Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1811
Gene name
LocationContig_141:9242..10223
Strand+
Gene length (bp)981
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05190 MutS_IV MutS family domain IV 1.7E-08 84 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40965|MSH4_YEAST MutS protein homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH4 PE=1 SV=2 8 260 3.0E-42
sp|O15457|MSH4_HUMAN MutS protein homolog 4 OS=Homo sapiens GN=MSH4 PE=1 SV=2 5 259 3.0E-34
sp|Q99MT2|MSH4_MOUSE MutS protein homolog 4 OS=Mus musculus GN=Msh4 PE=2 SV=1 5 259 5.0E-34
sp|O94065|MSH4_CANAX MutS protein homolog 4 OS=Candida albicans GN=MSH4 PE=3 SV=1 5 260 6.0E-34
sp|F4JP48|MSH4_ARATH DNA mismatch repair protein MSH4 OS=Arabidopsis thaliana GN=MSH4 PE=2 SV=1 5 259 5.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40965|MSH4_YEAST MutS protein homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH4 PE=1 SV=2 8 260 3.0E-42
sp|O15457|MSH4_HUMAN MutS protein homolog 4 OS=Homo sapiens GN=MSH4 PE=1 SV=2 5 259 3.0E-34
sp|Q99MT2|MSH4_MOUSE MutS protein homolog 4 OS=Mus musculus GN=Msh4 PE=2 SV=1 5 259 5.0E-34
sp|O94065|MSH4_CANAX MutS protein homolog 4 OS=Candida albicans GN=MSH4 PE=3 SV=1 5 260 6.0E-34
sp|F4JP48|MSH4_ARATH DNA mismatch repair protein MSH4 OS=Arabidopsis thaliana GN=MSH4 PE=2 SV=1 5 259 5.0E-33
sp|Q23405|HIM14_CAEEL MutS protein homolog him-14 OS=Caenorhabditis elegans GN=him-14 PE=1 SV=2 67 254 7.0E-15
sp|Q8RFK2|MUTS_FUSNN DNA mismatch repair protein MutS OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=mutS PE=3 SV=1 11 254 5.0E-09
sp|A1CDD4|MSH3_ASPCL DNA mismatch repair protein msh3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=msh3 PE=3 SV=1 97 254 8.0E-09
sp|A7HMG4|MUTS_FERNB DNA mismatch repair protein MutS OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mutS PE=3 SV=1 80 260 1.0E-08
sp|Q1IN52|MUTS_KORVE DNA mismatch repair protein MutS OS=Koribacter versatilis (strain Ellin345) GN=mutS PE=3 SV=1 88 256 3.0E-08
sp|Q46CE2|MUTS_METBF DNA mismatch repair protein MutS OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=mutS PE=3 SV=1 80 254 2.0E-07
sp|A8F164|MUTS_RICM5 DNA mismatch repair protein MutS OS=Rickettsia massiliae (strain Mtu5) GN=mutS PE=3 SV=1 105 259 2.0E-07
sp|Q8TTB4|MUTS_METAC DNA mismatch repair protein MutS OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=mutS PE=3 SV=1 80 254 2.0E-07
sp|C5D9H5|MUTS_GEOSW DNA mismatch repair protein MutS OS=Geobacillus sp. (strain WCH70) GN=mutS PE=3 SV=1 186 260 5.0E-07
sp|A8GMX2|MUTS_RICAH DNA mismatch repair protein MutS OS=Rickettsia akari (strain Hartford) GN=mutS PE=3 SV=1 138 259 5.0E-07
sp|Q8PWA7|MUTS_METMA DNA mismatch repair protein MutS OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=mutS PE=3 SV=1 80 254 6.0E-07
sp|B0VAU7|MUTS_ACIBY DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AYE) GN=mutS PE=3 SV=1 69 256 7.0E-07
sp|B2HX50|MUTS_ACIBC DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain ACICU) GN=mutS PE=3 SV=1 69 256 7.0E-07
sp|B7IBV9|MUTS_ACIB5 DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AB0057) GN=mutS PE=3 SV=1 69 256 7.0E-07
sp|B7GW85|MUTS_ACIB3 DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AB307-0294) GN=mutS PE=3 SV=1 69 256 7.0E-07
sp|B0VUC9|MUTS_ACIBS DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain SDF) GN=mutS PE=3 SV=1 69 256 7.0E-07
sp|A6TR79|MUTS_ALKMQ DNA mismatch repair protein MutS OS=Alkaliphilus metalliredigens (strain QYMF) GN=mutS PE=3 SV=1 96 256 7.0E-07
sp|A3PNR5|MUTS_RHOS1 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mutS PE=3 SV=1 116 252 8.0E-07
sp|Q7UP05|MUTS_RHOBA DNA mismatch repair protein MutS OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mutS PE=3 SV=1 198 254 1.0E-06
sp|Q4UM86|MUTS_RICFE DNA mismatch repair protein MutS OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mutS PE=3 SV=1 138 259 1.0E-06
sp|Q5L7B7|MUTS_BACFN DNA mismatch repair protein MutS OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=mutS PE=3 SV=1 80 254 1.0E-06
sp|Q18FJ9|MUTS_HALWD DNA mismatch repair protein MutS OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=mutS PE=3 SV=1 179 253 1.0E-06
sp|A5EX62|MUTS_DICNV DNA mismatch repair protein MutS OS=Dichelobacter nodosus (strain VCS1703A) GN=mutS PE=3 SV=1 1 254 2.0E-06
sp|P26359|MSH3_SCHPO DNA mismatch repair protein msh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh3 PE=3 SV=1 141 253 2.0E-06
sp|Q8A334|MUTS_BACTN DNA mismatch repair protein MutS OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=mutS PE=3 SV=1 80 254 2.0E-06
sp|Q3IYI5|MUTS_RHOS4 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mutS PE=3 SV=1 117 252 2.0E-06
sp|Q92IL9|MUTS_RICCN DNA mismatch repair protein MutS OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mutS PE=3 SV=1 138 259 2.0E-06
sp|B0JFY0|MUTS_MICAN DNA mismatch repair protein MutS OS=Microcystis aeruginosa (strain NIES-843) GN=mutS PE=3 SV=1 51 253 2.0E-06
sp|B0BWY8|MUTS_RICRO DNA mismatch repair protein MutS OS=Rickettsia rickettsii (strain Iowa) GN=mutS PE=3 SV=1 138 259 2.0E-06
sp|Q0CPP9|MSH3_ASPTN DNA mismatch repair protein msh3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=msh3 PE=3 SV=1 141 254 2.0E-06
sp|Q64MG7|MUTS_BACFR DNA mismatch repair protein MutS OS=Bacteroides fragilis (strain YCH46) GN=mutS PE=3 SV=1 80 254 2.0E-06
sp|A8GRI6|MUTS_RICRS DNA mismatch repair protein MutS OS=Rickettsia rickettsii (strain Sheila Smith) GN=mutS PE=3 SV=1 138 259 2.0E-06
sp|C3PN02|MUTS_RICAE DNA mismatch repair protein MutS OS=Rickettsia africae (strain ESF-5) GN=mutS PE=3 SV=1 138 259 3.0E-06
sp|Q6AQ04|MUTS_DESPS DNA mismatch repair protein MutS OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=mutS PE=3 SV=1 108 256 3.0E-06
sp|Q1RJJ5|MUTS_RICBR DNA mismatch repair protein MutS OS=Rickettsia bellii (strain RML369-C) GN=mutS PE=3 SV=1 137 259 3.0E-06
sp|A8GX86|MUTS_RICB8 DNA mismatch repair protein MutS OS=Rickettsia bellii (strain OSU 85-389) GN=mutS PE=3 SV=1 137 259 3.0E-06
sp|A8ZXH5|MUTS_DESOH DNA mismatch repair protein MutS OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=mutS PE=3 SV=1 186 253 3.0E-06
sp|Q2JT35|MUTS_SYNJA DNA mismatch repair protein MutS OS=Synechococcus sp. (strain JA-3-3Ab) GN=mutS PE=3 SV=1 10 254 3.0E-06
sp|Q12VC9|MUTS_METBU DNA mismatch repair protein MutS OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=mutS PE=3 SV=1 193 254 3.0E-06
sp|Q0A8K3|MUTS_ALKEH DNA mismatch repair protein MutS OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mutS PE=3 SV=1 201 254 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006298 mismatch repair Yes
GO:0030983 mismatched DNA binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006950 response to stress No
GO:0006259 DNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0006281 DNA repair No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044237 cellular metabolic process No
GO:0050896 response to stimulus No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0003677 DNA binding No
GO:0032555 purine ribonucleotide binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003690 double-stranded DNA binding No
GO:0051716 cellular response to stimulus No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006974 cellular response to DNA damage stimulus No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1811
MAQMEDEIGQILMVKSFLESAPDLYRALDQAQSLLLVKARDLCHPDITGPILANIRRIIEADVTYMRSPLDLRNQ
RTFAVKSGISGMLDVARQTYKELTQEIHQHVDELTERHRVQIALKFDNGRKYWLRLRDVDFADSILPPVFINVVR
KKKYIECQTLDLVKLNVRLSDTSNEVVIRSDAVVRDLMRDLRHASPQLFRVCESIAFVDMIASFAQLATVRDYVR
PEITDTLALKSARHPILDKTLCGSYVPNDYYATEQ*
Coding >Hirsu2|1811
ATGGCCCAAATGGAAGATGAGATCGGCCAGATCCTCATGGTCAAGAGCTTCCTCGAGTCGGCTCCGGACCTATAC
AGGGCGCTAGACCAGGCGCAAAGCTTACTGCTCGTCAAGGCCCGAGACTTGTGCCACCCGGACATAACCGGACCG
ATTCTCGCCAACATCCGGCGCATAATAGAGGCCGACGTGACGTACATGAGGTCTCCCCTGGATCTTCGCAACCAG
CGAACTTTTGCTGTCAAGTCGGGGATCAGTGGGATGCTTGACGTGGCCAGGCAAACGTACAAGGAGCTGACTCAA
GAAATCCATCAGCACGTAGACGAATTGACTGAGCGACACCGCGTCCAGATCGCCCTCAAGTTCGATAATGGGCGA
AAATACTGGCTCAGACTCAGGGACGTTGACTTTGCCGATTCAATCCTCCCCCCCGTCTTCATTAACGTTGTTCGC
AAAAAGAAATACATCGAATGCCAGACGCTGGATCTTGTCAAGTTGAACGTTCGGCTGTCCGACACGTCGAACGAG
GTGGTCATCAGGAGCGACGCCGTCGTACGCGATTTGATGCGCGATCTCCGTCACGCATCGCCGCAGTTGTTTCGG
GTCTGCGAGTCAATAGCGTTTGTCGACATGATTGCCTCGTTTGCCCAGCTGGCCACAGTTCGAGACTACGTTCGG
CCAGAAATCACGGACACTCTGGCATTAAAGTCGGCACGGCATCCGATTCTGGACAAGACCCTCTGTGGGAGCTAT
GTTCCCAACGACTACTATGCCACGGAGCAATAG
Transcript >Hirsu2|1811
ATGGCCCAAATGGAAGATGAGATCGGCCAGATCCTCATGGTCAAGAGCTTCCTCGAGTCGGCTCCGGACCTATAC
AGGGCGCTAGACCAGGCGCAAAGCTTACTGCTCGTCAAGGCCCGAGACTTGTGCCACCCGGACATAACCGGACCG
ATTCTCGCCAACATCCGGCGCATAATAGAGGCCGACGTGACGTACATGAGGTCTCCCCTGGATCTTCGCAACCAG
CGAACTTTTGCTGTCAAGTCGGGGATCAGTGGGATGCTTGACGTGGCCAGGCAAACGTACAAGGAGCTGACTCAA
GAAATCCATCAGCACGTAGACGAATTGACTGAGCGACACCGCGTCCAGATCGCCCTCAAGTTCGATAATGGGCGA
AAATACTGGCTCAGACTCAGGGACGTTGACTTTGCCGATTCAATCCTCCCCCCCGTCTTCATTAACGTTGTTCGC
AAAAAGAAATACATCGAATGCCAGACGCTGGATCTTGTCAAGTTGAACGTTCGGCTGTCCGACACGTCGAACGAG
GTGGTCATCAGGAGCGACGCCGTCGTACGCGATTTGATGCGCGATCTCCGTCACGCATCGCCGCAGTTGTTTCGG
GTCTGCGAGTCAATAGCGTTTGTCGACATGATTGCCTCGTTTGCCCAGCTGGCCACAGTTCGAGACTACGTTCGG
CCAGAAATCACGGACACTCTGGCATTAAAGTCGGCACGGCATCCGATTCTGGACAAGACCCTCTGTGGGAGCTAT
GTTCCCAACGACTACTATGCCACGGAGCAATAG
Gene >Hirsu2|1811
ATGGCCCAAATGGAAGATGAGATCGGCCAGATCCTCATGGTCAAGAGCTTCCTCGAGTCGGCTCCGGACCTATAC
AGGGCGCTAGACCAGGCGCAAAGCTTACTGCTCGTCAAGGCCCGAGACTTGTGCCACCCGGACATAACCGGACCG
ATTCTCGCCAACATCCGGCGCATAATAGAGGCCGACGTGACGTACATGAGGTCTCCCCTGGATCTTCGCAACCAG
CGAACTTTTGCTGTCAAGTCGGGGATCAGTGGGATGCTTGACGTGGCCAGGCAAACGTACAAGGAGCTGACTCAA
GAAATCCATCAGCACGTAGACGAATTGACTGGTCTGTATCATTGTATAAGCCCAAGGCTGCATGCAGCTGCTGAC
CTTCGCCAAGAGCGACACCGCGTCCAGATCGCCCTCAAGTTCGATAATGGGCGAAAATACTGGCTCAGACTCAGG
GACGTTGACTTTGCCGATTCAATCCTCCCCCCCGTCTTCATTAACGTTGTTCGCAAAAAGAAATACATCGAATGC
CAGACGCTGGATCTTGTCAAGTTGAACGTTCGGCTGTCCGACACGTCGAACGAGGTGGTCATCAGGAGCGACGCC
GTCGTACGCGATTTGATGCGCGATCTCCGTCACGCATCGCCGCAGTTGTTTCGGGTCTGCGAGTCAATAGCGTTT
GTCGACATGATTGCCTCGTTTGCCCAGCTGGCCACAGTTCGAGACTACGTTCGGCCAGAAATCACGGACACTCTG
GCATTAAAGTCGGCACGGCATCCGATTCTGGACAAGGTGAGGAGGCAAAGCGAGGTTCTTTCCAGGGGTCCTGAC
GGCTTACTTCGCTGCAGACCCTCTGTGGGAGCTATGTTCCCAACGACTACTATGCCACGGAGCAGTACTGCTTTC
ACATAGTCACAGGCTGCAACATGAGCGGGAAAAGCACTTACATCCGCGCCGTGGCTCTTCTCCAGATCATGGCAC
AGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail