubiE PE=3 SV=1 58 229 3.0E-06
sp|P59912|MENG_RHOBA Demethylmenaquinone methyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=menG PE=3 SV=1 57 164 3.0E-06
sp|A4T183|MENG_MYCGI Demethylmenaquinone methyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=menG PE=3 SV=1 57 167 3.0E-06
sp|Q8E9R7|UBIE_SHEON Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella oneidensis (strain MR-1) GN=ubiE PE=3 SV=1 60 164 4.0E-06
sp|P64842|Y1440_MYCBO Uncharacterized protein Mb1440c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1440c PE=3 SV=1 61 164 4.0E-06
sp|P9WLY7|Y1405_MYCTU Uncharacterized protein Rv1405c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1405c PE=1 SV=1 61 164 4.0E-06
sp|P9WLY6|Y1405_MYCTO Uncharacterized protein MT1449 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1449 PE=3 SV=1 61 164 4.0E-06
sp|Q3BSF8|UBIG_XANC5 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiG PE=3 SV=1 33 167 4.0E-06
sp|P9WFR3|MENG_MYCTU Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menG PE=1 SV=1 54 167 5.0E-06
sp|P9WFR2|MENG_MYCTO Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menG PE=3 SV=1 54 167 5.0E-06
sp|A5TZT8|MENG_MYCTA Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=menG PE=3 SV=1 54 167 5.0E-06
sp|C1AKN8|MENG_MYCBT Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=menG PE=3 SV=1 54 167 5.0E-06
sp|A1KG35|MENG_MYCBP Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=menG PE=3 SV=1 54 167 5.0E-06
sp|P0A639|MENG_MYCBO Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=menG PE=3 SV=1 54 167 5.0E-06
sp|D8MPW4|BIOC_ERWBE Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia billingiae (strain Eb661) GN=bioC PE=3 SV=1 60 234 5.0E-06
sp|B4RC42|UBIE_PHEZH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Phenylobacterium zucineum (strain HLK1) GN=ubiE PE=3 SV=1 5 185 5.0E-06
sp|Q0AA73|UBIG_ALKEH Ubiquinone biosynthesis O-methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ubiG PE=3 SV=1 32 180 5.0E-06
sp|C1DCV3|UBIE_LARHH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Laribacter hongkongensis (strain HLHK9) GN=ubiE PE=3 SV=1 59 167 7.0E-06
sp|Q74LY0|MENG_LACJO Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 62 205 9.0E-06
sp|B1J2S8|UBIE_PSEPW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain W619) GN=ubiE PE=3 SV=1 27 167 9.0E-06
sp|Q1I3T0|UBIE_PSEE4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas entomophila (strain L48) GN=ubiE PE=3 SV=1 27 167 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0009312 oligosaccharide biosynthetic process Yes
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0008171 O-methyltransferase activity Yes
GO:0009877 nodulation Yes
GO:0008168 methyltransferase activity Yes
GO:0005975 carbohydrate metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0051704 multi-organism process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044419 interspecies interaction between organisms No
GO:0044238 primary metabolic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044403 symbiont process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1816
MTQPSPAAVGAVYDQFTDFFADLLGGCIHFGYWDDADDGQTVRAATDQLTGLVAGRLALRPGQHILDVGCGSGKP
AMQIATAHDVRVTGVTVSNRQIELARAQPGGVEQLGQVCFQLADAMDLPFADGTFDGAYAIESLVHMHDKSAALA
NIARVLRPGGRLVVADMFLDEPPSGGHDAQALASICRLFQISVILTVDEYRRLLHQAGLHVVDFADVRHNVLPTY
GIVAEALRQKALCLDGELGEQMRAGASDIEHMGTMTELGYALIVASRA*
Coding >Hirsu2|1816
ATGACGCAACCAAGCCCTGCCGCAGTCGGCGCCGTGTACGACCAATTCACCGACTTCTTTGCCGACTTGCTGGGC
GGATGCATCCATTTTGGCTACTGGGACGACGCCGACGATGGCCAGACGGTAAGGGCGGCCACCGATCAACTGACC
GGCTTGGTCGCCGGCCGGCTTGCCCTCAGGCCGGGGCAGCATATCCTCGACGTCGGGTGCGGCAGCGGCAAGCCG
GCGATGCAGATCGCCACCGCGCATGACGTCCGCGTTACGGGCGTCACCGTCAGCAACCGCCAGATCGAGCTCGCC
CGCGCCCAGCCCGGAGGCGTCGAGCAGCTCGGACAAGTCTGCTTCCAGCTCGCCGATGCCATGGACCTGCCGTTC
GCTGACGGCACGTTCGACGGCGCGTACGCCATCGAATCTCTGGTGCACATGCACGATAAGAGTGCTGCCCTGGCC
AACATCGCACGTGTGCTTCGTCCCGGGGGCCGACTGGTCGTCGCCGACATGTTCCTCGACGAACCGCCCAGCGGC
GGCCACGACGCTCAAGCCTTGGCGAGCATATGCCGGCTCTTTCAAATCTCCGTCATCCTCACCGTCGACGAATAC
AGGCGTCTCTTGCACCAGGCCGGGCTGCACGTGGTCGACTTCGCCGACGTGCGGCACAACGTCCTGCCCACCTAC
GGCATCGTTGCAGAGGCACTGCGCCAGAAGGCGCTCTGCCTCGACGGCGAACTCGGCGAACAGATGCGCGCCGGG
GCATCTGATATAGAGCATATGGGCACCATGACAGAACTCGGCTACGCCCTGATTGTCGCCTCGCGCGCGTGA
Transcript >Hirsu2|1816
ATGACGCAACCAAGCCCTGCCGCAGTCGGCGCCGTGTACGACCAATTCACCGACTTCTTTGCCGACTTGCTGGGC
GGATGCATCCATTTTGGCTACTGGGACGACGCCGACGATGGCCAGACGGTAAGGGCGGCCACCGATCAACTGACC
GGCTTGGTCGCCGGCCGGCTTGCCCTCAGGCCGGGGCAGCATATCCTCGACGTCGGGTGCGGCAGCGGCAAGCCG
GCGATGCAGATCGCCACCGCGCATGACGTCCGCGTTACGGGCGTCACCGTCAGCAACCGCCAGATCGAGCTCGCC
CGCGCCCAGCCCGGAGGCGTCGAGCAGCTCGGACAAGTCTGCTTCCAGCTCGCCGATGCCATGGACCTGCCGTTC
GCTGACGGCACGTTCGACGGCGCGTACGCCATCGAATCTCTGGTGCACATGCACGATAAGAGTGCTGCCCTGGCC
AACATCGCACGTGTGCTTCGTCCCGGGGGCCGACTGGTCGTCGCCGACATGTTCCTCGACGAACCGCCCAGCGGC
GGCCACGACGCTCAAGCCTTGGCGAGCATATGCCGGCTCTTTCAAATCTCCGTCATCCTCACCGTCGACGAATAC
AGGCGTCTCTTGCACCAGGCCGGGCTGCACGTGGTCGACTTCGCCGACGTGCGGCACAACGTCCTGCCCACCTAC
GGCATCGTTGCAGAGGCACTGCGCCAGAAGGCGCTCTGCCTCGACGGCGAACTCGGCGAACAGATGCGCGCCGGG
GCATCTGATATAGAGCATATGGGCACCATGACAGAACTCGGCTACGCCCTGATTGTCGCCTCGCGCGCGTGA
Gene >Hirsu2|1816
ATGACGCAACCAAGCCCTGCCGCAGTCGGCGCCGTGTACGACCAATTCACCGACTTCTTTGCCGACTTGCTGGGC
GGATGCATCCATTTTGGCTACTGGGACGACGCCGACGATGGCCAGACGGTAAGGGCGGCCACCGATCAACTGACC
GGCTTGGTCGCCGGCCGGCTTGCCCTCAGGCCGGGGCAGCATATCCTCGACGTCGGGTGCGGCAGCGGCAAGCCG
GCGATGCAGATCGCCACCGCGCATGACGTCCGCGTTACGGGCGTCACCGTCAGCAACCGCCAGATCGAGCTCGCC
CGCGCCCAGCCCGGAGGCGTCGAGCAGCTCGGACAAGTCTGCTTCCAGCTCGCCGATGCCATGGACCTGCCGTTC
GCTGACGGCACGTTCGACGGCGCGTACGCCATCGAATCTCTGGTGCACATGCACGATAAGAGTGCTGCCCTGGCC
AACATCGCACGTGTGCTTCGTCCCGGGGGCCGACTGGTCGTCGCCGACATGTTCCTCGACGAACCGCCCAGCGGC
GGCCACGACGCTCAAGCCTTGGCGAGCATATGCCGGCTCTTTCAAATCTCCGTCATCCTCACCGTCGACGAATAC
AGGCGTCTCTTGCACCAGGCCGGGCTGCACGTGGTCGACTTCGCCGACGTGCGGCACAACGTCCTGCCCACCTAC
GGCATCGTTGCAGAGGCACTGCGCCAGAAGGCGCTCTGCCTCGACGGCGAACTCGGCGAACAGATGCGCGCCGGG
GCATCTGATATAGAGCATATGGGCACCATGACAGAACTCGGCTACGCCCTGATTGTCGCCTCGCGCGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail