Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1801
Gene name
LocationContig_1406:5720..6841
Strand-
Gene length (bp)1121
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.2E-19 2 291

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 2 309 5.0E-35
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 1 333 2.0E-28
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 1 308 1.0E-25
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 1 298 2.0E-08
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 3 298 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 2 309 5.0E-35
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 1 333 2.0E-28
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 1 308 1.0E-25
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 1 298 2.0E-08
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 3 298 3.0E-08
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 3 298 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 80 102 22
3 112 134 22
4 146 168 22
5 191 208 17
6 215 232 17
7 242 264 22
8 285 302 17
9 306 325 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1801
MASPVIGRLSDRYGRRTALLASMCGNMVSVLLWVVAVDFRTFVASRVIXXXXXXXXXXXXQLATAIASDISDDAS
RSPTMAIIGACFCVAFTFGPALGAWLSGVAVLAANPFALAAGFSLALVVVETAYLYLCLPETLPALXXXXXXXXX
XXXXXXXXXXXXFFLLFFSGMESSLSFMTYDLFGFGSSKNGRLLGFIGLVASLLQGGVTRRLAPLLSVRLGLVAC
LASFALLGRLSTVGGLYAAATCLAATSATVVTGLNALSSFDAAEDERGSKLGILRSWGQLGRGLGPVFFTSVYWW
AGREYAYNVGTTGILLVTAAVLVGLKTPKAAAKPK*
Coding >Hirsu2|1801
ATGGCCTCGCCCGTCATCGGCCGCCTCTCGGACCGCTACGGGCGGCGGACGGCGCTGCTGGCGTCCATGTGCGGC
AACATGGTGTCGGTGCTGCTGTGGGTGGTGGCCGTCGACTTCCGCACCTTCGTCGCCAGCCGCGTCATCGNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAGCTGGCGACGGCCATCGCCAGCGACATCTCGGACGACGCGTCG
CGCAGCCCGACCATGGCCATCATCGGCGCCTGCTTCTGCGTCGCCTTCACCTTCGGCCCGGCCCTGGGCGCCTGG
CTCAGCGGCGTCGCCGTCCTGGCCGCCAACCCCTTCGCCCTGGCCGCCGGCTTCAGCCTGGCCCTGGTCGTCGTC
GAGACGGCCTACCTCTACCTGTGCCTGCCCGAGACCCTGCCGGCGCTGCNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTTCTTCCTCCTCTTCTTCTCCGGCATGGAGAGCTCGCTG
TCCTTCATGACGTACGACCTGTTCGGCTTCGGCTCCAGCAAGAACGGCCGGCTGCTGGGCTTCATCGGCCTGGTC
GCGTCGCTGCTGCAGGGCGGCGTCACGCGCCGCCTGGCCCCGCTGCTGTCGGTCCGCCTCGGCCTCGTCGCCTGC
CTGGCCTCCTTCGCCCTGCTGGGCCGCCTCTCGACCGTCGGCGGCCTGTACGCGGCCGCCACCTGCCTGGCCGCC
ACCTCGGCCACCGTCGTCACCGGCCTCAACGCCCTGAGCAGCTTCGACGCCGCCGAGGACGAGCGCGGCAGCAAG
CTGGGCATCCTCCGCAGCTGGGGCCAGCTCGGCCGCGGCCTCGGGCCCGTCTTCTTCACCAGCGTCTACTGGTGG
GCCGGCCGCGAGTACGCCTACAACGTCGGCACCACCGGCATCCTCCTCGTCACCGCCGCCGTCCTGGTGGGGCTC
AAGACGCCCAAGGCGGCGGCCAAGCCCAAGTAG
Transcript >Hirsu2|1801
ATGGCCTCGCCCGTCATCGGCCGCCTCTCGGACCGCTACGGGCGGCGGACGGCGCTGCTGGCGTCCATGTGCGGC
AACATGGTGTCGGTGCTGCTGTGGGTGGTGGCCGTCGACTTCCGCACCTTCGTCGCCAGCCGCGTCATCGNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAGCTGGCGACGGCCATCGCCAGCGACATCTCGGACGACGCGTCG
CGCAGCCCGACCATGGCCATCATCGGCGCCTGCTTCTGCGTCGCCTTCACCTTCGGCCCGGCCCTGGGCGCCTGG
CTCAGCGGCGTCGCCGTCCTGGCCGCCAACCCCTTCGCCCTGGCCGCCGGCTTCAGCCTGGCCCTGGTCGTCGTC
GAGACGGCCTACCTCTACCTGTGCCTGCCCGAGACCCTGCCGGCGCTGCNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTTCTTCCTCCTCTTCTTCTCCGGCATGGAGAGCTCGCTG
TCCTTCATGACGTACGACCTGTTCGGCTTCGGCTCCAGCAAGAACGGCCGGCTGCTGGGCTTCATCGGCCTGGTC
GCGTCGCTGCTGCAGGGCGGCGTCACGCGCCGCCTGGCCCCGCTGCTGTCGGTCCGCCTCGGCCTCGTCGCCTGC
CTGGCCTCCTTCGCCCTGCTGGGCCGCCTCTCGACCGTCGGCGGCCTGTACGCGGCCGCCACCTGCCTGGCCGCC
ACCTCGGCCACCGTCGTCACCGGCCTCAACGCCCTGAGCAGCTTCGACGCCGCCGAGGACGAGCGCGGCAGCAAG
CTGGGCATCCTCCGCAGCTGGGGCCAGCTCGGCCGCGGCCTCGGGCCCGTCTTCTTCACCAGCGTCTACTGGTGG
GCCGGCCGCGAGTACGCCTACAACGTCGGCACCACCGGCATCCTCCTCGTCACCGCCGCCGTCCTGGTGGGGCTC
AAGACGCCCAAGGCGGCGGCCAAGCCCAAGTAG
Gene >Hirsu2|1801
ATGGCCTCGCCCGTCATCGGCCGCCTCTCGGACCGCTACGGGCGGCGGACGGCGCTGCTGGCGTCCATGTGCGGC
AACATGGTGTCGGTGCTGCTGTGGGTGGTGGCCGTCGACTTCCGCACCTTCGTCGCCAGCCGCGTCATCGNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAGCTGGCGACGGCCATCGCCAGCGACATCTCGGACGACGCGTCG
CGCAGCCCGACCATGGCCATCATCGGCGCCTGCTTCTGCGTCGCCTTCACCTTCGGCCCGGCCCTGGGCGCCTGG
CTCAGCGGCGTCGCCGTCCTGGCCGCCAACCCCTTCGCCCTGGCCGCCGGCTTCAGCCTGGCCCTGGTCGTCGTC
GAGACGGCCTACCTCTACCTGTGCCTGCCCGAGACCCTGCCGGCGCTGGTGGGCAACGACAAGAAGAAGAGGGAG
ACGGCGAACAAGACGGGGCGGGGCGGCGATGACGACGACGGGACCGCGAGCCCCGAGGCCGGCAAGGCCGCCGCC
GCCGCCGACAGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCT
TCTTCCTCCTCTTCTTCTCCGGCATGGAGAGCTCGCTGTCCTTCATGACGTACGACCTGTTCGGCTTCGGCTCCA
GCAAGAACGGCCGGCTGCTGGGCTTCATCGGCCTGGTCGCGTCGCTGCTGCAGGGCGGCGTCACGCGCCGCCTGG
CCCCGCTGCTGTCGGTCCGCCTCGGCCTCGTCGCCTGCCTGGCCTCCTTCGCCCTGCTGGGCCGCCTCTCGACCG
TCGGCGGCCTGTACGCGGCCGCCACCTGCCTGGCCGCCACCTCGGCCACCGTCGTCACCGGCCTCAACGCCCTGA
GCAGCTTCGACGCCGCCGAGGACGAGCGCGGCAGCAAGCTGGGCATCCTCCGCAGCTGGGGCCAGCTCGGCCGCG
GCCTCGGGCCCGTCTTCTTCACCAGCGTCTACTGGTGGGCCGGCCGCGAGTACGCCTACAACGTCGGCACCACCG
GCATCCTCCTCGTCACCGCCGCCGTCCTGGTGGGGCTCAAGACGCCCAAGGCGGCGGCCAAGCCCAAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail