Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1802
Gene name
LocationContig_1407:978..2992
Strand-
Gene length (bp)2014
Transcript length (bp)1818
Coding sequence length (bp)1818
Protein length (aa) 606

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00860 Xan_ur_permease Permease family 3.4E-23 80 254
PF00860 Xan_ur_permease Permease family 1.6E-38 276 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07307|UAPA_EMENI Uric acid-xanthine permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uapA PE=1 SV=3 1 562 0.0E+00
sp|P48777|UAPC_EMENI Purine permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uapC PE=2 SV=2 27 545 0.0E+00
sp|Q9HE12|YI31_SCHPO Putative purine permease C1399.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.01c PE=3 SV=1 20 574 0.0E+00
sp|P0AGN2|XANP_SHIFL Xanthine permease XanP OS=Shigella flexneri GN=xanP PE=3 SV=1 58 561 7.0E-52
sp|P0AGM9|XANP_ECOLI Xanthine permease XanP OS=Escherichia coli (strain K12) GN=xanP PE=1 SV=1 58 561 7.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07307|UAPA_EMENI Uric acid-xanthine permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uapA PE=1 SV=3 1 562 0.0E+00
sp|P48777|UAPC_EMENI Purine permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uapC PE=2 SV=2 27 545 0.0E+00
sp|Q9HE12|YI31_SCHPO Putative purine permease C1399.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.01c PE=3 SV=1 20 574 0.0E+00
sp|P0AGN2|XANP_SHIFL Xanthine permease XanP OS=Shigella flexneri GN=xanP PE=3 SV=1 58 561 7.0E-52
sp|P0AGM9|XANP_ECOLI Xanthine permease XanP OS=Escherichia coli (strain K12) GN=xanP PE=1 SV=1 58 561 7.0E-52
sp|P0AGN0|XANP_ECOL6 Xanthine permease XanP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=xanP PE=3 SV=1 58 561 7.0E-52
sp|P0AGN1|XANP_ECO57 Xanthine permease XanP OS=Escherichia coli O157:H7 GN=xanP PE=3 SV=1 58 561 7.0E-52
sp|P67444|XANQ_ECOLI Xanthine permease XanQ OS=Escherichia coli (strain K12) GN=xanQ PE=1 SV=2 68 515 3.0E-47
sp|P67445|XANQ_ECOL6 Xanthine permease XanQ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=xanQ PE=3 SV=2 68 515 3.0E-47
sp|P67446|XANQ_ECO57 Xanthine permease XanQ OS=Escherichia coli O157:H7 GN=xanQ PE=3 SV=2 68 515 3.0E-47
sp|P50487|Y397_CLOPE Putative purine permease CPE0397 OS=Clostridium perfringens (strain 13 / Type A) GN=cpx PE=3 SV=3 60 563 2.0E-38
sp|O32140|PUCK_BACSU Uric acid permease PucK OS=Bacillus subtilis (strain 168) GN=pucK PE=2 SV=1 70 529 1.0E-33
sp|P42086|PBUX_BACSU Xanthine permease OS=Bacillus subtilis (strain 168) GN=pbuX PE=3 SV=1 80 567 1.0E-31
sp|Q46821|UACT_ECOLI Uric acid transporter UacT OS=Escherichia coli (strain K12) GN=uacT PE=1 SV=2 80 517 5.0E-28
sp|P0AGM7|URAA_ECOLI Uracil permease OS=Escherichia coli (strain K12) GN=uraA PE=1 SV=1 69 499 6.0E-16
sp|P0AGM8|URAA_ECO57 Uracil permease OS=Escherichia coli O157:H7 GN=uraA PE=3 SV=1 69 499 6.0E-16
sp|O32139|PUCJ_BACSU Uric acid permease PucJ OS=Bacillus subtilis (strain 168) GN=pucJ PE=2 SV=1 82 571 2.0E-15
sp|P75892|RUTG_ECOLI Putative pyrimidine permease RutG OS=Escherichia coli (strain K12) GN=rutG PE=1 SV=2 71 485 1.0E-10
sp|P93039|NAT4_ARATH Nucleobase-ascorbate transporter 4 OS=Arabidopsis thaliana GN=NAT4 PE=2 SV=2 80 556 3.0E-09
sp|Q9CPL9|URAA_PASMU Probable uracil permease OS=Pasteurella multocida (strain Pm70) GN=uraA PE=3 SV=1 300 565 1.0E-08
sp|P45117|URAA_HAEIN Probable uracil permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uraA PE=3 SV=1 300 565 2.0E-08
sp|Q0WPE9|NAT7_ARATH Nucleobase-ascorbate transporter 7 OS=Arabidopsis thaliana GN=NAT7 PE=2 SV=2 79 516 3.0E-08
sp|Q27GI3|NAT6_ARATH Nucleobase-ascorbate transporter 6 OS=Arabidopsis thaliana GN=NAT6 PE=2 SV=2 79 516 3.0E-08
sp|P39766|PYRP_BACSU Uracil permease OS=Bacillus subtilis (strain 168) GN=pyrP PE=1 SV=2 295 567 6.0E-08
sp|Q8VZQ5|NAT8_ARATH Nucleobase-ascorbate transporter 8 OS=Arabidopsis thaliana GN=NAT8 PE=2 SV=1 80 559 3.0E-07
sp|Q9SHZ3|NAT1_ARATH Nucleobase-ascorbate transporter 1 OS=Arabidopsis thaliana GN=NAT1 PE=2 SV=1 56 563 3.0E-07
sp|Q9UHI7|S23A1_HUMAN Solute carrier family 23 member 1 OS=Homo sapiens GN=SLC23A1 PE=1 SV=3 349 515 5.0E-07
sp|Q9Z2J0|S23A1_MOUSE Solute carrier family 23 member 1 OS=Mus musculus GN=Slc23a1 PE=1 SV=2 368 515 1.0E-06
sp|Q9WTW7|S23A1_RAT Solute carrier family 23 member 1 OS=Rattus norvegicus GN=Slc23a1 PE=2 SV=1 368 515 1.0E-06
sp|Q41760|LPE1_MAIZE Nucleobase-ascorbate transporter LPE1 OS=Zea mays GN=LPE1 PE=1 SV=2 64 552 2.0E-06
sp|B0JZG0|S23A2_XENTR Solute carrier family 23 member 2 OS=Xenopus tropicalis GN=slc23a2 PE=2 SV=1 68 516 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 77 99 22
2 114 136 22
3 143 165 22
4 191 213 22
5 215 237 22
6 275 297 22
7 310 332 22
8 347 366 19
9 437 459 22
10 463 482 19
11 495 514 19
12 534 556 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1802
MDEDSGPSAIVAHAGAPAGRAAAVRARLRAVFRTFTTRRGLVGDYDYGFLFRPNLPFMAKSRDRSPFFGLDDRMP
VLLALLLGLQHALAMLAGIITPPIILSGSAGANLEPAQQQYLVSTALIVSGILSSIQINRFRIPKTRYFLGTGVL
SVVGVSFSIIPIAQGAFRQMYANGYCPTDDGGNRLPCPKGYGALIGTGSVCALVEVLISFLPARILLRMFPPIVT
GPTVMLIGIHLVGSGFKDWLGGSGQCSDPDSAGNQRDFFAKCPDITAPHALPWGSAEFLGLGFSAFVTIILCERF
GSPIMKSTSVVIGLIVGCIIAGASGYFDGSGIGAAPVASFIWTKTFPLTVYGPLVLPIMAVFVLAATEGVGDITA
TCDVSRLEVEGRDYESRIQGGLLTDGLNGIVAALMTMTPMTRFAQNNGVIALTRCANRTAGLACCFLLVILGVFA
KLAAALVAIPKPVLGGMTTFLFGSVAVSGIAIMVRGVPFDRRSRFILTTGLSLGYGATLVPNYFEHVFTYSGDNH
ALEGFLNAIVLVMETGFAVTAAVCMLLNLVLAPEMEEEIDAAAVELKNGEVVTTTTTVVKGREDDEVWTSASSSG
RPSPR*
Coding >Hirsu2|1802
ATGGACGAAGACAGTGGCCCGAGCGCCATTGTTGCCCACGCCGGCGCCCCGGCCGGCAGAGCCGCCGCGGTCCGG
GCCCGGCTCCGGGCCGTCTTCCGAACCTTCACCACCCGCCGCGGCCTCGTCGGCGACTACGACTACGGCTTCCTC
TTCCGCCCCAACCTGCCCTTCATGGCCAAGTCGCGCGACCGGAGTCCCTTCTTCGGCCTCGACGACCGCATGCCC
GTCCTGCTCGCGTTGCTTCTCGGCCTCCAGCACGCCCTCGCCATGCTCGCCGGCATCATCACGCCCCCCATCATC
CTCAGCGGCAGCGCCGGTGCCAACCTGGAGCCCGCCCAGCAGCAGTATCTCGTCTCGACCGCCCTCATCGTGTCC
GGCATTCTCTCCAGCATCCAGATCAACCGCTTCCGCATCCCCAAGACGCGCTACTTTCTCGGAACCGGTGTCCTC
TCCGTCGTCGGCGTCTCCTTCAGCATCATCCCCATCGCGCAAGGGGCCTTCCGTCAGATGTACGCCAACGGTTAC
TGTCCGACCGACGACGGCGGCAACCGCCTGCCGTGCCCCAAGGGCTACGGCGCCCTCATCGGCACCGGCTCCGTC
TGTGCGCTCGTCGAGGTCCTCATCTCCTTCCTCCCGGCCCGCATCCTGCTCCGCATGTTTCCGCCCATCGTCACC
GGACCGACGGTCATGCTCATCGGCATCCACCTGGTCGGGAGCGGCTTCAAGGACTGGCTGGGCGGCAGCGGCCAG
TGCTCGGACCCGGACTCGGCCGGCAACCAGCGCGACTTCTTCGCGAAATGTCCCGACATCACGGCCCCGCACGCC
CTGCCGTGGGGGTCTGCCGAGTTCCTCGGCCTCGGTTTCTCCGCCTTCGTCACCATCATCCTGTGCGAGCGCTTC
GGGTCGCCCATCATGAAGTCGACGTCGGTGGTCATCGGCCTCATCGTCGGCTGCATCATCGCCGGCGCCAGCGGG
TACTTCGACGGCTCCGGCATCGGGGCCGCGCCCGTCGCCTCGTTCATCTGGACCAAGACGTTTCCGCTGACCGTC
TACGGGCCGCTGGTGTTGCCCATCATGGCCGTCTTCGTCCTCGCGGCGACGGAGGGCGTCGGCGACATAACGGCG
ACGTGCGACGTTTCGCGGCTCGAGGTGGAGGGCCGCGACTACGAGTCGCGCATCCAGGGCGGCCTGCTGACGGAC
GGGCTCAACGGAATAGTGGCCGCGCTCATGACCATGACGCCCATGACGCGCTTCGCGCAGAACAACGGCGTGATC
GCGCTGACACGGTGCGCCAACCGCACGGCCGGCCTGGCCTGCTGCTTCCTGCTCGTCATCCTGGGCGTCTTCGCC
AAGCTGGCCGCCGCCCTCGTGGCCATCCCCAAGCCCGTACTGGGGGGGATGACGACGTTTCTGTTCGGGTCCGTC
GCCGTCTCCGGAATCGCCATCATGGTGCGCGGCGTGCCGTTTGACCGGAGGAGCCGCTTCATCCTCACGACCGGC
CTGTCGCTCGGGTACGGGGCCACGCTCGTGCCCAATTACTTCGAACACGTCTTCACCTACTCGGGCGACAACCAC
GCGCTCGAGGGCTTCCTCAACGCCATTGTGCTCGTCATGGAGACGGGCTTCGCGGTGACGGCGGCCGTGTGCATG
CTCCTGAATCTGGTGCTGGCGCCGGAGATGGAGGAAGAGATCGATGCGGCGGCGGTCGAGCTGAAGAATGGCGAG
GTGGTGACGACGACGACGACCGTGGTCAAGGGCCGAGAAGACGACGAGGTCTGGACGAGCGCTTCCTCGTCGGGG
AGGCCGTCGCCGAGATGA
Transcript >Hirsu2|1802
ATGGACGAAGACAGTGGCCCGAGCGCCATTGTTGCCCACGCCGGCGCCCCGGCCGGCAGAGCCGCCGCGGTCCGG
GCCCGGCTCCGGGCCGTCTTCCGAACCTTCACCACCCGCCGCGGCCTCGTCGGCGACTACGACTACGGCTTCCTC
TTCCGCCCCAACCTGCCCTTCATGGCCAAGTCGCGCGACCGGAGTCCCTTCTTCGGCCTCGACGACCGCATGCCC
GTCCTGCTCGCGTTGCTTCTCGGCCTCCAGCACGCCCTCGCCATGCTCGCCGGCATCATCACGCCCCCCATCATC
CTCAGCGGCAGCGCCGGTGCCAACCTGGAGCCCGCCCAGCAGCAGTATCTCGTCTCGACCGCCCTCATCGTGTCC
GGCATTCTCTCCAGCATCCAGATCAACCGCTTCCGCATCCCCAAGACGCGCTACTTTCTCGGAACCGGTGTCCTC
TCCGTCGTCGGCGTCTCCTTCAGCATCATCCCCATCGCGCAAGGGGCCTTCCGTCAGATGTACGCCAACGGTTAC
TGTCCGACCGACGACGGCGGCAACCGCCTGCCGTGCCCCAAGGGCTACGGCGCCCTCATCGGCACCGGCTCCGTC
TGTGCGCTCGTCGAGGTCCTCATCTCCTTCCTCCCGGCCCGCATCCTGCTCCGCATGTTTCCGCCCATCGTCACC
GGACCGACGGTCATGCTCATCGGCATCCACCTGGTCGGGAGCGGCTTCAAGGACTGGCTGGGCGGCAGCGGCCAG
TGCTCGGACCCGGACTCGGCCGGCAACCAGCGCGACTTCTTCGCGAAATGTCCCGACATCACGGCCCCGCACGCC
CTGCCGTGGGGGTCTGCCGAGTTCCTCGGCCTCGGTTTCTCCGCCTTCGTCACCATCATCCTGTGCGAGCGCTTC
GGGTCGCCCATCATGAAGTCGACGTCGGTGGTCATCGGCCTCATCGTCGGCTGCATCATCGCCGGCGCCAGCGGG
TACTTCGACGGCTCCGGCATCGGGGCCGCGCCCGTCGCCTCGTTCATCTGGACCAAGACGTTTCCGCTGACCGTC
TACGGGCCGCTGGTGTTGCCCATCATGGCCGTCTTCGTCCTCGCGGCGACGGAGGGCGTCGGCGACATAACGGCG
ACGTGCGACGTTTCGCGGCTCGAGGTGGAGGGCCGCGACTACGAGTCGCGCATCCAGGGCGGCCTGCTGACGGAC
GGGCTCAACGGAATAGTGGCCGCGCTCATGACCATGACGCCCATGACGCGCTTCGCGCAGAACAACGGCGTGATC
GCGCTGACACGGTGCGCCAACCGCACGGCCGGCCTGGCCTGCTGCTTCCTGCTCGTCATCCTGGGCGTCTTCGCC
AAGCTGGCCGCCGCCCTCGTGGCCATCCCCAAGCCCGTACTGGGGGGGATGACGACGTTTCTGTTCGGGTCCGTC
GCCGTCTCCGGAATCGCCATCATGGTGCGCGGCGTGCCGTTTGACCGGAGGAGCCGCTTCATCCTCACGACCGGC
CTGTCGCTCGGGTACGGGGCCACGCTCGTGCCCAATTACTTCGAACACGTCTTCACCTACTCGGGCGACAACCAC
GCGCTCGAGGGCTTCCTCAACGCCATTGTGCTCGTCATGGAGACGGGCTTCGCGGTGACGGCGGCCGTGTGCATG
CTCCTGAATCTGGTGCTGGCGCCGGAGATGGAGGAAGAGATCGATGCGGCGGCGGTCGAGCTGAAGAATGGCGAG
GTGGTGACGACGACGACGACCGTGGTCAAGGGCCGAGAAGACGACGAGGTCTGGACGAGCGCTTCCTCGTCGGGG
AGGCCGTCGCCGAGATGA
Gene >Hirsu2|1802
ATGGACGAAGACAGTGGCCCGAGCGCCATTGTTGCCCACGCCGGCGCCCCGGCCGGCAGAGCCGCCGCGGTCCGG
GCCCGGCTCCGGGCCGTCTTCCGAACCTTCACCACCCGCCGCGGCCTCGTCGGCGACTACGACTACGGCTTCCTC
TTCCGCCCCAACCTGCCCTTCATGGCCAAGTCGCGCGACCGGAGTCCCTTCTTCGGCCTCGACGACCGCATGCCC
GTCCTGCTCGCGTTGCTTCTCGGCCTCCAGCACGCCCTCGCCATGCTCGCCGGCATCATCACGCCCCCCATCATC
CTCAGCGGCAGCGCCGGTGCCAACCTGGAGCCCGCCCAGCAGCAGTATCTCGTCTCGACCGCCCTCATCGTGTCC
GGCATTCTCTCCAGCATCCAGATCAACCGCTTCCGCATCCCCAAGACGCGGTGAGCTCCTCCCCCTGCATGTCCT
TCAGCGCGTCCCTCTTCGCCAGCCTCCTTCGCGTACATCCACCCCTATGCTGTACATGACAACACCCCTCCTTCC
ACGCCGCCCGCCGCTCGCAAGACCTTGTCGCTTGGCGTGCCGAAACCCGGAGTGGCCGAAGCTGACCGGGCCACC
GCCGTCTGCCGTCATCTCTAGCTACTTTCTCGGAACCGGTGTCCTCTCCGTCGTCGGCGTCTCCTTCAGCATCAT
CCCCATCGCGCAAGGGGCCTTCCGTCAGATGTACGCCAACGGTTACTGTCCGACCGACGACGGCGGCAACCGCCT
GCCGTGCCCCAAGGGCTACGGCGCCCTCATCGGCACCGGCTCCGTCTGTGCGCTCGTCGAGGTCCTCATCTCCTT
CCTCCCGGCCCGCATCCTGCTCCGCATGTTTCCGCCCATCGTCACCGGACCGACGGTCATGCTCATCGGCATCCA
CCTGGTCGGGAGCGGCTTCAAGGACTGGCTGGGCGGCAGCGGCCAGTGCTCGGACCCGGACTCGGCCGGCAACCA
GCGCGACTTCTTCGCGAAATGTCCCGACATCACGGCCCCGCACGCCCTGCCGTGGGGGTCTGCCGAGTTCCTCGG
CCTCGGTTTCTCCGCCTTCGTCACCATCATCCTGTGCGAGCGCTTCGGGTCGCCCATCATGAAGTCGACGTCGGT
GGTCATCGGCCTCATCGTCGGCTGCATCATCGCCGGCGCCAGCGGGTACTTCGACGGCTCCGGCATCGGGGCCGC
GCCCGTCGCCTCGTTCATCTGGACCAAGACGTTTCCGCTGACCGTCTACGGGCCGCTGGTGTTGCCCATCATGGC
CGTCTTCGTCCTCGCGGCGACGGAGGGCGTCGGCGACATAACGGCGACGTGCGACGTTTCGCGGCTCGAGGTGGA
GGGCCGCGACTACGAGTCGCGCATCCAGGGCGGCCTGCTGACGGACGGGCTCAACGGAATAGTGGCCGCGCTCAT
GACCATGACGCCCATGACGCGCTTCGCGCAGAACAACGGCGTGATCGCGCTGACACGGTGCGCCAACCGCACGGC
CGGCCTGGCCTGCTGCTTCCTGCTCGTCATCCTGGGCGTCTTCGCCAAGCTGGCCGCCGCCCTCGTGGCCATCCC
CAAGCCCGTACTGGGGGGGATGACGACGTTTCTGTTCGGGTCCGTCGCCGTCTCCGGAATCGCCATCATGGTGCG
CGGCGTGCCGTTTGACCGGAGGAGCCGCTTCATCCTCACGACCGGCCTGTCGCTCGGGTACGGGGCCACGCTCGT
GCCCAATTACTTCGAACACGTCTTCACCTACTCGGGCGACAACCACGCGCTCGAGGGCTTCCTCAACGCCATTGT
GCTCGTCATGGAGACGGGCTTCGCGGTGACGGCGGCCGTGTGCATGCTCCTGAATCTGGTGCTGGCGCCGGAGAT
GGAGGAAGAGATCGATGCGGCGGCGGTCGAGCTGAAGAATGGCGAGGTGGTGACGACGACGACGACCGTGGTCAA
GGGCCGAGAAGACGACGAGGTCTGGACGAGCGCTTCCTCGTCGGGGAGGCCGTCGCCGAGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail