Protein ID | Hirsu2|180 |
Gene name | |
Location | Contig_103:13107..13871 |
Strand | - |
Gene length (bp) | 764 |
Transcript length (bp) | 687 |
Coding sequence length (bp) | 687 |
Protein length (aa) | 229 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00475 | IGPD | Imidazoleglycerol-phosphate dehydratase | 5.3E-59 | 62 | 205 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9HEG3|HIS7_NEUCR | Imidazoleglycerol-phosphate dehydratase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=65E11.030 PE=3 SV=1 | 8 | 227 | 7.0E-127 |
sp|P34041|HIS7_TRIHA | Imidazoleglycerol-phosphate dehydratase OS=Trichoderma harzianum GN=his3 PE=2 SV=1 | 1 | 206 | 4.0E-117 |
sp|O42621|HIS7_MAGO7 | Imidazoleglycerol-phosphate dehydratase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PTH3 PE=3 SV=2 | 5 | 227 | 4.0E-113 |
sp|P06633|HIS7_YEAST | Imidazoleglycerol-phosphate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS3 PE=1 SV=2 | 6 | 226 | 8.0E-98 |
sp|Q9C1D4|HIS7_PICST | Imidazoleglycerol-phosphate dehydratase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HIS3 PE=3 SV=2 | 7 | 226 | 8.0E-98 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9HEG3|HIS7_NEUCR | Imidazoleglycerol-phosphate dehydratase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=65E11.030 PE=3 SV=1 | 8 | 227 | 7.0E-127 |
sp|P34041|HIS7_TRIHA | Imidazoleglycerol-phosphate dehydratase OS=Trichoderma harzianum GN=his3 PE=2 SV=1 | 1 | 206 | 4.0E-117 |
sp|O42621|HIS7_MAGO7 | Imidazoleglycerol-phosphate dehydratase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PTH3 PE=3 SV=2 | 5 | 227 | 4.0E-113 |
sp|P06633|HIS7_YEAST | Imidazoleglycerol-phosphate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS3 PE=1 SV=2 | 6 | 226 | 8.0E-98 |
sp|Q9C1D4|HIS7_PICST | Imidazoleglycerol-phosphate dehydratase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HIS3 PE=3 SV=2 | 7 | 226 | 8.0E-98 |
sp|P56090|HIS7_CANAX | Imidazoleglycerol-phosphate dehydratase OS=Candida albicans GN=HIS3 PE=3 SV=1 | 7 | 227 | 8.0E-97 |
sp|Q6CLR6|HIS7_KLULA | Imidazoleglycerol-phosphate dehydratase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIS3 PE=3 SV=1 | 8 | 226 | 1.0E-96 |
sp|Q92447|HIS7_PICPA | Imidazoleglycerol-phosphate dehydratase OS=Komagataella pastoris GN=HIS3 PE=3 SV=1 | 8 | 226 | 5.0E-96 |
sp|Q02986|HIS7_LACK1 | Imidazoleglycerol-phosphate dehydratase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=HIS3 PE=3 SV=1 | 8 | 226 | 8.0E-95 |
sp|H9C4A4|HIS7_CANHU | Imidazoleglycerol-phosphate dehydratase OS=Candida humilis GN=HIS3 PE=1 SV=1 | 6 | 226 | 5.0E-94 |
sp|Q6XD66|HIS7_TORDE | Imidazoleglycerol-phosphate dehydratase OS=Torulaspora delbrueckii GN=HIS3 PE=3 SV=1 | 6 | 226 | 5.0E-94 |
sp|Q9UVE1|HIS7_ZYGRC | Imidazoleglycerol-phosphate dehydratase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HIS3 PE=3 SV=2 | 10 | 226 | 3.0E-93 |
sp|Q96UK2|HIS7_ZYGBA | Imidazoleglycerol-phosphate dehydratase OS=Zygosaccharomyces bailii GN=HIS3 PE=2 SV=1 | 10 | 226 | 2.0E-91 |
sp|Q75B47|HIS7_ASHGO | Imidazoleglycerol-phosphate dehydratase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HIS3 PE=3 SV=2 | 5 | 226 | 8.0E-91 |
sp|Q12578|HIS7_CANGA | Imidazoleglycerol-phosphate dehydratase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HIS3 PE=3 SV=2 | 10 | 226 | 4.0E-90 |
sp|O94126|HIS7_CYBJA | Imidazoleglycerol-phosphate dehydratase OS=Cyberlindnera jadinii GN=HIS3 PE=3 SV=1 | 8 | 226 | 7.0E-89 |
sp|Q6JV40|HIS7_KLUMA | Imidazoleglycerol-phosphate dehydratase OS=Kluyveromyces marxianus GN=HIS3 PE=3 SV=1 | 8 | 226 | 3.0E-88 |
sp|P40374|HIS7_SCHPO | Imidazoleglycerol-phosphate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his5 PE=1 SV=1 | 8 | 226 | 1.0E-87 |
sp|P0CO22|HIS7_CRYNJ | Imidazoleglycerol-phosphate dehydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIS3 PE=1 SV=1 | 6 | 226 | 7.0E-76 |
sp|P0CO23|HIS7_CRYNB | Imidazoleglycerol-phosphate dehydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIS3 PE=3 SV=1 | 6 | 226 | 7.0E-76 |
sp|O94153|HIS7_PHARH | Imidazoleglycerol-phosphate dehydratase OS=Phaffia rhodozyma GN=HIS3 PE=3 SV=1 | 1 | 226 | 3.0E-74 |
sp|P28624|HIS7_PHYPR | Imidazoleglycerol-phosphate dehydratase OS=Phytophthora parasitica GN=HIS3 PE=3 SV=1 | 5 | 226 | 9.0E-60 |
sp|B0V8S1|HIS7_ACIBY | Imidazoleglycerol-phosphate dehydratase OS=Acinetobacter baumannii (strain AYE) GN=hisB PE=3 SV=1 | 4 | 226 | 6.0E-58 |
sp|B0VPC2|HIS7_ACIBS | Imidazoleglycerol-phosphate dehydratase OS=Acinetobacter baumannii (strain SDF) GN=hisB PE=3 SV=1 | 4 | 226 | 7.0E-58 |
sp|Q6F7A8|HIS7_ACIAD | Imidazoleglycerol-phosphate dehydratase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisB PE=3 SV=1 | 4 | 226 | 3.0E-57 |
sp|A5V9V7|HIS7_SPHWW | Imidazoleglycerol-phosphate dehydratase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-56 |
sp|B1LU98|HIS7_METRJ | Imidazoleglycerol-phosphate dehydratase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-56 |
sp|A7NQZ5|HIS7_ROSCS | Imidazoleglycerol-phosphate dehydratase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=hisB PE=3 SV=1 | 8 | 226 | 7.0E-56 |
sp|Q5NMD3|HIS7_ZYMMO | Imidazoleglycerol-phosphate dehydratase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisB PE=3 SV=2 | 8 | 226 | 1.0E-55 |
sp|A0LBT6|HIS7_MAGMM | Imidazoleglycerol-phosphate dehydratase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=hisB PE=3 SV=1 | 7 | 227 | 2.0E-55 |
sp|A5USC4|HIS7_ROSS1 | Imidazoleglycerol-phosphate dehydratase OS=Roseiflexus sp. (strain RS-1) GN=hisB PE=3 SV=1 | 5 | 226 | 3.0E-55 |
sp|Q1GNC0|HIS7_SPHAL | Imidazoleglycerol-phosphate dehydratase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-55 |
sp|Q2N8I5|HIS7_ERYLH | Imidazoleglycerol-phosphate dehydratase OS=Erythrobacter litoralis (strain HTCC2594) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-55 |
sp|Q2VYI7|HIS7_MAGSA | Imidazoleglycerol-phosphate dehydratase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=hisB PE=3 SV=2 | 8 | 226 | 5.0E-55 |
sp|Q31E67|HIS7_THICR | Imidazoleglycerol-phosphate dehydratase OS=Thiomicrospira crunogena (strain XCL-2) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-53 |
sp|B3PGA1|HIS7_CELJU | Imidazoleglycerol-phosphate dehydratase OS=Cellvibrio japonicus (strain Ueda107) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-53 |
sp|Q5FTN7|HIS7_GLUOX | Imidazoleglycerol-phosphate dehydratase OS=Gluconobacter oxydans (strain 621H) GN=hisB PE=3 SV=1 | 5 | 226 | 6.0E-53 |
sp|B8EM89|HIS7_METSB | Imidazoleglycerol-phosphate dehydratase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-53 |
sp|A2SE06|HIS7_METPP | Imidazoleglycerol-phosphate dehydratase OS=Methylibium petroleiphilum (strain PM1) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-53 |
sp|Q1H4R5|HIS7_METFK | Imidazoleglycerol-phosphate dehydratase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-52 |
sp|P18787|HIS7_AZOBR | Imidazoleglycerol-phosphate dehydratase OS=Azospirillum brasilense GN=hisB PE=3 SV=1 | 9 | 226 | 1.0E-52 |
sp|A4G9I9|HIS7_HERAR | Imidazoleglycerol-phosphate dehydratase OS=Herminiimonas arsenicoxydans GN=hisB PE=3 SV=1 | 5 | 226 | 2.0E-52 |
sp|Q1R077|HIS7_CHRSD | Imidazoleglycerol-phosphate dehydratase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-52 |
sp|B1ZAD1|HIS7_METPB | Imidazoleglycerol-phosphate dehydratase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-52 |
sp|Q9A232|HIS7_CAUCR | Imidazoleglycerol-phosphate dehydratase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisB PE=3 SV=1 | 7 | 226 | 5.0E-52 |
sp|B8GW12|HIS7_CAUCN | Imidazoleglycerol-phosphate dehydratase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hisB PE=3 SV=1 | 7 | 226 | 5.0E-52 |
sp|Q21NH8|HIS7_SACD2 | Imidazoleglycerol-phosphate dehydratase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-52 |
sp|Q8KY27|HIS7_AMIAM | Imidazoleglycerol-phosphate dehydratase OS=Aminomonas aminovorus GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-52 |
sp|A3PB03|HIS7_PROM0 | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9301) GN=hisB PE=3 SV=1 | 5 | 226 | 8.0E-52 |
sp|B7KPM4|HIS7_METC4 | Imidazoleglycerol-phosphate dehydratase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-51 |
sp|A9W5T6|HIS7_METEP | Imidazoleglycerol-phosphate dehydratase OS=Methylobacterium extorquens (strain PA1) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-51 |
sp|Q2S2A1|HIS7_SALRD | Imidazoleglycerol-phosphate dehydratase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hisB PE=3 SV=1 | 4 | 226 | 2.0E-51 |
sp|A6T379|HIS7_JANMA | Imidazoleglycerol-phosphate dehydratase OS=Janthinobacterium sp. (strain Marseille) GN=hisB PE=3 SV=1 | 5 | 226 | 2.0E-51 |
sp|Q9HU41|HIS7_PSEAE | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-51 |
sp|Q02EM2|HIS7_PSEAB | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-51 |
sp|B7V3N7|HIS7_PSEA8 | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas aeruginosa (strain LESB58) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-51 |
sp|A6VDR3|HIS7_PSEA7 | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas aeruginosa (strain PA7) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-51 |
sp|A1VK39|HIS7_POLNA | Imidazoleglycerol-phosphate dehydratase OS=Polaromonas naphthalenivorans (strain CJ2) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-51 |
sp|Q31CQ1|HIS7_PROM9 | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9312) GN=hisB PE=3 SV=1 | 5 | 226 | 6.0E-51 |
sp|A2BP81|HIS7_PROMS | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain AS9601) GN=hisB PE=3 SV=1 | 5 | 226 | 6.0E-51 |
sp|A3PI66|HIS7_RHOS1 | Imidazoleglycerol-phosphate dehydratase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-51 |
sp|Q7V314|HIS7_PROMP | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hisB PE=3 SV=1 | 5 | 226 | 7.0E-51 |
sp|A5CVR1|HIS7_VESOH | Imidazoleglycerol-phosphate dehydratase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hisB PE=3 SV=1 | 12 | 226 | 7.0E-51 |
sp|A4VRW2|HIS7_PSEU5 | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas stutzeri (strain A1501) GN=hisB PE=3 SV=1 | 6 | 226 | 1.0E-50 |
sp|Q46CW9|HIS7_METBF | Imidazoleglycerol-phosphate dehydratase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-50 |
sp|A5E8F1|HIS7_BRASB | Imidazoleglycerol-phosphate dehydratase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-50 |
sp|Q12FD0|HIS7_POLSJ | Imidazoleglycerol-phosphate dehydratase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=hisB PE=3 SV=1 | 1 | 226 | 2.0E-50 |
sp|Q3SWE7|HIS7_NITWN | Imidazoleglycerol-phosphate dehydratase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-50 |
sp|A9GZY1|HIS7_GLUDA | Imidazoleglycerol-phosphate dehydratase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=hisB PE=3 SV=1 | 6 | 226 | 2.0E-50 |
sp|Q8ESR9|HIS7_OCEIH | Imidazoleglycerol-phosphate dehydratase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-50 |
sp|B5EQE9|HIS7_ACIF5 | Imidazoleglycerol-phosphate dehydratase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=hisB PE=3 SV=1 | 8 | 227 | 2.0E-50 |
sp|B7JA16|HIS7_ACIF2 | Imidazoleglycerol-phosphate dehydratase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=hisB PE=3 SV=1 | 8 | 227 | 2.0E-50 |
sp|Q5P792|HIS7_AROAE | Imidazoleglycerol-phosphate dehydratase OS=Aromatoleum aromaticum (strain EbN1) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-50 |
sp|A8G2U2|HIS7_PROM2 | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9215) GN=hisB PE=3 SV=1 | 5 | 226 | 2.0E-50 |
sp|B0T7A1|HIS7_CAUSK | Imidazoleglycerol-phosphate dehydratase OS=Caulobacter sp. (strain K31) GN=hisB PE=3 SV=1 | 7 | 226 | 4.0E-50 |
sp|Q2YAU7|HIS7_NITMU | Imidazoleglycerol-phosphate dehydratase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-50 |
sp|B2SZ63|HIS7_BURPP | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-50 |
sp|Q7VSY9|HIS7_BORPE | Imidazoleglycerol-phosphate dehydratase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisB PE=3 SV=2 | 8 | 226 | 5.0E-50 |
sp|Q7W2Y2|HIS7_BORPA | Imidazoleglycerol-phosphate dehydratase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-50 |
sp|Q7WDY2|HIS7_BORBR | Imidazoleglycerol-phosphate dehydratase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-50 |
sp|Q13TQ6|HIS7_BURXL | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia xenovorans (strain LB400) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-50 |
sp|B9KPD2|HIS7_RHOSK | Imidazoleglycerol-phosphate dehydratase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-50 |
sp|O33564|HIS7_RHOS4 | Imidazoleglycerol-phosphate dehydratase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisB PE=3 SV=2 | 8 | 226 | 6.0E-50 |
sp|C1DJC9|HIS7_AZOVD | Imidazoleglycerol-phosphate dehydratase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-50 |
sp|Q4KJS8|HIS7_PSEF5 | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-50 |
sp|A1KAV7|HIS7_AZOSB | Imidazoleglycerol-phosphate dehydratase OS=Azoarcus sp. (strain BH72) GN=hisB PE=3 SV=2 | 8 | 226 | 8.0E-50 |
sp|A2BUR2|HIS7_PROM5 | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9515) GN=hisB PE=3 SV=1 | 5 | 226 | 8.0E-50 |
sp|Q4FNT4|HIS7_PELUB | Imidazoleglycerol-phosphate dehydratase OS=Pelagibacter ubique (strain HTCC1062) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-49 |
sp|C5BMF2|HIS7_TERTT | Imidazoleglycerol-phosphate dehydratase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-49 |
sp|A4X9Q4|HIS7_SALTO | Imidazoleglycerol-phosphate dehydratase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=hisB PE=3 SV=1 | 7 | 226 | 1.0E-49 |
sp|A8LX62|HIS7_SALAI | Imidazoleglycerol-phosphate dehydratase OS=Salinispora arenicola (strain CNS-205) GN=hisB PE=3 SV=1 | 7 | 226 | 1.0E-49 |
sp|Q2KTT4|HIS7_BORA1 | Imidazoleglycerol-phosphate dehydratase OS=Bordetella avium (strain 197N) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-49 |
sp|Q3KJI9|HIS7_PSEPF | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-49 |
sp|Q8PWS1|HIS7_METMA | Imidazoleglycerol-phosphate dehydratase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-49 |
sp|Q89WM8|HIS7_BRADU | Imidazoleglycerol-phosphate dehydratase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-49 |
sp|A7IHP3|HIS7_XANP2 | Imidazoleglycerol-phosphate dehydratase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-49 |
sp|A9HWC8|HIS7_BORPD | Imidazoleglycerol-phosphate dehydratase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-49 |
sp|Q2RNA4|HIS7_RHORT | Imidazoleglycerol-phosphate dehydratase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-49 |
sp|B3PWI5|HIS7_RHIE6 | Imidazoleglycerol-phosphate dehydratase OS=Rhizobium etli (strain CIAT 652) GN=hisB PE=3 SV=1 | 1 | 226 | 5.0E-49 |
sp|B2ICL6|HIS7_BEII9 | Imidazoleglycerol-phosphate dehydratase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-49 |
sp|Q5F7D6|HIS7_NEIG1 | Imidazoleglycerol-phosphate dehydratase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hisB PE=3 SV=2 | 3 | 228 | 5.0E-49 |
sp|A1KV07|HIS7_NEIMF | Imidazoleglycerol-phosphate dehydratase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=hisB PE=3 SV=1 | 3 | 228 | 5.0E-49 |
sp|P64371|HIS7_NEIMB | Imidazoleglycerol-phosphate dehydratase OS=Neisseria meningitidis serogroup B (strain MC58) GN=hisB PE=3 SV=1 | 3 | 228 | 5.0E-49 |
sp|P64370|HIS7_NEIMA | Imidazoleglycerol-phosphate dehydratase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hisB PE=3 SV=1 | 3 | 228 | 5.0E-49 |
sp|A9M186|HIS7_NEIM0 | Imidazoleglycerol-phosphate dehydratase OS=Neisseria meningitidis serogroup C (strain 053442) GN=hisB PE=3 SV=1 | 3 | 228 | 5.0E-49 |
sp|Q2KE56|HIS7_RHIEC | Imidazoleglycerol-phosphate dehydratase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=hisB PE=3 SV=1 | 1 | 226 | 6.0E-49 |
sp|B2UX23|HIS7_CLOBA | Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-49 |
sp|B1JED5|HIS7_PSEPW | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas putida (strain W619) GN=hisB PE=3 SV=1 | 8 | 226 | 7.0E-49 |
sp|A1U5H8|HIS7_MARHV | Imidazoleglycerol-phosphate dehydratase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-49 |
sp|B2JHY3|HIS7_BURP8 | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-49 |
sp|C3MBC5|HIS7_RHISN | Imidazoleglycerol-phosphate dehydratase OS=Rhizobium sp. (strain NGR234) GN=hisB PE=3 SV=1 | 1 | 226 | 9.0E-49 |
sp|B5ZV97|HIS7_RHILW | Imidazoleglycerol-phosphate dehydratase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=hisB PE=3 SV=1 | 1 | 226 | 9.0E-49 |
sp|Q1I3G4|HIS7_PSEE4 | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas entomophila (strain L48) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-48 |
sp|Q1QRX4|HIS7_NITHX | Imidazoleglycerol-phosphate dehydratase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-48 |
sp|A8HYU9|HIS7_AZOC5 | Imidazoleglycerol-phosphate dehydratase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-48 |
sp|Q1MNB6|HIS7_RHIL3 | Imidazoleglycerol-phosphate dehydratase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=hisB PE=3 SV=1 | 1 | 226 | 2.0E-48 |
sp|Q3AQD7|HIS7_CHLCH | Imidazoleglycerol-phosphate dehydratase OS=Chlorobium chlorochromatii (strain CaD3) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-48 |
sp|Q0VM69|HIS7_ALCBS | Imidazoleglycerol-phosphate dehydratase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hisB PE=3 SV=1 | 6 | 227 | 2.0E-48 |
sp|Q7P0F3|HIS7_CHRVO | Imidazoleglycerol-phosphate dehydratase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hisB PE=3 SV=1 | 8 | 228 | 2.0E-48 |
sp|A6LT19|HIS7_CLOB8 | Imidazoleglycerol-phosphate dehydratase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-48 |
sp|B2UEE9|HIS7_RALPJ | Imidazoleglycerol-phosphate dehydratase OS=Ralstonia pickettii (strain 12J) GN=hisB PE=3 SV=1 | 7 | 226 | 3.0E-48 |
sp|Q21CK7|HIS7_RHOPB | Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain BisB18) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-48 |
sp|A7HSH4|HIS7_PARL1 | Imidazoleglycerol-phosphate dehydratase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=hisB PE=3 SV=1 | 1 | 226 | 3.0E-48 |
sp|B1XSV0|HIS7_POLNS | Imidazoleglycerol-phosphate dehydratase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-48 |
sp|A4SV17|HIS7_POLSQ | Imidazoleglycerol-phosphate dehydratase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-48 |
sp|Q92TB0|HIS7_RHIME | Imidazoleglycerol-phosphate dehydratase OS=Rhizobium meliloti (strain 1021) GN=hisB PE=3 SV=1 | 1 | 226 | 4.0E-48 |
sp|P58878|HIS7_METAC | Imidazoleglycerol-phosphate dehydratase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-48 |
sp|C1DAK1|HIS7_LARHH | Imidazoleglycerol-phosphate dehydratase OS=Laribacter hongkongensis (strain HLHK9) GN=hisB PE=3 SV=1 | 8 | 228 | 5.0E-48 |
sp|Q8XV81|HIS7_RALSO | Imidazoleglycerol-phosphate dehydratase OS=Ralstonia solanacearum (strain GMI1000) GN=hisB PE=3 SV=1 | 7 | 226 | 5.0E-48 |
sp|A4Y087|HIS7_PSEMY | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas mendocina (strain ymp) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-48 |
sp|B2FPM1|HIS7_STRMK | Histidine biosynthesis bifunctional protein HisB OS=Stenotrophomonas maltophilia (strain K279a) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-48 |
sp|B4RBJ4|HIS7_PHEZH | Imidazoleglycerol-phosphate dehydratase OS=Phenylobacterium zucineum (strain HLK1) GN=hisB PE=3 SV=1 | 7 | 226 | 6.0E-48 |
sp|A6VTA8|HIS7_MARMS | Imidazoleglycerol-phosphate dehydratase OS=Marinomonas sp. (strain MWYL1) GN=hisB PE=3 SV=1 | 8 | 226 | 7.0E-48 |
sp|A6UEK7|HIS7_SINMW | Imidazoleglycerol-phosphate dehydratase OS=Sinorhizobium medicae (strain WSM419) GN=hisB PE=3 SV=1 | 1 | 226 | 1.0E-47 |
sp|Q18C69|HIS7_PEPD6 | Imidazoleglycerol-phosphate dehydratase OS=Peptoclostridium difficile (strain 630) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-47 |
sp|Q39K89|HIS7_BURL3 | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-47 |
sp|Q82WM4|HIS7_NITEU | Imidazoleglycerol-phosphate dehydratase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-47 |
sp|Q88R45|HIS7_PSEPK | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas putida (strain KT2440) GN=hisB PE=3 SV=2 | 8 | 226 | 2.0E-47 |
sp|A5VX72|HIS7_PSEP1 | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hisB PE=3 SV=2 | 8 | 226 | 2.0E-47 |
sp|Q21U94|HIS7_RHOFT | Imidazoleglycerol-phosphate dehydratase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-47 |
sp|Q3B4Y6|HIS7_CHLL7 | Imidazoleglycerol-phosphate dehydratase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisB PE=3 SV=1 | 3 | 226 | 3.0E-47 |
sp|B8GU29|HIS7_THISH | Imidazoleglycerol-phosphate dehydratase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hisB PE=3 SV=1 | 6 | 226 | 3.0E-47 |
sp|A4YJV1|HIS7_BRASO | Imidazoleglycerol-phosphate dehydratase OS=Bradyrhizobium sp. (strain ORS278) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-47 |
sp|Q03VX7|HIS7_LEUMM | Imidazoleglycerol-phosphate dehydratase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=hisB PE=3 SV=1 | 7 | 226 | 3.0E-47 |
sp|Q845V1|HIS7_BURM1 | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-47 |
sp|Q0AEU4|HIS7_NITEC | Imidazoleglycerol-phosphate dehydratase OS=Nitrosomonas eutropha (strain C91) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-47 |
sp|Q8DTQ9|HIS7_STRMU | Imidazoleglycerol-phosphate dehydratase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-47 |
sp|Q4ZLP8|HIS7_PSEU2 | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-47 |
sp|Q87UG0|HIS7_PSESM | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-47 |
sp|C3K6U9|HIS7_PSEFS | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas fluorescens (strain SBW25) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-47 |
sp|Q48C77|HIS7_PSE14 | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-47 |
sp|Q1LIA8|HIS7_CUPMC | Imidazoleglycerol-phosphate dehydratase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-47 |
sp|Q3JMZ8|HIS7_BURP1 | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia pseudomallei (strain 1710b) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-47 |
sp|Q46WL4|HIS7_CUPPJ | Imidazoleglycerol-phosphate dehydratase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-47 |
sp|Q2SUA4|HIS7_BURTA | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-47 |
sp|Q88UE0|HIS7_LACPL | Imidazoleglycerol-phosphate dehydratase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisB PE=3 SV=2 | 8 | 226 | 7.0E-47 |
sp|A1TKZ1|HIS7_ACIAC | Imidazoleglycerol-phosphate dehydratase OS=Acidovorax citrulli (strain AAC00-1) GN=hisB PE=3 SV=1 | 3 | 226 | 7.0E-47 |
sp|B3R798|HIS7_CUPTR | Imidazoleglycerol-phosphate dehydratase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-47 |
sp|Q0K689|HIS7_CUPNH | Imidazoleglycerol-phosphate dehydratase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-47 |
sp|B6JAL6|HIS7_OLICO | Imidazoleglycerol-phosphate dehydratase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-47 |
sp|Q0BIW8|HIS7_BURCM | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-47 |
sp|B1YRV7|HIS7_BURA4 | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia ambifaria (strain MC40-6) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-47 |
sp|A8LQZ6|HIS7_DINSH | Imidazoleglycerol-phosphate dehydratase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-47 |
sp|B4E637|HIS7_BURCJ | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-46 |
sp|B1JUA1|HIS7_BURCC | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia cenocepacia (strain MC0-3) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-46 |
sp|A4JAW5|HIS7_BURVG | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-46 |
sp|Q0W0J2|HIS7_METAR | Imidazoleglycerol-phosphate dehydratase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-46 |
sp|Q50504|HIS7_METTH | Imidazoleglycerol-phosphate dehydratase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisB PE=3 SV=1 | 6 | 226 | 1.0E-46 |
sp|Q3AD51|HIS7_CARHZ | Imidazoleglycerol-phosphate dehydratase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-46 |
sp|Q0A5D0|HIS7_ALKEH | Imidazoleglycerol-phosphate dehydratase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-46 |
sp|Q1GF01|HIS7_RUEST | Imidazoleglycerol-phosphate dehydratase OS=Ruegeria sp. (strain TM1040) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-46 |
sp|Q13E36|HIS7_RHOPS | Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain BisB5) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-46 |
sp|A0K3V4|HIS7_BURCH | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia cenocepacia (strain HI2424) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-46 |
sp|Q1BS27|HIS7_BURCA | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia cenocepacia (strain AU 1054) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-46 |
sp|Q2J344|HIS7_RHOP2 | Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain HaA2) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-46 |
sp|Q63Q88|HIS7_BURPS | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia pseudomallei (strain K96243) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-46 |
sp|A3NE97|HIS7_BURP6 | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia pseudomallei (strain 668) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-46 |
sp|A3P031|HIS7_BURP0 | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia pseudomallei (strain 1106a) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-46 |
sp|A1V8H1|HIS7_BURMS | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia mallei (strain SAVP1) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-46 |
sp|Q62GE1|HIS7_BURMA | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia mallei (strain ATCC 23344) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-46 |
sp|A2S750|HIS7_BURM9 | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia mallei (strain NCTC 10229) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-46 |
sp|A3MPU8|HIS7_BURM7 | Imidazoleglycerol-phosphate dehydratase OS=Burkholderia mallei (strain NCTC 10247) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-46 |
sp|A4WUS5|HIS7_RHOS5 | Imidazoleglycerol-phosphate dehydratase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-46 |
sp|Q11CL1|HIS7_CHESB | Imidazoleglycerol-phosphate dehydratase OS=Chelativorans sp. (strain BNC1) GN=hisB PE=3 SV=1 | 3 | 226 | 2.0E-46 |
sp|Q07UQ5|HIS7_RHOP5 | Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain BisA53) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-46 |
sp|B4STN9|HIS7_STRM5 | Histidine biosynthesis bifunctional protein HisB OS=Stenotrophomonas maltophilia (strain R551-3) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-46 |
sp|B3Q8C2|HIS7_RHOPT | Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain TIE-1) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-46 |
sp|B0KI41|HIS7_PSEPG | Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas putida (strain GB-1) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-46 |
sp|Q0C636|HIS7_HYPNA | Imidazoleglycerol-phosphate dehydratase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hisB PE=3 SV=1 | 3 | 226 | 6.0E-46 |
sp|Q5LU92|HIS7_RUEPO | Imidazoleglycerol-phosphate dehydratase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-46 |
sp|Q3SEU5|HIS7_THIDA | Imidazoleglycerol-phosphate dehydratase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-46 |
sp|B8G451|HIS7_CHLAD | Imidazoleglycerol-phosphate dehydratase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=hisB PE=3 SV=1 | 5 | 226 | 6.0E-46 |
sp|Q8EFB3|HIS7_SHEON | Histidine biosynthesis bifunctional protein HisB OS=Shewanella oneidensis (strain MR-1) GN=hisB PE=3 SV=1 | 5 | 226 | 7.0E-46 |
sp|A4XL23|HIS7_CALS8 | Imidazoleglycerol-phosphate dehydratase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=hisB PE=3 SV=1 | 6 | 226 | 7.0E-46 |
sp|P60887|HIS7_RHOPA | Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisB PE=3 SV=1 | 8 | 226 | 9.0E-46 |
sp|B3WED4|HIS7_LACCB | Imidazoleglycerol-phosphate dehydratase OS=Lactobacillus casei (strain BL23) GN=hisB PE=3 SV=1 | 51 | 226 | 9.0E-46 |
sp|B0K736|HIS7_THEP3 | Imidazoleglycerol-phosphate dehydratase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-45 |
sp|A4SF66|HIS7_CHLPM | Imidazoleglycerol-phosphate dehydratase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-45 |
sp|A9WDZ1|HIS7_CHLAA | Imidazoleglycerol-phosphate dehydratase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-45 |
sp|A1B384|HIS7_PARDP | Imidazoleglycerol-phosphate dehydratase OS=Paracoccus denitrificans (strain Pd 1222) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-45 |
sp|A5I242|HIS7_CLOBH | Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hisB PE=3 SV=1 | 10 | 226 | 3.0E-45 |
sp|A7FU78|HIS7_CLOB1 | Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hisB PE=3 SV=1 | 10 | 226 | 3.0E-45 |
sp|Q2G9M2|HIS7_NOVAD | Imidazoleglycerol-phosphate dehydratase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-45 |
sp|A6VJJ9|HIS7_METM7 | Imidazoleglycerol-phosphate dehydratase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-45 |
sp|Q2SMB5|HIS7_HAHCH | Imidazoleglycerol-phosphate dehydratase OS=Hahella chejuensis (strain KCTC 2396) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-45 |
sp|B3EDX3|HIS7_CHLL2 | Imidazoleglycerol-phosphate dehydratase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisB PE=3 SV=1 | 4 | 226 | 4.0E-45 |
sp|Q47AM0|HIS7_DECAR | Imidazoleglycerol-phosphate dehydratase OS=Dechloromonas aromatica (strain RCB) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-45 |
sp|Q9KSX1|HIS7_VIBCH | Histidine biosynthesis bifunctional protein HisB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisB PE=3 SV=1 | 4 | 226 | 7.0E-45 |
sp|A3DJF3|HIS7_CLOTH | Imidazoleglycerol-phosphate dehydratase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-45 |
sp|B1ILA6|HIS7_CLOBK | Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain Okra / Type B1) GN=hisB PE=3 SV=1 | 10 | 226 | 8.0E-45 |
sp|A1W432|HIS7_ACISJ | Imidazoleglycerol-phosphate dehydratase OS=Acidovorax sp. (strain JS42) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-45 |
sp|B9MDV5|HIS7_ACIET | Imidazoleglycerol-phosphate dehydratase OS=Acidovorax ebreus (strain TPSY) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-45 |
sp|Q5HKN9|HIS7_STAEQ | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisB PE=3 SV=1 | 52 | 226 | 1.0E-44 |
sp|P58877|HIS7_CALS4 | Imidazoleglycerol-phosphate dehydratase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-44 |
sp|Q87QK9|HIS7_VIBPA | Histidine biosynthesis bifunctional protein HisB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-44 |
sp|B4SD35|HIS7_PELPB | Imidazoleglycerol-phosphate dehydratase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-44 |
sp|Q15RU7|HIS7_PSEA6 | Histidine biosynthesis bifunctional protein HisB OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hisB PE=3 SV=1 | 5 | 226 | 2.0E-44 |
sp|Q039B2|HIS7_LACC3 | Imidazoleglycerol-phosphate dehydratase OS=Lactobacillus casei (strain ATCC 334) GN=hisB PE=3 SV=1 | 51 | 226 | 2.0E-44 |
sp|B2GBR2|HIS7_LACF3 | Imidazoleglycerol-phosphate dehydratase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-44 |
sp|A1WW08|HIS7_HALHL | Imidazoleglycerol-phosphate dehydratase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-44 |
sp|A7GDQ3|HIS7_CLOBL | Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=hisB PE=3 SV=1 | 10 | 226 | 2.0E-44 |
sp|Q12WC5|HIS7_METBU | Imidazoleglycerol-phosphate dehydratase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-44 |
sp|Q0BPW9|HIS7_GRABC | Imidazoleglycerol-phosphate dehydratase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-44 |
sp|Q82AA4|HIS7_STRAW | Imidazoleglycerol-phosphate dehydratase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-44 |
sp|Q18DL1|HIS7_HALWD | Imidazoleglycerol-phosphate dehydratase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hisB PE=3 SV=1 | 2 | 226 | 2.0E-44 |
sp|C1FN38|HIS7_CLOBJ | Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hisB PE=3 SV=1 | 10 | 226 | 3.0E-44 |
sp|Q03K79|HIS7_STRTD | Imidazoleglycerol-phosphate dehydratase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-44 |
sp|B3QTX2|HIS7_CHLT3 | Imidazoleglycerol-phosphate dehydratase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-44 |
sp|A5WBH9|HIS7_PSYWF | Imidazoleglycerol-phosphate dehydratase OS=Psychrobacter sp. (strain PRwf-1) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-44 |
sp|B9DQ86|HIS7_STACT | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus carnosus (strain TM300) GN=hisB PE=3 SV=1 | 55 | 226 | 3.0E-44 |
sp|Q8CQ94|HIS7_STAES | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisB PE=3 SV=1 | 52 | 226 | 4.0E-44 |
sp|A4FYS8|HIS7_METM5 | Imidazoleglycerol-phosphate dehydratase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-44 |
sp|Q7MLS4|HIS7_VIBVY | Histidine biosynthesis bifunctional protein HisB OS=Vibrio vulnificus (strain YJ016) GN=hisB PE=3 SV=1 | 7 | 226 | 5.0E-44 |
sp|Q8D8Q2|HIS7_VIBVU | Histidine biosynthesis bifunctional protein HisB OS=Vibrio vulnificus (strain CMCP6) GN=hisB PE=3 SV=1 | 7 | 226 | 5.0E-44 |
sp|A9A756|HIS7_METM6 | Imidazoleglycerol-phosphate dehydratase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-44 |
sp|Q7VDQ5|HIS7_PROMA | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hisB PE=3 SV=1 | 8 | 226 | 7.0E-44 |
sp|O23346|HIS5B_ARATH | Imidazoleglycerol-phosphate dehydratase 2, chloroplastic OS=Arabidopsis thaliana GN=HISN5B PE=1 SV=2 | 6 | 227 | 7.0E-44 |
sp|P60888|HIS7_METMP | Imidazoleglycerol-phosphate dehydratase OS=Methanococcus maripaludis (strain S2 / LL) GN=hisB PE=3 SV=1 | 8 | 226 | 9.0E-44 |
sp|Q1IKB4|HIS7_KORVE | Imidazoleglycerol-phosphate dehydratase OS=Koribacter versatilis (strain Ellin345) GN=hisB PE=3 SV=1 | 8 | 226 | 9.0E-44 |
sp|B0K626|HIS7_THEPX | Imidazoleglycerol-phosphate dehydratase OS=Thermoanaerobacter sp. (strain X514) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-43 |
sp|Q3Z880|HIS7_DEHM1 | Imidazoleglycerol-phosphate dehydratase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=hisB PE=3 SV=1 | 6 | 226 | 2.0E-43 |
sp|Q8UJ89|HIS7_AGRFC | Imidazoleglycerol-phosphate dehydratase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hisB PE=3 SV=2 | 8 | 226 | 2.0E-43 |
sp|A5UMI3|HIS7_METS3 | Imidazoleglycerol-phosphate dehydratase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-43 |
sp|A6UN45|HIS7_METVS | Imidazoleglycerol-phosphate dehydratase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-43 |
sp|Q46H93|HIS7_PROMT | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain NATL2A) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-43 |
sp|A2C0B5|HIS7_PROM1 | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain NATL1A) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-43 |
sp|B0TDN0|HIS7_HELMI | Imidazoleglycerol-phosphate dehydratase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-43 |
sp|Q47QS7|HIS7_THEFY | Imidazoleglycerol-phosphate dehydratase OS=Thermobifida fusca (strain YX) GN=hisB PE=3 SV=1 | 7 | 226 | 3.0E-43 |
sp|C4L173|HIS7_EXISA | Imidazoleglycerol-phosphate dehydratase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hisB PE=3 SV=1 | 8 | 224 | 3.0E-43 |
sp|Q603K0|HIS7_METCA | Imidazoleglycerol-phosphate dehydratase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-43 |
sp|P16247|HIS7_STRCO | Imidazoleglycerol-phosphate dehydratase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hisB PE=3 SV=1 | 7 | 226 | 4.0E-43 |
sp|B9MJR6|HIS7_CALBD | Imidazoleglycerol-phosphate dehydratase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-43 |
sp|Q3ZXL9|HIS7_DEHMC | Imidazoleglycerol-phosphate dehydratase OS=Dehalococcoides mccartyi (strain CBDB1) GN=hisB PE=3 SV=1 | 6 | 226 | 6.0E-43 |
sp|A0LTS3|HIS7_ACIC1 | Imidazoleglycerol-phosphate dehydratase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-43 |
sp|Q3J6Q4|HIS7_NITOC | Imidazoleglycerol-phosphate dehydratase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisB PE=3 SV=1 | 10 | 226 | 6.0E-43 |
sp|P34047|HIS5A_ARATH | Imidazoleglycerol-phosphate dehydratase 1, chloroplastic OS=Arabidopsis thaliana GN=HISN5A PE=1 SV=1 | 8 | 227 | 7.0E-43 |
sp|A8ETG3|HIS7_ARCB4 | Imidazoleglycerol-phosphate dehydratase OS=Arcobacter butzleri (strain RM4018) GN=hisB PE=3 SV=1 | 12 | 226 | 7.0E-43 |
sp|A8M909|HIS7_CALMQ | Imidazoleglycerol-phosphate dehydratase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hisB PE=3 SV=1 | 8 | 226 | 7.0E-43 |
sp|Q162Q6|HIS7_ROSDO | Imidazoleglycerol-phosphate dehydratase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-43 |
sp|A5FR28|HIS7_DEHMB | Imidazoleglycerol-phosphate dehydratase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=hisB PE=3 SV=1 | 6 | 226 | 9.0E-43 |
sp|Q43072|HIS7_PEA | Imidazoleglycerol-phosphate dehydratase OS=Pisum sativum GN=HIS3 PE=2 SV=1 | 2 | 227 | 9.0E-43 |
sp|Q2JNK3|HIS7_SYNJB | Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-42 |
sp|B3QMG8|HIS7_CHLP8 | Imidazoleglycerol-phosphate dehydratase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hisB PE=3 SV=1 | 6 | 226 | 1.0E-42 |
sp|A8FHR2|HIS7_BACP2 | Imidazoleglycerol-phosphate dehydratase OS=Bacillus pumilus (strain SAFR-032) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-42 |
sp|Q5UZF0|HIS7_HALMA | Imidazoleglycerol-phosphate dehydratase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisB PE=3 SV=1 | 6 | 226 | 1.0E-42 |
sp|A0RQ64|HIS7_CAMFF | Imidazoleglycerol-phosphate dehydratase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hisB PE=3 SV=1 | 54 | 226 | 1.0E-42 |
sp|Q4A046|HIS7_STAS1 | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hisB PE=3 SV=1 | 56 | 226 | 1.0E-42 |
sp|Q6ANL7|HIS7_DESPS | Imidazoleglycerol-phosphate dehydratase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-42 |
sp|Q5N2A1|HIS7_SYNP6 | Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-42 |
sp|Q31S12|HIS7_SYNE7 | Imidazoleglycerol-phosphate dehydratase OS=Synechococcus elongatus (strain PCC 7942) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-42 |
sp|B1W0M1|HIS7_STRGG | Imidazoleglycerol-phosphate dehydratase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=hisB PE=3 SV=1 | 6 | 226 | 1.0E-42 |
sp|Q81G05|HIS7_BACCR | Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-42 |
sp|Q3IRM3|HIS7_NATPD | Imidazoleglycerol-phosphate dehydratase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hisB PE=3 SV=1 | 6 | 226 | 2.0E-42 |
sp|B0RSL6|HIS7_XANCB | Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas campestris pv. campestris (strain B100) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-42 |
sp|A3CNT3|HIS7_STRSV | Imidazoleglycerol-phosphate dehydratase OS=Streptococcus sanguinis (strain SK36) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-42 |
sp|A9VLH4|HIS7_BACWK | Imidazoleglycerol-phosphate dehydratase OS=Bacillus weihenstephanensis (strain KBAB4) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-42 |
sp|A1W1K1|HIS7_CAMJJ | Histidine biosynthesis bifunctional protein HisB OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hisB PE=3 SV=1 | 5 | 226 | 2.0E-42 |
sp|P58882|HIS7_XANCP | Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-42 |
sp|Q4UU42|HIS7_XANC8 | Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-42 |
sp|B9IUZ7|HIS7_BACCQ | Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain Q1) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-42 |
sp|B7HKD1|HIS7_BACC7 | Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain AH187) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-42 |
sp|A8AY27|HIS7_STRGC | Imidazoleglycerol-phosphate dehydratase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-42 |
sp|Q9PM76|HIS7_CAMJE | Histidine biosynthesis bifunctional protein HisB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hisB PE=3 SV=1 | 5 | 226 | 4.0E-42 |
sp|Q2JRL0|HIS7_SYNJA | Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain JA-3-3Ab) GN=hisB PE=3 SV=1 | 4 | 226 | 4.0E-42 |
sp|Q5KVC7|HIS7_GEOKA | Imidazoleglycerol-phosphate dehydratase OS=Geobacillus kaustophilus (strain HTA426) GN=hisB PE=3 SV=1 | 7 | 226 | 4.0E-42 |
sp|Q3BUF5|HIS7_XANC5 | Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-42 |
sp|B7JFZ2|HIS7_BACC0 | Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain AH820) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-42 |
sp|A8FNR1|HIS7_CAMJ8 | Histidine biosynthesis bifunctional protein HisB OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=hisB PE=3 SV=1 | 5 | 226 | 5.0E-42 |
sp|Q5H0K9|HIS7_XANOR | Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-42 |
sp|B2SKN6|HIS7_XANOP | Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-42 |
sp|Q2P3K1|HIS7_XANOM | Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-42 |
sp|A1ATG7|HIS7_PELPD | Imidazoleglycerol-phosphate dehydratase OS=Pelobacter propionicus (strain DSM 2379) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-42 |
sp|Q6HLE6|HIS7_BACHK | Imidazoleglycerol-phosphate dehydratase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-42 |
sp|Q81T61|HIS7_BACAN | Imidazoleglycerol-phosphate dehydratase OS=Bacillus anthracis GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-42 |
sp|C3L9Q0|HIS7_BACAC | Imidazoleglycerol-phosphate dehydratase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-42 |
sp|C3P503|HIS7_BACAA | Imidazoleglycerol-phosphate dehydratase OS=Bacillus anthracis (strain A0248) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-42 |
sp|A8LGQ5|HIS7_FRASN | Imidazoleglycerol-phosphate dehydratase OS=Frankia sp. (strain EAN1pec) GN=hisB PE=3 SV=1 | 7 | 226 | 5.0E-42 |
sp|C3KVX2|HIS7_CLOB6 | Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hisB PE=3 SV=1 | 60 | 226 | 5.0E-42 |
sp|B7HHG2|HIS7_BACC4 | Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain B4264) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-42 |
sp|Q64RE9|HIS7_BACFR | Histidine biosynthesis bifunctional protein HisB OS=Bacteroides fragilis (strain YCH46) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-42 |
sp|Q5LB00|HIS7_BACFN | Histidine biosynthesis bifunctional protein HisB OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-42 |
sp|P58881|HIS7_XANAC | Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hisB PE=3 SV=1 | 8 | 226 | 7.0E-42 |
sp|A6WX56|HIS7_OCHA4 | Imidazoleglycerol-phosphate dehydratase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hisB PE=3 SV=1 | 3 | 226 | 7.0E-42 |
sp|Q8KEF4|HIS7_CHLTE | Imidazoleglycerol-phosphate dehydratase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisB PE=3 SV=1 | 6 | 226 | 7.0E-42 |
sp|B8I5V2|HIS7_CLOCE | Imidazoleglycerol-phosphate dehydratase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-42 |
sp|Q28NK7|HIS7_JANSC | Imidazoleglycerol-phosphate dehydratase OS=Jannaschia sp. (strain CCS1) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-42 |
sp|Q2NHQ1|HIS7_METST | Imidazoleglycerol-phosphate dehydratase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-41 |
sp|Q63DX1|HIS7_BACCZ | Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain ZK / E33L) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-41 |
sp|Q2J8L0|HIS7_FRASC | Imidazoleglycerol-phosphate dehydratase OS=Frankia sp. (strain CcI3) GN=hisB PE=3 SV=1 | 7 | 226 | 1.0E-41 |
sp|A1BF00|HIS7_CHLPD | Imidazoleglycerol-phosphate dehydratase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hisB PE=3 SV=1 | 7 | 226 | 1.0E-41 |
sp|A4ISR5|HIS7_GEOTN | Imidazoleglycerol-phosphate dehydratase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-41 |
sp|B3EKC2|HIS7_CHLPB | Imidazoleglycerol-phosphate dehydratase OS=Chlorobium phaeobacteroides (strain BS1) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-41 |
sp|Q5HSJ2|HIS7_CAMJR | Histidine biosynthesis bifunctional protein HisB OS=Campylobacter jejuni (strain RM1221) GN=hisB PE=3 SV=1 | 5 | 226 | 2.0E-41 |
sp|P64367|HIS7_BRUSU | Imidazoleglycerol-phosphate dehydratase OS=Brucella suis biovar 1 (strain 1330) GN=hisB PE=3 SV=1 | 3 | 226 | 2.0E-41 |
sp|A5VT39|HIS7_BRUO2 | Imidazoleglycerol-phosphate dehydratase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hisB PE=3 SV=1 | 3 | 226 | 2.0E-41 |
sp|P64366|HIS7_BRUME | Imidazoleglycerol-phosphate dehydratase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisB PE=3 SV=1 | 3 | 226 | 2.0E-41 |
sp|C0RFW9|HIS7_BRUMB | Imidazoleglycerol-phosphate dehydratase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hisB PE=3 SV=1 | 3 | 226 | 2.0E-41 |
sp|A9M9R5|HIS7_BRUC2 | Imidazoleglycerol-phosphate dehydratase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hisB PE=3 SV=1 | 3 | 226 | 2.0E-41 |
sp|Q57AH7|HIS7_BRUAB | Imidazoleglycerol-phosphate dehydratase OS=Brucella abortus biovar 1 (strain 9-941) GN=hisB PE=3 SV=1 | 3 | 226 | 2.0E-41 |
sp|Q2YQZ2|HIS7_BRUA2 | Imidazoleglycerol-phosphate dehydratase OS=Brucella abortus (strain 2308) GN=hisB PE=3 SV=1 | 3 | 226 | 2.0E-41 |
sp|B2S980|HIS7_BRUA1 | Imidazoleglycerol-phosphate dehydratase OS=Brucella abortus (strain S19) GN=hisB PE=3 SV=1 | 3 | 226 | 2.0E-41 |
sp|Q30RM3|HIS7_SULDN | Imidazoleglycerol-phosphate dehydratase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hisB PE=3 SV=1 | 53 | 226 | 2.0E-41 |
sp|C1EMQ4|HIS7_BACC3 | Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain 03BB102) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-41 |
sp|A0RBL9|HIS7_BACAH | Imidazoleglycerol-phosphate dehydratase OS=Bacillus thuringiensis (strain Al Hakam) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-41 |
sp|Q93DQ9|HIS7_TRIEI | Imidazoleglycerol-phosphate dehydratase OS=Trichodesmium erythraeum (strain IMS101) GN=hisB PE=3 SV=1 | 3 | 226 | 2.0E-41 |
sp|Q65RB3|HIS7_MANSM | Histidine biosynthesis bifunctional protein HisB OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-41 |
sp|Q7UNC2|HIS7_RHOBA | Imidazoleglycerol-phosphate dehydratase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisB PE=3 SV=1 | 3 | 226 | 3.0E-41 |
sp|P64374|HIS7_STAAW | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain MW2) GN=hisB PE=3 SV=1 | 60 | 226 | 3.0E-41 |
sp|A8Z5H6|HIS7_STAAT | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hisB PE=3 SV=1 | 60 | 226 | 3.0E-41 |
sp|Q6G5Z9|HIS7_STAAS | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain MSSA476) GN=hisB PE=3 SV=1 | 60 | 226 | 3.0E-41 |
sp|P64373|HIS7_STAAN | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain N315) GN=hisB PE=1 SV=1 | 60 | 226 | 3.0E-41 |
sp|P64372|HIS7_STAAM | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisB PE=3 SV=1 | 60 | 226 | 3.0E-41 |
sp|A6QKG4|HIS7_STAAE | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain Newman) GN=hisB PE=3 SV=1 | 60 | 226 | 3.0E-41 |
sp|Q5HCM1|HIS7_STAAC | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain COL) GN=hisB PE=3 SV=1 | 60 | 226 | 3.0E-41 |
sp|A5IWA3|HIS7_STAA9 | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain JH9) GN=hisB PE=3 SV=1 | 60 | 226 | 3.0E-41 |
sp|Q2FUU0|HIS7_STAA8 | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain NCTC 8325) GN=hisB PE=3 SV=1 | 60 | 226 | 3.0E-41 |
sp|Q2FDI5|HIS7_STAA3 | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain USA300) GN=hisB PE=3 SV=1 | 60 | 226 | 3.0E-41 |
sp|A6U561|HIS7_STAA2 | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain JH1) GN=hisB PE=3 SV=1 | 60 | 226 | 3.0E-41 |
sp|A7X766|HIS7_STAA1 | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hisB PE=3 SV=1 | 60 | 226 | 3.0E-41 |
sp|P61658|HIS7_BACC1 | Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-41 |
sp|P34048|HIS7_WHEAT | Imidazoleglycerol-phosphate dehydratase (Fragment) OS=Triticum aestivum PE=2 SV=1 | 12 | 227 | 4.0E-41 |
sp|Q9HN13|HIS7_HALSA | Imidazoleglycerol-phosphate dehydratase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisB PE=3 SV=1 | 6 | 226 | 4.0E-41 |
sp|B0R7J1|HIS7_HALS3 | Imidazoleglycerol-phosphate dehydratase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hisB PE=3 SV=1 | 6 | 226 | 4.0E-41 |
sp|Q2YZ91|HIS7_STAAB | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hisB PE=3 SV=1 | 60 | 226 | 4.0E-41 |
sp|A7GMU7|HIS7_BACCN | Imidazoleglycerol-phosphate dehydratase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-41 |
sp|B7INA0|HIS7_BACC2 | Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain G9842) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-41 |
sp|B0CJI2|HIS7_BRUSI | Imidazoleglycerol-phosphate dehydratase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hisB PE=3 SV=1 | 3 | 226 | 7.0E-41 |
sp|A5GWD4|HIS7_SYNR3 | Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain RCC307) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-41 |
sp|A1WR21|HIS7_VEREI | Imidazoleglycerol-phosphate dehydratase OS=Verminephrobacter eiseniae (strain EF01-2) GN=hisB PE=3 SV=1 | 5 | 226 | 8.0E-41 |
sp|Q7NMJ6|HIS7_GLOVI | Imidazoleglycerol-phosphate dehydratase OS=Gloeobacter violaceus (strain PCC 7421) GN=hisB PE=3 SV=1 | 8 | 226 | 9.0E-41 |
sp|Q7M7V2|HIS7_WOLSU | Imidazoleglycerol-phosphate dehydratase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hisB PE=3 SV=1 | 54 | 226 | 9.0E-41 |
sp|A9KNX4|HIS7_CLOPH | Imidazoleglycerol-phosphate dehydratase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-40 |
sp|Q97KI1|HIS7_CLOAB | Imidazoleglycerol-phosphate dehydratase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-40 |
sp|P62455|HIS7_PHOPR | Histidine biosynthesis bifunctional protein HisB OS=Photobacterium profundum GN=hisB PE=3 SV=1 | 4 | 226 | 1.0E-40 |
sp|Q98CT7|HIS7_RHILO | Imidazoleglycerol-phosphate dehydratase OS=Rhizobium loti (strain MAFF303099) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-40 |
sp|B1I559|HIS7_DESAP | Imidazoleglycerol-phosphate dehydratase OS=Desulforudis audaxviator (strain MP104C) GN=hisB PE=3 SV=1 | 8 | 227 | 1.0E-40 |
sp|Q2RGV9|HIS7_MOOTA | Imidazoleglycerol-phosphate dehydratase OS=Moorella thermoacetica (strain ATCC 39073) GN=hisB PE=3 SV=1 | 7 | 227 | 1.0E-40 |
sp|A7H5U9|HIS7_CAMJD | Histidine biosynthesis bifunctional protein HisB OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=hisB PE=3 SV=1 | 5 | 226 | 2.0E-40 |
sp|A6Q330|HIS7_NITSB | Imidazoleglycerol-phosphate dehydratase OS=Nitratiruptor sp. (strain SB155-2) GN=hisB PE=3 SV=1 | 12 | 226 | 2.0E-40 |
sp|Q05068|HIS7_NOSS1 | Imidazoleglycerol-phosphate dehydratase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisB PE=3 SV=1 | 4 | 226 | 2.0E-40 |
sp|A5FYE1|HIS7_ACICJ | Imidazoleglycerol-phosphate dehydratase OS=Acidiphilium cryptum (strain JF-5) GN=hisB PE=3 SV=1 | 7 | 226 | 3.0E-40 |
sp|C4XSN6|HIS7_DESMR | Imidazoleglycerol-phosphate dehydratase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-40 |
sp|C0QUG8|HIS7_PERMH | Imidazoleglycerol-phosphate dehydratase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-40 |
sp|B3GZG9|HIS7_ACTP7 | Histidine biosynthesis bifunctional protein HisB OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-40 |
sp|B0BU51|HIS7_ACTPJ | Histidine biosynthesis bifunctional protein HisB OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-40 |
sp|O34683|HIS7_BACSU | Imidazoleglycerol-phosphate dehydratase OS=Bacillus subtilis (strain 168) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-40 |
sp|A0AG18|HIS7_LISW6 | Imidazoleglycerol-phosphate dehydratase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-40 |
sp|P57920|HIS7_PASMU | Histidine biosynthesis bifunctional protein HisB OS=Pasteurella multocida (strain Pm70) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-40 |
sp|A7ZEG5|HIS7_CAMC1 | Imidazoleglycerol-phosphate dehydratase OS=Campylobacter concisus (strain 13826) GN=hisB PE=3 SV=1 | 12 | 226 | 5.0E-40 |
sp|Q9PBC7|HIS7_XYLFA | Histidine biosynthesis bifunctional protein HisB OS=Xylella fastidiosa (strain 9a5c) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-40 |
sp|Q6GDC8|HIS7_STAAR | Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain MRSA252) GN=hisB PE=3 SV=1 | 60 | 226 | 7.0E-40 |
sp|Q722Y4|HIS7_LISMF | Imidazoleglycerol-phosphate dehydratase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hisB PE=3 SV=1 | 8 | 226 | 7.0E-40 |
sp|C1L0J5|HIS7_LISMC | Imidazoleglycerol-phosphate dehydratase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hisB PE=3 SV=1 | 8 | 226 | 7.0E-40 |
sp|Q87C31|HIS7_XYLFT | Histidine biosynthesis bifunctional protein HisB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-40 |
sp|B2I5X9|HIS7_XYLF2 | Histidine biosynthesis bifunctional protein HisB OS=Xylella fastidiosa (strain M23) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-40 |
sp|B1H0E9|HIS7_UNCTG | Imidazoleglycerol-phosphate dehydratase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-40 |
sp|A4J710|HIS7_DESRM | Imidazoleglycerol-phosphate dehydratase OS=Desulfotomaculum reducens (strain MI-1) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-39 |
sp|O66455|HIS7_AQUAE | Imidazoleglycerol-phosphate dehydratase OS=Aquifex aeolicus (strain VF5) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-39 |
sp|Q8DMI3|HIS7_THEEB | Imidazoleglycerol-phosphate dehydratase OS=Thermosynechococcus elongatus (strain BP-1) GN=hisB PE=3 SV=1 | 2 | 228 | 1.0E-39 |
sp|Q24QJ2|HIS7_DESHY | Imidazoleglycerol-phosphate dehydratase OS=Desulfitobacterium hafniense (strain Y51) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-39 |
sp|Q2NTX3|HIS7_SODGM | Histidine biosynthesis bifunctional protein HisB OS=Sodalis glossinidius (strain morsitans) GN=hisB PE=3 SV=1 | 60 | 226 | 1.0E-39 |
sp|Q9K6Z3|HIS7_BACHD | Imidazoleglycerol-phosphate dehydratase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-39 |
sp|A5N7Q8|HIS7_CLOK5 | Imidazoleglycerol-phosphate dehydratase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-39 |
sp|B9E169|HIS7_CLOK1 | Imidazoleglycerol-phosphate dehydratase OS=Clostridium kluyveri (strain NBRC 12016) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-39 |
sp|Q8ABA7|HIS7_BACTN | Histidine biosynthesis bifunctional protein HisB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-39 |
sp|Q9ZHE4|HIS7_BUCAP | Histidine biosynthesis bifunctional protein HisB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-39 |
sp|A7Z965|HIS7_BACMF | Imidazoleglycerol-phosphate dehydratase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-39 |
sp|A6UTB1|HIS7_META3 | Imidazoleglycerol-phosphate dehydratase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-39 |
sp|B8DA59|HIS7_LISMH | Imidazoleglycerol-phosphate dehydratase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-39 |
sp|B0U3B1|HIS7_XYLFM | Histidine biosynthesis bifunctional protein HisB OS=Xylella fastidiosa (strain M12) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-39 |
sp|B9LAD4|HIS7_NAUPA | Imidazoleglycerol-phosphate dehydratase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=hisB PE=3 SV=1 | 12 | 226 | 2.0E-39 |
sp|Q92E85|HIS7_LISIN | Imidazoleglycerol-phosphate dehydratase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-39 |
sp|Q8Y9G2|HIS7_LISMO | Imidazoleglycerol-phosphate dehydratase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-39 |
sp|Q01ZU4|HIS7_SOLUE | Imidazoleglycerol-phosphate dehydratase OS=Solibacter usitatus (strain Ellin6076) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-39 |
sp|Q3AN36|HIS7_SYNSC | Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain CC9605) GN=hisB PE=3 SV=1 | 7 | 226 | 3.0E-39 |
sp|A1SL60|HIS7_NOCSJ | Imidazoleglycerol-phosphate dehydratase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-39 |
sp|A6TKT3|HIS7_ALKMQ | Imidazoleglycerol-phosphate dehydratase OS=Alkaliphilus metalliredigens (strain QYMF) GN=hisB PE=3 SV=1 | 14 | 226 | 3.0E-39 |
sp|P06987|HIS7_ECOLI | Histidine biosynthesis bifunctional protein HisB OS=Escherichia coli (strain K12) GN=hisB PE=1 SV=1 | 8 | 226 | 3.0E-39 |
sp|Q83R05|HIS7_SHIFL | Histidine biosynthesis bifunctional protein HisB OS=Shigella flexneri GN=hisB PE=3 SV=2 | 8 | 226 | 4.0E-39 |
sp|Q9S5G5|HIS7_ECO57 | Histidine biosynthesis bifunctional protein HisB OS=Escherichia coli O157:H7 GN=hisB PE=1 SV=1 | 8 | 226 | 4.0E-39 |
sp|Q8FG50|HIS7_ECOL6 | Histidine biosynthesis bifunctional protein HisB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hisB PE=3 SV=2 | 8 | 226 | 4.0E-39 |
sp|A3N3W1|HIS7_ACTP2 | Histidine biosynthesis bifunctional protein HisB OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=hisB PE=3 SV=1 | 8 | 226 | 5.0E-39 |
sp|A6WCV0|HIS7_KINRD | Imidazoleglycerol-phosphate dehydratase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=hisB PE=3 SV=1 | 7 | 226 | 5.0E-39 |
sp|Q2FN13|HIS7_METHJ | Imidazoleglycerol-phosphate dehydratase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=hisB PE=3 SV=1 | 8 | 226 | 6.0E-39 |
sp|A0PXP6|HIS7_CLONN | Imidazoleglycerol-phosphate dehydratase OS=Clostridium novyi (strain NT) GN=hisB PE=3 SV=1 | 6 | 226 | 6.0E-39 |
sp|A0RZ75|HIS7_CENSY | Imidazoleglycerol-phosphate dehydratase OS=Cenarchaeum symbiosum (strain A) GN=hisB PE=3 SV=1 | 14 | 226 | 6.0E-39 |
sp|Q7V4R6|HIS7_PROMM | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9313) GN=hisB PE=3 SV=1 | 1 | 226 | 6.0E-39 |
sp|Q02YW7|HIS7_LACLS | Imidazoleglycerol-phosphate dehydratase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=hisB PE=3 SV=1 | 8 | 228 | 6.0E-39 |
sp|B0JJ52|HIS7_MICAN | Imidazoleglycerol-phosphate dehydratase OS=Microcystis aeruginosa (strain NIES-843) GN=hisB PE=3 SV=1 | 5 | 226 | 7.0E-39 |
sp|P48054|HIS7_SYNY3 | Imidazoleglycerol-phosphate dehydratase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisB PE=3 SV=1 | 8 | 226 | 7.0E-39 |
sp|C5D7P1|HIS7_GEOSW | Imidazoleglycerol-phosphate dehydratase OS=Geobacillus sp. (strain WCH70) GN=hisB PE=3 SV=1 | 7 | 226 | 8.0E-39 |
sp|Q0IDH6|HIS7_SYNS3 | Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain CC9311) GN=hisB PE=3 SV=1 | 8 | 226 | 9.0E-39 |
sp|Q4QN72|HIS7_HAEI8 | Histidine biosynthesis bifunctional protein HisB OS=Haemophilus influenzae (strain 86-028NP) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-38 |
sp|P58879|HIS7_METKA | Imidazoleglycerol-phosphate dehydratase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisB PE=3 SV=1 | 5 | 226 | 1.0E-38 |
sp|B8GJY3|HIS7_METPE | Imidazoleglycerol-phosphate dehydratase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-38 |
sp|A1A2H5|HIS7_BIFAA | Imidazoleglycerol-phosphate dehydratase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=hisB PE=3 SV=1 | 7 | 226 | 1.0E-38 |
sp|A5UGY3|HIS7_HAEIG | Histidine biosynthesis bifunctional protein HisB OS=Haemophilus influenzae (strain PittGG) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-38 |
sp|A5UA18|HIS7_HAEIE | Histidine biosynthesis bifunctional protein HisB OS=Haemophilus influenzae (strain PittEE) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-38 |
sp|A2CCN3|HIS7_PROM3 | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9303) GN=hisB PE=3 SV=1 | 1 | 226 | 1.0E-38 |
sp|B5EDR7|HIS7_GEOBB | Imidazoleglycerol-phosphate dehydratase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hisB PE=3 SV=1 | 7 | 226 | 1.0E-38 |
sp|A9BDS9|HIS7_PROM4 | Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9211) GN=hisB PE=3 SV=1 | 5 | 226 | 1.0E-38 |
sp|A6VM11|HIS7_ACTSZ | Histidine biosynthesis bifunctional protein HisB OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=hisB PE=3 SV=1 | 6 | 226 | 1.0E-38 |
sp|Q58109|HIS7_METJA | Imidazoleglycerol-phosphate dehydratase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-38 |
sp|C6E7F7|HIS7_GEOSM | Imidazoleglycerol-phosphate dehydratase OS=Geobacter sp. (strain M21) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-38 |
sp|Q47XB6|HIS7_COLP3 | Histidine biosynthesis bifunctional protein HisB OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-38 |
sp|Q0SHY0|HIS7_RHOJR | Imidazoleglycerol-phosphate dehydratase OS=Rhodococcus jostii (strain RHA1) GN=hisB PE=3 SV=1 | 6 | 226 | 2.0E-38 |
sp|P44327|HIS7_HAEIN | Histidine biosynthesis bifunctional protein HisB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-38 |
sp|Q6D409|HIS7_PECAS | Histidine biosynthesis bifunctional protein HisB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hisB PE=3 SV=1 | 51 | 226 | 2.0E-38 |
sp|A5G8T2|HIS7_GEOUR | Imidazoleglycerol-phosphate dehydratase OS=Geobacter uraniireducens (strain Rf4) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-38 |
sp|Q7U9M8|HIS7_SYNPX | Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain WH8102) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-38 |
sp|B3E4Y5|HIS7_GEOLS | Imidazoleglycerol-phosphate dehydratase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-38 |
sp|P60885|HIS7_GEOSL | Imidazoleglycerol-phosphate dehydratase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-38 |
sp|C1ATZ4|HIS7_RHOOB | Imidazoleglycerol-phosphate dehydratase OS=Rhodococcus opacus (strain B4) GN=hisB PE=3 SV=1 | 6 | 226 | 3.0E-38 |
sp|B8DSW4|HIS7_BIFA0 | Imidazoleglycerol-phosphate dehydratase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=hisB PE=3 SV=1 | 7 | 226 | 3.0E-38 |
sp|Q8Z5J8|HIS7_SALTI | Histidine biosynthesis bifunctional protein HisB OS=Salmonella typhi GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-38 |
sp|P10368|HIS7_SALTY | Histidine biosynthesis bifunctional protein HisB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hisB PE=3 SV=2 | 8 | 226 | 3.0E-38 |
sp|Q5PDP5|HIS7_SALPA | Histidine biosynthesis bifunctional protein HisB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-38 |
sp|Q65EG0|HIS7_BACLD | Imidazoleglycerol-phosphate dehydratase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-38 |
sp|B4S729|HIS7_PROA2 | Imidazoleglycerol-phosphate dehydratase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hisB PE=3 SV=1 | 54 | 226 | 4.0E-38 |
sp|Q6AE13|HIS7_LEIXX | Imidazoleglycerol-phosphate dehydratase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hisB PE=3 SV=1 | 6 | 226 | 4.0E-38 |
sp|A7I064|HIS7_CAMHC | Imidazoleglycerol-phosphate dehydratase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=hisB PE=3 SV=1 | 54 | 226 | 4.0E-38 |
sp|C3MW64|HIS7_SULIM | Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=hisB PE=3 SV=1 | 7 | 226 | 4.0E-38 |
sp|C4KHS1|HIS7_SULIK | Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=hisB PE=3 SV=1 | 7 | 226 | 4.0E-38 |
sp|Q3B0A6|HIS7_SYNS9 | Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain CC9902) GN=hisB PE=3 SV=1 | 8 | 226 | 4.0E-38 |
sp|C3N6A7|HIS7_SULIA | Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain M.16.27) GN=hisB PE=3 SV=1 | 7 | 226 | 6.0E-38 |
sp|B0RHB5|HIS7_CLAMS | Imidazoleglycerol-phosphate dehydratase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=hisB PE=3 SV=1 | 4 | 226 | 6.0E-38 |
sp|Q8ZFX7|HIS7_YERPE | Histidine biosynthesis bifunctional protein HisB OS=Yersinia pestis GN=hisB PE=3 SV=1 | 60 | 226 | 7.0E-38 |
sp|A0LQG8|HIS7_SYNFM | Imidazoleglycerol-phosphate dehydratase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=hisB PE=3 SV=1 | 8 | 226 | 7.0E-38 |
sp|Q66C51|HIS7_YERPS | Histidine biosynthesis bifunctional protein HisB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hisB PE=3 SV=1 | 60 | 226 | 7.0E-38 |
sp|B3DQA1|HIS7_BIFLD | Imidazoleglycerol-phosphate dehydratase OS=Bifidobacterium longum (strain DJO10A) GN=hisB PE=3 SV=1 | 7 | 226 | 8.0E-38 |
sp|C3NGY0|HIS7_SULIN | Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=hisB PE=3 SV=1 | 7 | 226 | 8.0E-38 |
sp|C3MQI6|HIS7_SULIL | Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=hisB PE=3 SV=1 | 7 | 226 | 8.0E-38 |
sp|P60884|HIS7_CORDI | Imidazoleglycerol-phosphate dehydratase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hisB PE=3 SV=1 | 4 | 226 | 9.0E-38 |
sp|A5CSK8|HIS7_CLAM3 | Imidazoleglycerol-phosphate dehydratase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=hisB PE=3 SV=1 | 4 | 226 | 1.0E-37 |
sp|Q7N6I2|HIS7_PHOLL | Histidine biosynthesis bifunctional protein HisB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hisB PE=3 SV=1 | 60 | 226 | 1.0E-37 |
sp|O33773|HIS7_SULSO | Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hisB PE=3 SV=1 | 7 | 226 | 1.0E-37 |
sp|A5GID0|HIS7_SYNPW | Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain WH7803) GN=hisB PE=3 SV=1 | 8 | 226 | 1.0E-37 |
sp|C6BSE1|HIS7_DESAD | Imidazoleglycerol-phosphate dehydratase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=hisB PE=3 SV=1 | 6 | 226 | 1.0E-37 |
sp|Q5ZW89|HIS7_LEGPH | Histidine biosynthesis bifunctional protein HisB OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hisB PE=3 SV=1 | 7 | 226 | 1.0E-37 |
sp|Q8G4S7|HIS7_BIFLO | Imidazoleglycerol-phosphate dehydratase OS=Bifidobacterium longum (strain NCC 2705) GN=hisB PE=3 SV=1 | 7 | 226 | 1.0E-37 |
sp|B7GQ48|HIS7_BIFLS | Imidazoleglycerol-phosphate dehydratase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=hisB PE=3 SV=1 | 7 | 226 | 2.0E-37 |
sp|A6TBC5|HIS7_KLEP7 | Histidine biosynthesis bifunctional protein HisB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hisB PE=3 SV=1 | 4 | 226 | 2.0E-37 |
sp|Q0AW39|HIS7_SYNWW | Imidazoleglycerol-phosphate dehydratase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-37 |
sp|Q4JW57|HIS7_CORJK | Imidazoleglycerol-phosphate dehydratase OS=Corynebacterium jeikeium (strain K411) GN=hisB PE=3 SV=1 | 1 | 226 | 2.0E-37 |
sp|Q39YP5|HIS7_GEOMG | Imidazoleglycerol-phosphate dehydratase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisB PE=3 SV=1 | 7 | 226 | 3.0E-37 |
sp|Q5X5X1|HIS7_LEGPA | Histidine biosynthesis bifunctional protein HisB OS=Legionella pneumophila (strain Paris) GN=hisB PE=3 SV=1 | 7 | 226 | 3.0E-37 |
sp|A2RKS1|HIS7_LACLM | Imidazoleglycerol-phosphate dehydratase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-37 |
sp|A5CZ77|HIS7_PELTS | Imidazoleglycerol-phosphate dehydratase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-37 |
sp|A6Q9M2|HIS7_SULNB | Imidazoleglycerol-phosphate dehydratase OS=Sulfurovum sp. (strain NBC37-1) GN=hisB PE=3 SV=1 | 12 | 226 | 3.0E-37 |
sp|Q1LT69|HIS7_BAUCH | Histidine biosynthesis bifunctional protein HisB OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=hisB PE=3 SV=1 | 4 | 227 | 3.0E-37 |
sp|C3NER4|HIS7_SULIY | Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=hisB PE=3 SV=1 | 7 | 226 | 3.0E-37 |
sp|Q9X7B9|HIS7_MYCLE | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium leprae (strain TN) GN=hisB PE=3 SV=1 | 6 | 226 | 3.0E-37 |
sp|B8ZRB1|HIS7_MYCLB | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium leprae (strain Br4923) GN=hisB PE=3 SV=1 | 6 | 226 | 3.0E-37 |
sp|A0QX83|HIS7_MYCS2 | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=hisB PE=1 SV=1 | 8 | 226 | 4.0E-37 |
sp|Q02134|HIS7_LACLA | Imidazoleglycerol-phosphate dehydratase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hisB PE=3 SV=3 | 7 | 226 | 4.0E-37 |
sp|Q5WX93|HIS7_LEGPL | Histidine biosynthesis bifunctional protein HisB OS=Legionella pneumophila (strain Lens) GN=hisB PE=3 SV=1 | 7 | 226 | 5.0E-37 |
sp|Q5WDH9|HIS7_BACSK | Imidazoleglycerol-phosphate dehydratase OS=Bacillus clausii (strain KSM-K16) GN=hisB PE=3 SV=1 | 7 | 226 | 6.0E-37 |
sp|A1T8W3|HIS7_MYCVP | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hisB PE=3 SV=1 | 7 | 226 | 6.0E-37 |
sp|A8ZUC7|HIS7_DESOH | Imidazoleglycerol-phosphate dehydratase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=hisB PE=3 SV=1 | 8 | 226 | 7.0E-37 |
sp|Q67KH7|HIS7_SYMTH | Imidazoleglycerol-phosphate dehydratase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisB PE=3 SV=1 | 8 | 226 | 8.0E-37 |
sp|Q6A8L3|HIS7_PROAC | Imidazoleglycerol-phosphate dehydratase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hisB PE=3 SV=1 | 6 | 226 | 9.0E-37 |
sp|A0JUZ5|HIS7_ARTS2 | Imidazoleglycerol-phosphate dehydratase OS=Arthrobacter sp. (strain FB24) GN=hisB PE=3 SV=1 | 4 | 226 | 1.0E-36 |
sp|A4YI33|HIS7_METS5 | Imidazoleglycerol-phosphate dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=hisB PE=3 SV=1 | 7 | 226 | 1.0E-36 |
sp|Q1B7G6|HIS7_MYCSS | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium sp. (strain MCS) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-36 |
sp|A1UHK6|HIS7_MYCSK | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium sp. (strain KMS) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-36 |
sp|A3Q129|HIS7_MYCSJ | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium sp. (strain JLS) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-36 |
sp|B8D708|HIS7_BUCAT | Histidine biosynthesis bifunctional protein HisB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-36 |
sp|P57203|HIS7_BUCAI | Histidine biosynthesis bifunctional protein HisB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-36 |
sp|B8D8Q4|HIS7_BUCA5 | Histidine biosynthesis bifunctional protein HisB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-36 |
sp|Q2LVF5|HIS7_SYNAS | Imidazoleglycerol-phosphate dehydratase OS=Syntrophus aciditrophicus (strain SB) GN=hisB PE=3 SV=1 | 8 | 226 | 2.0E-36 |
sp|Q9KJU3|HIS7_CORGL | Imidazoleglycerol-phosphate dehydratase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hisB PE=3 SV=2 | 8 | 226 | 3.0E-36 |
sp|A4QFG5|HIS7_CORGB | Imidazoleglycerol-phosphate dehydratase OS=Corynebacterium glutamicum (strain R) GN=hisB PE=3 SV=1 | 8 | 226 | 3.0E-36 |
sp|B9M0L7|HIS7_GEODF | Imidazoleglycerol-phosphate dehydratase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hisB PE=3 SV=1 | 7 | 226 | 3.0E-36 |
sp|A1R559|HIS7_ARTAT | Imidazoleglycerol-phosphate dehydratase OS=Arthrobacter aurescens (strain TC1) GN=hisB PE=3 SV=1 | 3 | 226 | 4.0E-36 |
sp|A7I774|HIS7_METB6 | Imidazoleglycerol-phosphate dehydratase OS=Methanoregula boonei (strain 6A8) GN=hisB PE=3 SV=1 | 10 | 226 | 5.0E-36 |
sp|A4T9M6|HIS7_MYCGI | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium gilvum (strain PYR-GCK) GN=hisB PE=3 SV=1 | 7 | 226 | 7.0E-36 |
sp|P9WML9|HIS7_MYCTU | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hisB PE=1 SV=1 | 54 | 226 | 8.0E-36 |
sp|P9WML8|HIS7_MYCTO | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hisB PE=3 SV=1 | 54 | 226 | 8.0E-36 |
sp|A5U2V7|HIS7_MYCTA | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hisB PE=3 SV=1 | 54 | 226 | 8.0E-36 |
sp|C1ANM3|HIS7_MYCBT | Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hisB PE=3 SV=1 | 54 | 226 | 8.0E-36 |
GO Term | Description | Terminal node |
---|---|---|
GO:0004424 | imidazoleglycerol-phosphate dehydratase activity | Yes |
GO:0000105 | histidine biosynthetic process | Yes |
GO:0043436 | oxoacid metabolic process | No |
GO:0008150 | biological_process | No |
GO:0009058 | biosynthetic process | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0006520 | cellular amino acid metabolic process | No |
GO:0046394 | carboxylic acid biosynthetic process | No |
GO:0003824 | catalytic activity | No |
GO:0071704 | organic substance metabolic process | No |
GO:0006082 | organic acid metabolic process | No |
GO:0016836 | hydro-lyase activity | No |
GO:0006547 | histidine metabolic process | No |
GO:0009987 | cellular process | No |
GO:0008152 | metabolic process | No |
GO:0016053 | organic acid biosynthetic process | No |
GO:0044283 | small molecule biosynthetic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0016835 | carbon-oxygen lyase activity | No |
GO:0044238 | primary metabolic process | No |
GO:0019752 | carboxylic acid metabolic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0044281 | small molecule metabolic process | No |
GO:0003674 | molecular_function | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0016829 | lyase activity | No |
GO:0008652 | cellular amino acid biosynthetic process | No |
Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
---|---|---|---|---|---|---|---|---|---|---|---|
Nucleus | 0.4086 | 0.4923 | 0.0311 | 0.1197 | 0.4833 | 0.0159 | 0.2239 | 0.4522 | 0.1487 | 0.0727 |
Orthofinder run ID | 4 |
Orthogroup | 1824 |
Change Orthofinder run |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|180 MGSSSTARAAALARDTNETKIQLALNLDGGDLPADTHPRLRERAAAAHASQSSGSQTIAVNTGIGFLDHMLHALA KHAGWSLALHCDGDLHIDDHHTAEDCCIALGYVFNKALGTPTGLARFGSAYAPLDEALSRAVVDLSNRPYSVVDL GLKREWLGKLSTEMVPHCLQSFAQAARITMHVDCIRGDNDHHRAESAFKALAVAIRLATSKVQGKEGEVPSTKGT LTA* |
Coding | >Hirsu2|180 ATGGGCTCCTCAAGCACGGCGCGGGCGGCGGCCCTGGCCCGCGACACCAACGAGACCAAGATCCAGCTGGCGCTC AACCTCGACGGCGGCGACCTGCCGGCCGACACGCACCCGCGCCTGCGCGAGCGCGCCGCCGCCGCCCACGCCTCG CAGTCGTCCGGGTCGCAGACCATCGCCGTCAACACCGGCATCGGCTTCCTCGACCACATGCTGCACGCCCTGGCC AAGCACGCGGGCTGGAGCCTGGCCCTGCACTGCGACGGCGACCTCCACATCGACGACCACCACACTGCCGAAGAC TGCTGCATCGCCCTCGGCTACGTCTTCAACAAGGCGCTCGGCACCCCGACCGGCCTCGCCCGCTTCGGCTCCGCC TACGCCCCGCTCGACGAGGCCCTCTCGCGCGCCGTCGTCGACCTGTCCAACCGCCCCTACAGCGTCGTCGACCTC GGCCTCAAGCGCGAGTGGCTGGGCAAGCTCAGCACCGAGATGGTGCCCCACTGCCTGCAGAGCTTCGCCCAGGCC GCCCGCATCACCATGCACGTCGACTGCATCCGCGGCGACAACGACCACCACCGCGCCGAGAGCGCCTTCAAGGCC CTTGCCGTCGCCATCCGCCTCGCCACCTCCAAGGTCCAGGGCAAGGAGGGCGAGGTCCCGAGCACCAAGGGCACC CTGACGGCCTGA |
Transcript | >Hirsu2|180 ATGGGCTCCTCAAGCACGGCGCGGGCGGCGGCCCTGGCCCGCGACACCAACGAGACCAAGATCCAGCTGGCGCTC AACCTCGACGGCGGCGACCTGCCGGCCGACACGCACCCGCGCCTGCGCGAGCGCGCCGCCGCCGCCCACGCCTCG CAGTCGTCCGGGTCGCAGACCATCGCCGTCAACACCGGCATCGGCTTCCTCGACCACATGCTGCACGCCCTGGCC AAGCACGCGGGCTGGAGCCTGGCCCTGCACTGCGACGGCGACCTCCACATCGACGACCACCACACTGCCGAAGAC TGCTGCATCGCCCTCGGCTACGTCTTCAACAAGGCGCTCGGCACCCCGACCGGCCTCGCCCGCTTCGGCTCCGCC TACGCCCCGCTCGACGAGGCCCTCTCGCGCGCCGTCGTCGACCTGTCCAACCGCCCCTACAGCGTCGTCGACCTC GGCCTCAAGCGCGAGTGGCTGGGCAAGCTCAGCACCGAGATGGTGCCCCACTGCCTGCAGAGCTTCGCCCAGGCC GCCCGCATCACCATGCACGTCGACTGCATCCGCGGCGACAACGACCACCACCGCGCCGAGAGCGCCTTCAAGGCC CTTGCCGTCGCCATCCGCCTCGCCACCTCCAAGGTCCAGGGCAAGGAGGGCGAGGTCCCGAGCACCAAGGGCACC CTGACGGCCTGA |
Gene | >Hirsu2|180 ATGGGCTCCTCAAGCACGGCGCGGGCGGCGGCCCTGGCCCGCGACACCAACGAGACCAAGATCCAGCTGGCGCTC AACCTCGACGGCGGCGACCTGCCGGCCGACACGCACCCGCGCCTGCGCGAGCGCGCCGCCGCCGCCCACGCCTCG CAGTCGTCCGGGTCGCAGACCATCGCCGTCAACACCGGCATCGGCTTCCTCGACCACATGCTGCACGCCCTGGCC AAGCACGCGGGCTGGAGCCTGGCCCTGCACTGCGACGGCGACCTCCACAGTCCGTTCCTGACCCCCACCCCCCTT CCTTGTCGTCCTCCTCGCTCCCCATCGCTGCGCTGACGACATCAAAAACAGTCGACGACCACCACACTGCCGAAG ACTGCTGCATCGCCCTCGGCTACGTCTTCAACAAGGCGCTCGGCACCCCGACCGGCCTCGCCCGCTTCGGCTCCG CCTACGCCCCGCTCGACGAGGCCCTCTCGCGCGCCGTCGTCGACCTGTCCAACCGCCCCTACAGCGTCGTCGACC TCGGCCTCAAGCGCGAGTGGCTGGGCAAGCTCAGCACCGAGATGGTGCCCCACTGCCTGCAGAGCTTCGCCCAGG CCGCCCGCATCACCATGCACGTCGACTGCATCCGCGGCGACAACGACCACCACCGCGCCGAGAGCGCCTTCAAGG CCCTTGCCGTCGCCATCCGCCTCGCCACCTCCAAGGTCCAGGGCAAGGAGGGCGAGGTCCCGAGCACCAAGGGCA CCCTGACGGCCTGA |