Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|180
Gene name
LocationContig_103:13107..13871
Strand-
Gene length (bp)764
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00475 IGPD Imidazoleglycerol-phosphate dehydratase 5.3E-59 62 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HEG3|HIS7_NEUCR Imidazoleglycerol-phosphate dehydratase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=65E11.030 PE=3 SV=1 8 227 7.0E-127
sp|P34041|HIS7_TRIHA Imidazoleglycerol-phosphate dehydratase OS=Trichoderma harzianum GN=his3 PE=2 SV=1 1 206 4.0E-117
sp|O42621|HIS7_MAGO7 Imidazoleglycerol-phosphate dehydratase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PTH3 PE=3 SV=2 5 227 4.0E-113
sp|P06633|HIS7_YEAST Imidazoleglycerol-phosphate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS3 PE=1 SV=2 6 226 8.0E-98
sp|Q9C1D4|HIS7_PICST Imidazoleglycerol-phosphate dehydratase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HIS3 PE=3 SV=2 7 226 8.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HEG3|HIS7_NEUCR Imidazoleglycerol-phosphate dehydratase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=65E11.030 PE=3 SV=1 8 227 7.0E-127
sp|P34041|HIS7_TRIHA Imidazoleglycerol-phosphate dehydratase OS=Trichoderma harzianum GN=his3 PE=2 SV=1 1 206 4.0E-117
sp|O42621|HIS7_MAGO7 Imidazoleglycerol-phosphate dehydratase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PTH3 PE=3 SV=2 5 227 4.0E-113
sp|P06633|HIS7_YEAST Imidazoleglycerol-phosphate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS3 PE=1 SV=2 6 226 8.0E-98
sp|Q9C1D4|HIS7_PICST Imidazoleglycerol-phosphate dehydratase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HIS3 PE=3 SV=2 7 226 8.0E-98
sp|P56090|HIS7_CANAX Imidazoleglycerol-phosphate dehydratase OS=Candida albicans GN=HIS3 PE=3 SV=1 7 227 8.0E-97
sp|Q6CLR6|HIS7_KLULA Imidazoleglycerol-phosphate dehydratase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIS3 PE=3 SV=1 8 226 1.0E-96
sp|Q92447|HIS7_PICPA Imidazoleglycerol-phosphate dehydratase OS=Komagataella pastoris GN=HIS3 PE=3 SV=1 8 226 5.0E-96
sp|Q02986|HIS7_LACK1 Imidazoleglycerol-phosphate dehydratase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=HIS3 PE=3 SV=1 8 226 8.0E-95
sp|H9C4A4|HIS7_CANHU Imidazoleglycerol-phosphate dehydratase OS=Candida humilis GN=HIS3 PE=1 SV=1 6 226 5.0E-94
sp|Q6XD66|HIS7_TORDE Imidazoleglycerol-phosphate dehydratase OS=Torulaspora delbrueckii GN=HIS3 PE=3 SV=1 6 226 5.0E-94
sp|Q9UVE1|HIS7_ZYGRC Imidazoleglycerol-phosphate dehydratase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HIS3 PE=3 SV=2 10 226 3.0E-93
sp|Q96UK2|HIS7_ZYGBA Imidazoleglycerol-phosphate dehydratase OS=Zygosaccharomyces bailii GN=HIS3 PE=2 SV=1 10 226 2.0E-91
sp|Q75B47|HIS7_ASHGO Imidazoleglycerol-phosphate dehydratase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HIS3 PE=3 SV=2 5 226 8.0E-91
sp|Q12578|HIS7_CANGA Imidazoleglycerol-phosphate dehydratase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HIS3 PE=3 SV=2 10 226 4.0E-90
sp|O94126|HIS7_CYBJA Imidazoleglycerol-phosphate dehydratase OS=Cyberlindnera jadinii GN=HIS3 PE=3 SV=1 8 226 7.0E-89
sp|Q6JV40|HIS7_KLUMA Imidazoleglycerol-phosphate dehydratase OS=Kluyveromyces marxianus GN=HIS3 PE=3 SV=1 8 226 3.0E-88
sp|P40374|HIS7_SCHPO Imidazoleglycerol-phosphate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his5 PE=1 SV=1 8 226 1.0E-87
sp|P0CO22|HIS7_CRYNJ Imidazoleglycerol-phosphate dehydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIS3 PE=1 SV=1 6 226 7.0E-76
sp|P0CO23|HIS7_CRYNB Imidazoleglycerol-phosphate dehydratase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIS3 PE=3 SV=1 6 226 7.0E-76
sp|O94153|HIS7_PHARH Imidazoleglycerol-phosphate dehydratase OS=Phaffia rhodozyma GN=HIS3 PE=3 SV=1 1 226 3.0E-74
sp|P28624|HIS7_PHYPR Imidazoleglycerol-phosphate dehydratase OS=Phytophthora parasitica GN=HIS3 PE=3 SV=1 5 226 9.0E-60
sp|B0V8S1|HIS7_ACIBY Imidazoleglycerol-phosphate dehydratase OS=Acinetobacter baumannii (strain AYE) GN=hisB PE=3 SV=1 4 226 6.0E-58
sp|B0VPC2|HIS7_ACIBS Imidazoleglycerol-phosphate dehydratase OS=Acinetobacter baumannii (strain SDF) GN=hisB PE=3 SV=1 4 226 7.0E-58
sp|Q6F7A8|HIS7_ACIAD Imidazoleglycerol-phosphate dehydratase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisB PE=3 SV=1 4 226 3.0E-57
sp|A5V9V7|HIS7_SPHWW Imidazoleglycerol-phosphate dehydratase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=hisB PE=3 SV=1 8 226 3.0E-56
sp|B1LU98|HIS7_METRJ Imidazoleglycerol-phosphate dehydratase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=hisB PE=3 SV=1 8 226 6.0E-56
sp|A7NQZ5|HIS7_ROSCS Imidazoleglycerol-phosphate dehydratase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=hisB PE=3 SV=1 8 226 7.0E-56
sp|Q5NMD3|HIS7_ZYMMO Imidazoleglycerol-phosphate dehydratase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisB PE=3 SV=2 8 226 1.0E-55
sp|A0LBT6|HIS7_MAGMM Imidazoleglycerol-phosphate dehydratase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=hisB PE=3 SV=1 7 227 2.0E-55
sp|A5USC4|HIS7_ROSS1 Imidazoleglycerol-phosphate dehydratase OS=Roseiflexus sp. (strain RS-1) GN=hisB PE=3 SV=1 5 226 3.0E-55
sp|Q1GNC0|HIS7_SPHAL Imidazoleglycerol-phosphate dehydratase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=hisB PE=3 SV=1 8 226 3.0E-55
sp|Q2N8I5|HIS7_ERYLH Imidazoleglycerol-phosphate dehydratase OS=Erythrobacter litoralis (strain HTCC2594) GN=hisB PE=3 SV=1 8 226 4.0E-55
sp|Q2VYI7|HIS7_MAGSA Imidazoleglycerol-phosphate dehydratase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=hisB PE=3 SV=2 8 226 5.0E-55
sp|Q31E67|HIS7_THICR Imidazoleglycerol-phosphate dehydratase OS=Thiomicrospira crunogena (strain XCL-2) GN=hisB PE=3 SV=1 8 226 2.0E-53
sp|B3PGA1|HIS7_CELJU Imidazoleglycerol-phosphate dehydratase OS=Cellvibrio japonicus (strain Ueda107) GN=hisB PE=3 SV=1 8 226 4.0E-53
sp|Q5FTN7|HIS7_GLUOX Imidazoleglycerol-phosphate dehydratase OS=Gluconobacter oxydans (strain 621H) GN=hisB PE=3 SV=1 5 226 6.0E-53
sp|B8EM89|HIS7_METSB Imidazoleglycerol-phosphate dehydratase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=hisB PE=3 SV=1 8 226 6.0E-53
sp|A2SE06|HIS7_METPP Imidazoleglycerol-phosphate dehydratase OS=Methylibium petroleiphilum (strain PM1) GN=hisB PE=3 SV=1 8 226 6.0E-53
sp|Q1H4R5|HIS7_METFK Imidazoleglycerol-phosphate dehydratase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hisB PE=3 SV=1 8 226 1.0E-52
sp|P18787|HIS7_AZOBR Imidazoleglycerol-phosphate dehydratase OS=Azospirillum brasilense GN=hisB PE=3 SV=1 9 226 1.0E-52
sp|A4G9I9|HIS7_HERAR Imidazoleglycerol-phosphate dehydratase OS=Herminiimonas arsenicoxydans GN=hisB PE=3 SV=1 5 226 2.0E-52
sp|Q1R077|HIS7_CHRSD Imidazoleglycerol-phosphate dehydratase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hisB PE=3 SV=1 8 226 4.0E-52
sp|B1ZAD1|HIS7_METPB Imidazoleglycerol-phosphate dehydratase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=hisB PE=3 SV=1 8 226 4.0E-52
sp|Q9A232|HIS7_CAUCR Imidazoleglycerol-phosphate dehydratase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisB PE=3 SV=1 7 226 5.0E-52
sp|B8GW12|HIS7_CAUCN Imidazoleglycerol-phosphate dehydratase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hisB PE=3 SV=1 7 226 5.0E-52
sp|Q21NH8|HIS7_SACD2 Imidazoleglycerol-phosphate dehydratase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=hisB PE=3 SV=1 8 226 5.0E-52
sp|Q8KY27|HIS7_AMIAM Imidazoleglycerol-phosphate dehydratase OS=Aminomonas aminovorus GN=hisB PE=3 SV=1 8 226 8.0E-52
sp|A3PB03|HIS7_PROM0 Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9301) GN=hisB PE=3 SV=1 5 226 8.0E-52
sp|B7KPM4|HIS7_METC4 Imidazoleglycerol-phosphate dehydratase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=hisB PE=3 SV=1 8 226 1.0E-51
sp|A9W5T6|HIS7_METEP Imidazoleglycerol-phosphate dehydratase OS=Methylobacterium extorquens (strain PA1) GN=hisB PE=3 SV=1 8 226 2.0E-51
sp|Q2S2A1|HIS7_SALRD Imidazoleglycerol-phosphate dehydratase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hisB PE=3 SV=1 4 226 2.0E-51
sp|A6T379|HIS7_JANMA Imidazoleglycerol-phosphate dehydratase OS=Janthinobacterium sp. (strain Marseille) GN=hisB PE=3 SV=1 5 226 2.0E-51
sp|Q9HU41|HIS7_PSEAE Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisB PE=3 SV=1 8 226 3.0E-51
sp|Q02EM2|HIS7_PSEAB Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hisB PE=3 SV=1 8 226 3.0E-51
sp|B7V3N7|HIS7_PSEA8 Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas aeruginosa (strain LESB58) GN=hisB PE=3 SV=1 8 226 3.0E-51
sp|A6VDR3|HIS7_PSEA7 Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas aeruginosa (strain PA7) GN=hisB PE=3 SV=1 8 226 3.0E-51
sp|A1VK39|HIS7_POLNA Imidazoleglycerol-phosphate dehydratase OS=Polaromonas naphthalenivorans (strain CJ2) GN=hisB PE=3 SV=1 8 226 3.0E-51
sp|Q31CQ1|HIS7_PROM9 Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9312) GN=hisB PE=3 SV=1 5 226 6.0E-51
sp|A2BP81|HIS7_PROMS Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain AS9601) GN=hisB PE=3 SV=1 5 226 6.0E-51
sp|A3PI66|HIS7_RHOS1 Imidazoleglycerol-phosphate dehydratase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=hisB PE=3 SV=1 8 226 6.0E-51
sp|Q7V314|HIS7_PROMP Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hisB PE=3 SV=1 5 226 7.0E-51
sp|A5CVR1|HIS7_VESOH Imidazoleglycerol-phosphate dehydratase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hisB PE=3 SV=1 12 226 7.0E-51
sp|A4VRW2|HIS7_PSEU5 Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas stutzeri (strain A1501) GN=hisB PE=3 SV=1 6 226 1.0E-50
sp|Q46CW9|HIS7_METBF Imidazoleglycerol-phosphate dehydratase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hisB PE=3 SV=1 8 226 1.0E-50
sp|A5E8F1|HIS7_BRASB Imidazoleglycerol-phosphate dehydratase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=hisB PE=3 SV=1 8 226 2.0E-50
sp|Q12FD0|HIS7_POLSJ Imidazoleglycerol-phosphate dehydratase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=hisB PE=3 SV=1 1 226 2.0E-50
sp|Q3SWE7|HIS7_NITWN Imidazoleglycerol-phosphate dehydratase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisB PE=3 SV=1 8 226 2.0E-50
sp|A9GZY1|HIS7_GLUDA Imidazoleglycerol-phosphate dehydratase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=hisB PE=3 SV=1 6 226 2.0E-50
sp|Q8ESR9|HIS7_OCEIH Imidazoleglycerol-phosphate dehydratase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisB PE=3 SV=1 8 226 2.0E-50
sp|B5EQE9|HIS7_ACIF5 Imidazoleglycerol-phosphate dehydratase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=hisB PE=3 SV=1 8 227 2.0E-50
sp|B7JA16|HIS7_ACIF2 Imidazoleglycerol-phosphate dehydratase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=hisB PE=3 SV=1 8 227 2.0E-50
sp|Q5P792|HIS7_AROAE Imidazoleglycerol-phosphate dehydratase OS=Aromatoleum aromaticum (strain EbN1) GN=hisB PE=3 SV=1 8 226 2.0E-50
sp|A8G2U2|HIS7_PROM2 Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9215) GN=hisB PE=3 SV=1 5 226 2.0E-50
sp|B0T7A1|HIS7_CAUSK Imidazoleglycerol-phosphate dehydratase OS=Caulobacter sp. (strain K31) GN=hisB PE=3 SV=1 7 226 4.0E-50
sp|Q2YAU7|HIS7_NITMU Imidazoleglycerol-phosphate dehydratase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=hisB PE=3 SV=1 8 226 4.0E-50
sp|B2SZ63|HIS7_BURPP Imidazoleglycerol-phosphate dehydratase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hisB PE=3 SV=1 8 226 5.0E-50
sp|Q7VSY9|HIS7_BORPE Imidazoleglycerol-phosphate dehydratase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisB PE=3 SV=2 8 226 5.0E-50
sp|Q7W2Y2|HIS7_BORPA Imidazoleglycerol-phosphate dehydratase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisB PE=3 SV=1 8 226 5.0E-50
sp|Q7WDY2|HIS7_BORBR Imidazoleglycerol-phosphate dehydratase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisB PE=3 SV=1 8 226 5.0E-50
sp|Q13TQ6|HIS7_BURXL Imidazoleglycerol-phosphate dehydratase OS=Burkholderia xenovorans (strain LB400) GN=hisB PE=3 SV=1 8 226 5.0E-50
sp|B9KPD2|HIS7_RHOSK Imidazoleglycerol-phosphate dehydratase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hisB PE=3 SV=1 8 226 6.0E-50
sp|O33564|HIS7_RHOS4 Imidazoleglycerol-phosphate dehydratase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisB PE=3 SV=2 8 226 6.0E-50
sp|C1DJC9|HIS7_AZOVD Imidazoleglycerol-phosphate dehydratase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=hisB PE=3 SV=1 8 226 8.0E-50
sp|Q4KJS8|HIS7_PSEF5 Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisB PE=3 SV=1 8 226 8.0E-50
sp|A1KAV7|HIS7_AZOSB Imidazoleglycerol-phosphate dehydratase OS=Azoarcus sp. (strain BH72) GN=hisB PE=3 SV=2 8 226 8.0E-50
sp|A2BUR2|HIS7_PROM5 Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9515) GN=hisB PE=3 SV=1 5 226 8.0E-50
sp|Q4FNT4|HIS7_PELUB Imidazoleglycerol-phosphate dehydratase OS=Pelagibacter ubique (strain HTCC1062) GN=hisB PE=3 SV=1 8 226 1.0E-49
sp|C5BMF2|HIS7_TERTT Imidazoleglycerol-phosphate dehydratase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=hisB PE=3 SV=1 8 226 1.0E-49
sp|A4X9Q4|HIS7_SALTO Imidazoleglycerol-phosphate dehydratase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=hisB PE=3 SV=1 7 226 1.0E-49
sp|A8LX62|HIS7_SALAI Imidazoleglycerol-phosphate dehydratase OS=Salinispora arenicola (strain CNS-205) GN=hisB PE=3 SV=1 7 226 1.0E-49
sp|Q2KTT4|HIS7_BORA1 Imidazoleglycerol-phosphate dehydratase OS=Bordetella avium (strain 197N) GN=hisB PE=3 SV=1 8 226 2.0E-49
sp|Q3KJI9|HIS7_PSEPF Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisB PE=3 SV=1 8 226 2.0E-49
sp|Q8PWS1|HIS7_METMA Imidazoleglycerol-phosphate dehydratase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hisB PE=3 SV=1 8 226 2.0E-49
sp|Q89WM8|HIS7_BRADU Imidazoleglycerol-phosphate dehydratase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisB PE=3 SV=1 8 226 3.0E-49
sp|A7IHP3|HIS7_XANP2 Imidazoleglycerol-phosphate dehydratase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=hisB PE=3 SV=1 8 226 3.0E-49
sp|A9HWC8|HIS7_BORPD Imidazoleglycerol-phosphate dehydratase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hisB PE=3 SV=1 8 226 3.0E-49
sp|Q2RNA4|HIS7_RHORT Imidazoleglycerol-phosphate dehydratase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hisB PE=3 SV=1 8 226 4.0E-49
sp|B3PWI5|HIS7_RHIE6 Imidazoleglycerol-phosphate dehydratase OS=Rhizobium etli (strain CIAT 652) GN=hisB PE=3 SV=1 1 226 5.0E-49
sp|B2ICL6|HIS7_BEII9 Imidazoleglycerol-phosphate dehydratase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=hisB PE=3 SV=1 8 226 5.0E-49
sp|Q5F7D6|HIS7_NEIG1 Imidazoleglycerol-phosphate dehydratase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hisB PE=3 SV=2 3 228 5.0E-49
sp|A1KV07|HIS7_NEIMF Imidazoleglycerol-phosphate dehydratase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=hisB PE=3 SV=1 3 228 5.0E-49
sp|P64371|HIS7_NEIMB Imidazoleglycerol-phosphate dehydratase OS=Neisseria meningitidis serogroup B (strain MC58) GN=hisB PE=3 SV=1 3 228 5.0E-49
sp|P64370|HIS7_NEIMA Imidazoleglycerol-phosphate dehydratase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hisB PE=3 SV=1 3 228 5.0E-49
sp|A9M186|HIS7_NEIM0 Imidazoleglycerol-phosphate dehydratase OS=Neisseria meningitidis serogroup C (strain 053442) GN=hisB PE=3 SV=1 3 228 5.0E-49
sp|Q2KE56|HIS7_RHIEC Imidazoleglycerol-phosphate dehydratase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=hisB PE=3 SV=1 1 226 6.0E-49
sp|B2UX23|HIS7_CLOBA Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hisB PE=3 SV=1 8 226 6.0E-49
sp|B1JED5|HIS7_PSEPW Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas putida (strain W619) GN=hisB PE=3 SV=1 8 226 7.0E-49
sp|A1U5H8|HIS7_MARHV Imidazoleglycerol-phosphate dehydratase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hisB PE=3 SV=1 8 226 8.0E-49
sp|B2JHY3|HIS7_BURP8 Imidazoleglycerol-phosphate dehydratase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hisB PE=3 SV=1 8 226 8.0E-49
sp|C3MBC5|HIS7_RHISN Imidazoleglycerol-phosphate dehydratase OS=Rhizobium sp. (strain NGR234) GN=hisB PE=3 SV=1 1 226 9.0E-49
sp|B5ZV97|HIS7_RHILW Imidazoleglycerol-phosphate dehydratase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=hisB PE=3 SV=1 1 226 9.0E-49
sp|Q1I3G4|HIS7_PSEE4 Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas entomophila (strain L48) GN=hisB PE=3 SV=1 8 226 1.0E-48
sp|Q1QRX4|HIS7_NITHX Imidazoleglycerol-phosphate dehydratase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hisB PE=3 SV=1 8 226 1.0E-48
sp|A8HYU9|HIS7_AZOC5 Imidazoleglycerol-phosphate dehydratase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=hisB PE=3 SV=1 8 226 1.0E-48
sp|Q1MNB6|HIS7_RHIL3 Imidazoleglycerol-phosphate dehydratase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=hisB PE=3 SV=1 1 226 2.0E-48
sp|Q3AQD7|HIS7_CHLCH Imidazoleglycerol-phosphate dehydratase OS=Chlorobium chlorochromatii (strain CaD3) GN=hisB PE=3 SV=1 7 226 2.0E-48
sp|Q0VM69|HIS7_ALCBS Imidazoleglycerol-phosphate dehydratase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hisB PE=3 SV=1 6 227 2.0E-48
sp|Q7P0F3|HIS7_CHRVO Imidazoleglycerol-phosphate dehydratase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hisB PE=3 SV=1 8 228 2.0E-48
sp|A6LT19|HIS7_CLOB8 Imidazoleglycerol-phosphate dehydratase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=hisB PE=3 SV=1 8 226 2.0E-48
sp|B2UEE9|HIS7_RALPJ Imidazoleglycerol-phosphate dehydratase OS=Ralstonia pickettii (strain 12J) GN=hisB PE=3 SV=1 7 226 3.0E-48
sp|Q21CK7|HIS7_RHOPB Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain BisB18) GN=hisB PE=3 SV=1 8 226 3.0E-48
sp|A7HSH4|HIS7_PARL1 Imidazoleglycerol-phosphate dehydratase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=hisB PE=3 SV=1 1 226 3.0E-48
sp|B1XSV0|HIS7_POLNS Imidazoleglycerol-phosphate dehydratase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=hisB PE=3 SV=1 8 226 4.0E-48
sp|A4SV17|HIS7_POLSQ Imidazoleglycerol-phosphate dehydratase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=hisB PE=3 SV=1 8 226 4.0E-48
sp|Q92TB0|HIS7_RHIME Imidazoleglycerol-phosphate dehydratase OS=Rhizobium meliloti (strain 1021) GN=hisB PE=3 SV=1 1 226 4.0E-48
sp|P58878|HIS7_METAC Imidazoleglycerol-phosphate dehydratase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisB PE=3 SV=1 8 226 4.0E-48
sp|C1DAK1|HIS7_LARHH Imidazoleglycerol-phosphate dehydratase OS=Laribacter hongkongensis (strain HLHK9) GN=hisB PE=3 SV=1 8 228 5.0E-48
sp|Q8XV81|HIS7_RALSO Imidazoleglycerol-phosphate dehydratase OS=Ralstonia solanacearum (strain GMI1000) GN=hisB PE=3 SV=1 7 226 5.0E-48
sp|A4Y087|HIS7_PSEMY Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas mendocina (strain ymp) GN=hisB PE=3 SV=1 8 226 5.0E-48
sp|B2FPM1|HIS7_STRMK Histidine biosynthesis bifunctional protein HisB OS=Stenotrophomonas maltophilia (strain K279a) GN=hisB PE=3 SV=1 8 226 6.0E-48
sp|B4RBJ4|HIS7_PHEZH Imidazoleglycerol-phosphate dehydratase OS=Phenylobacterium zucineum (strain HLK1) GN=hisB PE=3 SV=1 7 226 6.0E-48
sp|A6VTA8|HIS7_MARMS Imidazoleglycerol-phosphate dehydratase OS=Marinomonas sp. (strain MWYL1) GN=hisB PE=3 SV=1 8 226 7.0E-48
sp|A6UEK7|HIS7_SINMW Imidazoleglycerol-phosphate dehydratase OS=Sinorhizobium medicae (strain WSM419) GN=hisB PE=3 SV=1 1 226 1.0E-47
sp|Q18C69|HIS7_PEPD6 Imidazoleglycerol-phosphate dehydratase OS=Peptoclostridium difficile (strain 630) GN=hisB PE=3 SV=1 8 226 1.0E-47
sp|Q39K89|HIS7_BURL3 Imidazoleglycerol-phosphate dehydratase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisB PE=3 SV=1 8 226 2.0E-47
sp|Q82WM4|HIS7_NITEU Imidazoleglycerol-phosphate dehydratase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hisB PE=3 SV=1 8 226 2.0E-47
sp|Q88R45|HIS7_PSEPK Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas putida (strain KT2440) GN=hisB PE=3 SV=2 8 226 2.0E-47
sp|A5VX72|HIS7_PSEP1 Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hisB PE=3 SV=2 8 226 2.0E-47
sp|Q21U94|HIS7_RHOFT Imidazoleglycerol-phosphate dehydratase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=hisB PE=3 SV=1 7 226 2.0E-47
sp|Q3B4Y6|HIS7_CHLL7 Imidazoleglycerol-phosphate dehydratase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisB PE=3 SV=1 3 226 3.0E-47
sp|B8GU29|HIS7_THISH Imidazoleglycerol-phosphate dehydratase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hisB PE=3 SV=1 6 226 3.0E-47
sp|A4YJV1|HIS7_BRASO Imidazoleglycerol-phosphate dehydratase OS=Bradyrhizobium sp. (strain ORS278) GN=hisB PE=3 SV=1 8 226 3.0E-47
sp|Q03VX7|HIS7_LEUMM Imidazoleglycerol-phosphate dehydratase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=hisB PE=3 SV=1 7 226 3.0E-47
sp|Q845V1|HIS7_BURM1 Imidazoleglycerol-phosphate dehydratase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisB PE=3 SV=1 8 226 3.0E-47
sp|Q0AEU4|HIS7_NITEC Imidazoleglycerol-phosphate dehydratase OS=Nitrosomonas eutropha (strain C91) GN=hisB PE=3 SV=1 8 226 4.0E-47
sp|Q8DTQ9|HIS7_STRMU Imidazoleglycerol-phosphate dehydratase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hisB PE=3 SV=1 8 226 4.0E-47
sp|Q4ZLP8|HIS7_PSEU2 Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hisB PE=3 SV=1 8 226 4.0E-47
sp|Q87UG0|HIS7_PSESM Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hisB PE=3 SV=1 8 226 4.0E-47
sp|C3K6U9|HIS7_PSEFS Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas fluorescens (strain SBW25) GN=hisB PE=3 SV=1 8 226 4.0E-47
sp|Q48C77|HIS7_PSE14 Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hisB PE=3 SV=1 8 226 4.0E-47
sp|Q1LIA8|HIS7_CUPMC Imidazoleglycerol-phosphate dehydratase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hisB PE=3 SV=1 8 226 5.0E-47
sp|Q3JMZ8|HIS7_BURP1 Imidazoleglycerol-phosphate dehydratase OS=Burkholderia pseudomallei (strain 1710b) GN=hisB PE=3 SV=1 8 226 5.0E-47
sp|Q46WL4|HIS7_CUPPJ Imidazoleglycerol-phosphate dehydratase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hisB PE=3 SV=1 8 226 6.0E-47
sp|Q2SUA4|HIS7_BURTA Imidazoleglycerol-phosphate dehydratase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=hisB PE=3 SV=1 8 226 6.0E-47
sp|Q88UE0|HIS7_LACPL Imidazoleglycerol-phosphate dehydratase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisB PE=3 SV=2 8 226 7.0E-47
sp|A1TKZ1|HIS7_ACIAC Imidazoleglycerol-phosphate dehydratase OS=Acidovorax citrulli (strain AAC00-1) GN=hisB PE=3 SV=1 3 226 7.0E-47
sp|B3R798|HIS7_CUPTR Imidazoleglycerol-phosphate dehydratase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=hisB PE=3 SV=1 8 226 8.0E-47
sp|Q0K689|HIS7_CUPNH Imidazoleglycerol-phosphate dehydratase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hisB PE=3 SV=1 8 226 8.0E-47
sp|B6JAL6|HIS7_OLICO Imidazoleglycerol-phosphate dehydratase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=hisB PE=3 SV=1 8 226 8.0E-47
sp|Q0BIW8|HIS7_BURCM Imidazoleglycerol-phosphate dehydratase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hisB PE=3 SV=1 8 226 8.0E-47
sp|B1YRV7|HIS7_BURA4 Imidazoleglycerol-phosphate dehydratase OS=Burkholderia ambifaria (strain MC40-6) GN=hisB PE=3 SV=1 8 226 8.0E-47
sp|A8LQZ6|HIS7_DINSH Imidazoleglycerol-phosphate dehydratase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=hisB PE=3 SV=1 8 226 8.0E-47
sp|B4E637|HIS7_BURCJ Imidazoleglycerol-phosphate dehydratase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hisB PE=3 SV=1 8 226 1.0E-46
sp|B1JUA1|HIS7_BURCC Imidazoleglycerol-phosphate dehydratase OS=Burkholderia cenocepacia (strain MC0-3) GN=hisB PE=3 SV=1 8 226 1.0E-46
sp|A4JAW5|HIS7_BURVG Imidazoleglycerol-phosphate dehydratase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hisB PE=3 SV=1 8 226 1.0E-46
sp|Q0W0J2|HIS7_METAR Imidazoleglycerol-phosphate dehydratase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hisB PE=3 SV=1 8 226 1.0E-46
sp|Q50504|HIS7_METTH Imidazoleglycerol-phosphate dehydratase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisB PE=3 SV=1 6 226 1.0E-46
sp|Q3AD51|HIS7_CARHZ Imidazoleglycerol-phosphate dehydratase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisB PE=3 SV=1 8 226 1.0E-46
sp|Q0A5D0|HIS7_ALKEH Imidazoleglycerol-phosphate dehydratase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=hisB PE=3 SV=1 8 226 1.0E-46
sp|Q1GF01|HIS7_RUEST Imidazoleglycerol-phosphate dehydratase OS=Ruegeria sp. (strain TM1040) GN=hisB PE=3 SV=1 8 226 1.0E-46
sp|Q13E36|HIS7_RHOPS Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain BisB5) GN=hisB PE=3 SV=1 8 226 1.0E-46
sp|A0K3V4|HIS7_BURCH Imidazoleglycerol-phosphate dehydratase OS=Burkholderia cenocepacia (strain HI2424) GN=hisB PE=3 SV=1 8 226 1.0E-46
sp|Q1BS27|HIS7_BURCA Imidazoleglycerol-phosphate dehydratase OS=Burkholderia cenocepacia (strain AU 1054) GN=hisB PE=3 SV=1 8 226 1.0E-46
sp|Q2J344|HIS7_RHOP2 Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain HaA2) GN=hisB PE=3 SV=1 8 226 2.0E-46
sp|Q63Q88|HIS7_BURPS Imidazoleglycerol-phosphate dehydratase OS=Burkholderia pseudomallei (strain K96243) GN=hisB PE=3 SV=1 8 226 2.0E-46
sp|A3NE97|HIS7_BURP6 Imidazoleglycerol-phosphate dehydratase OS=Burkholderia pseudomallei (strain 668) GN=hisB PE=3 SV=1 8 226 2.0E-46
sp|A3P031|HIS7_BURP0 Imidazoleglycerol-phosphate dehydratase OS=Burkholderia pseudomallei (strain 1106a) GN=hisB PE=3 SV=1 8 226 2.0E-46
sp|A1V8H1|HIS7_BURMS Imidazoleglycerol-phosphate dehydratase OS=Burkholderia mallei (strain SAVP1) GN=hisB PE=3 SV=1 8 226 2.0E-46
sp|Q62GE1|HIS7_BURMA Imidazoleglycerol-phosphate dehydratase OS=Burkholderia mallei (strain ATCC 23344) GN=hisB PE=3 SV=1 8 226 2.0E-46
sp|A2S750|HIS7_BURM9 Imidazoleglycerol-phosphate dehydratase OS=Burkholderia mallei (strain NCTC 10229) GN=hisB PE=3 SV=1 8 226 2.0E-46
sp|A3MPU8|HIS7_BURM7 Imidazoleglycerol-phosphate dehydratase OS=Burkholderia mallei (strain NCTC 10247) GN=hisB PE=3 SV=1 8 226 2.0E-46
sp|A4WUS5|HIS7_RHOS5 Imidazoleglycerol-phosphate dehydratase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=hisB PE=3 SV=1 8 226 2.0E-46
sp|Q11CL1|HIS7_CHESB Imidazoleglycerol-phosphate dehydratase OS=Chelativorans sp. (strain BNC1) GN=hisB PE=3 SV=1 3 226 2.0E-46
sp|Q07UQ5|HIS7_RHOP5 Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain BisA53) GN=hisB PE=3 SV=1 8 226 2.0E-46
sp|B4STN9|HIS7_STRM5 Histidine biosynthesis bifunctional protein HisB OS=Stenotrophomonas maltophilia (strain R551-3) GN=hisB PE=3 SV=1 8 226 3.0E-46
sp|B3Q8C2|HIS7_RHOPT Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain TIE-1) GN=hisB PE=3 SV=1 8 226 5.0E-46
sp|B0KI41|HIS7_PSEPG Imidazoleglycerol-phosphate dehydratase OS=Pseudomonas putida (strain GB-1) GN=hisB PE=3 SV=1 8 226 6.0E-46
sp|Q0C636|HIS7_HYPNA Imidazoleglycerol-phosphate dehydratase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hisB PE=3 SV=1 3 226 6.0E-46
sp|Q5LU92|HIS7_RUEPO Imidazoleglycerol-phosphate dehydratase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisB PE=3 SV=1 8 226 6.0E-46
sp|Q3SEU5|HIS7_THIDA Imidazoleglycerol-phosphate dehydratase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hisB PE=3 SV=1 8 226 6.0E-46
sp|B8G451|HIS7_CHLAD Imidazoleglycerol-phosphate dehydratase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=hisB PE=3 SV=1 5 226 6.0E-46
sp|Q8EFB3|HIS7_SHEON Histidine biosynthesis bifunctional protein HisB OS=Shewanella oneidensis (strain MR-1) GN=hisB PE=3 SV=1 5 226 7.0E-46
sp|A4XL23|HIS7_CALS8 Imidazoleglycerol-phosphate dehydratase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=hisB PE=3 SV=1 6 226 7.0E-46
sp|P60887|HIS7_RHOPA Imidazoleglycerol-phosphate dehydratase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisB PE=3 SV=1 8 226 9.0E-46
sp|B3WED4|HIS7_LACCB Imidazoleglycerol-phosphate dehydratase OS=Lactobacillus casei (strain BL23) GN=hisB PE=3 SV=1 51 226 9.0E-46
sp|B0K736|HIS7_THEP3 Imidazoleglycerol-phosphate dehydratase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisB PE=3 SV=1 8 226 2.0E-45
sp|A4SF66|HIS7_CHLPM Imidazoleglycerol-phosphate dehydratase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hisB PE=3 SV=1 8 226 2.0E-45
sp|A9WDZ1|HIS7_CHLAA Imidazoleglycerol-phosphate dehydratase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=hisB PE=3 SV=1 8 226 2.0E-45
sp|A1B384|HIS7_PARDP Imidazoleglycerol-phosphate dehydratase OS=Paracoccus denitrificans (strain Pd 1222) GN=hisB PE=3 SV=1 8 226 2.0E-45
sp|A5I242|HIS7_CLOBH Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hisB PE=3 SV=1 10 226 3.0E-45
sp|A7FU78|HIS7_CLOB1 Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hisB PE=3 SV=1 10 226 3.0E-45
sp|Q2G9M2|HIS7_NOVAD Imidazoleglycerol-phosphate dehydratase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=hisB PE=3 SV=1 8 226 4.0E-45
sp|A6VJJ9|HIS7_METM7 Imidazoleglycerol-phosphate dehydratase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisB PE=3 SV=1 8 226 4.0E-45
sp|Q2SMB5|HIS7_HAHCH Imidazoleglycerol-phosphate dehydratase OS=Hahella chejuensis (strain KCTC 2396) GN=hisB PE=3 SV=1 8 226 4.0E-45
sp|B3EDX3|HIS7_CHLL2 Imidazoleglycerol-phosphate dehydratase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisB PE=3 SV=1 4 226 4.0E-45
sp|Q47AM0|HIS7_DECAR Imidazoleglycerol-phosphate dehydratase OS=Dechloromonas aromatica (strain RCB) GN=hisB PE=3 SV=1 8 226 6.0E-45
sp|Q9KSX1|HIS7_VIBCH Histidine biosynthesis bifunctional protein HisB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisB PE=3 SV=1 4 226 7.0E-45
sp|A3DJF3|HIS7_CLOTH Imidazoleglycerol-phosphate dehydratase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=hisB PE=3 SV=1 8 226 8.0E-45
sp|B1ILA6|HIS7_CLOBK Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain Okra / Type B1) GN=hisB PE=3 SV=1 10 226 8.0E-45
sp|A1W432|HIS7_ACISJ Imidazoleglycerol-phosphate dehydratase OS=Acidovorax sp. (strain JS42) GN=hisB PE=3 SV=1 8 226 8.0E-45
sp|B9MDV5|HIS7_ACIET Imidazoleglycerol-phosphate dehydratase OS=Acidovorax ebreus (strain TPSY) GN=hisB PE=3 SV=1 8 226 8.0E-45
sp|Q5HKN9|HIS7_STAEQ Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisB PE=3 SV=1 52 226 1.0E-44
sp|P58877|HIS7_CALS4 Imidazoleglycerol-phosphate dehydratase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hisB PE=3 SV=1 8 226 1.0E-44
sp|Q87QK9|HIS7_VIBPA Histidine biosynthesis bifunctional protein HisB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hisB PE=3 SV=1 7 226 2.0E-44
sp|B4SD35|HIS7_PELPB Imidazoleglycerol-phosphate dehydratase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hisB PE=3 SV=1 7 226 2.0E-44
sp|Q15RU7|HIS7_PSEA6 Histidine biosynthesis bifunctional protein HisB OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hisB PE=3 SV=1 5 226 2.0E-44
sp|Q039B2|HIS7_LACC3 Imidazoleglycerol-phosphate dehydratase OS=Lactobacillus casei (strain ATCC 334) GN=hisB PE=3 SV=1 51 226 2.0E-44
sp|B2GBR2|HIS7_LACF3 Imidazoleglycerol-phosphate dehydratase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=hisB PE=3 SV=1 8 226 2.0E-44
sp|A1WW08|HIS7_HALHL Imidazoleglycerol-phosphate dehydratase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hisB PE=3 SV=1 8 226 2.0E-44
sp|A7GDQ3|HIS7_CLOBL Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=hisB PE=3 SV=1 10 226 2.0E-44
sp|Q12WC5|HIS7_METBU Imidazoleglycerol-phosphate dehydratase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hisB PE=3 SV=1 8 226 2.0E-44
sp|Q0BPW9|HIS7_GRABC Imidazoleglycerol-phosphate dehydratase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=hisB PE=3 SV=1 8 226 2.0E-44
sp|Q82AA4|HIS7_STRAW Imidazoleglycerol-phosphate dehydratase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hisB PE=3 SV=1 7 226 2.0E-44
sp|Q18DL1|HIS7_HALWD Imidazoleglycerol-phosphate dehydratase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hisB PE=3 SV=1 2 226 2.0E-44
sp|C1FN38|HIS7_CLOBJ Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hisB PE=3 SV=1 10 226 3.0E-44
sp|Q03K79|HIS7_STRTD Imidazoleglycerol-phosphate dehydratase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=hisB PE=3 SV=1 8 226 3.0E-44
sp|B3QTX2|HIS7_CHLT3 Imidazoleglycerol-phosphate dehydratase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hisB PE=3 SV=1 8 226 3.0E-44
sp|A5WBH9|HIS7_PSYWF Imidazoleglycerol-phosphate dehydratase OS=Psychrobacter sp. (strain PRwf-1) GN=hisB PE=3 SV=1 8 226 3.0E-44
sp|B9DQ86|HIS7_STACT Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus carnosus (strain TM300) GN=hisB PE=3 SV=1 55 226 3.0E-44
sp|Q8CQ94|HIS7_STAES Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisB PE=3 SV=1 52 226 4.0E-44
sp|A4FYS8|HIS7_METM5 Imidazoleglycerol-phosphate dehydratase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisB PE=3 SV=1 8 226 4.0E-44
sp|Q7MLS4|HIS7_VIBVY Histidine biosynthesis bifunctional protein HisB OS=Vibrio vulnificus (strain YJ016) GN=hisB PE=3 SV=1 7 226 5.0E-44
sp|Q8D8Q2|HIS7_VIBVU Histidine biosynthesis bifunctional protein HisB OS=Vibrio vulnificus (strain CMCP6) GN=hisB PE=3 SV=1 7 226 5.0E-44
sp|A9A756|HIS7_METM6 Imidazoleglycerol-phosphate dehydratase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hisB PE=3 SV=1 8 226 6.0E-44
sp|Q7VDQ5|HIS7_PROMA Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hisB PE=3 SV=1 8 226 7.0E-44
sp|O23346|HIS5B_ARATH Imidazoleglycerol-phosphate dehydratase 2, chloroplastic OS=Arabidopsis thaliana GN=HISN5B PE=1 SV=2 6 227 7.0E-44
sp|P60888|HIS7_METMP Imidazoleglycerol-phosphate dehydratase OS=Methanococcus maripaludis (strain S2 / LL) GN=hisB PE=3 SV=1 8 226 9.0E-44
sp|Q1IKB4|HIS7_KORVE Imidazoleglycerol-phosphate dehydratase OS=Koribacter versatilis (strain Ellin345) GN=hisB PE=3 SV=1 8 226 9.0E-44
sp|B0K626|HIS7_THEPX Imidazoleglycerol-phosphate dehydratase OS=Thermoanaerobacter sp. (strain X514) GN=hisB PE=3 SV=1 8 226 1.0E-43
sp|Q3Z880|HIS7_DEHM1 Imidazoleglycerol-phosphate dehydratase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=hisB PE=3 SV=1 6 226 2.0E-43
sp|Q8UJ89|HIS7_AGRFC Imidazoleglycerol-phosphate dehydratase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hisB PE=3 SV=2 8 226 2.0E-43
sp|A5UMI3|HIS7_METS3 Imidazoleglycerol-phosphate dehydratase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=hisB PE=3 SV=1 8 226 3.0E-43
sp|A6UN45|HIS7_METVS Imidazoleglycerol-phosphate dehydratase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hisB PE=3 SV=1 8 226 3.0E-43
sp|Q46H93|HIS7_PROMT Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain NATL2A) GN=hisB PE=3 SV=1 8 226 3.0E-43
sp|A2C0B5|HIS7_PROM1 Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain NATL1A) GN=hisB PE=3 SV=1 8 226 3.0E-43
sp|B0TDN0|HIS7_HELMI Imidazoleglycerol-phosphate dehydratase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=hisB PE=3 SV=1 8 226 3.0E-43
sp|Q47QS7|HIS7_THEFY Imidazoleglycerol-phosphate dehydratase OS=Thermobifida fusca (strain YX) GN=hisB PE=3 SV=1 7 226 3.0E-43
sp|C4L173|HIS7_EXISA Imidazoleglycerol-phosphate dehydratase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hisB PE=3 SV=1 8 224 3.0E-43
sp|Q603K0|HIS7_METCA Imidazoleglycerol-phosphate dehydratase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hisB PE=3 SV=1 8 226 4.0E-43
sp|P16247|HIS7_STRCO Imidazoleglycerol-phosphate dehydratase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hisB PE=3 SV=1 7 226 4.0E-43
sp|B9MJR6|HIS7_CALBD Imidazoleglycerol-phosphate dehydratase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=hisB PE=3 SV=1 8 226 5.0E-43
sp|Q3ZXL9|HIS7_DEHMC Imidazoleglycerol-phosphate dehydratase OS=Dehalococcoides mccartyi (strain CBDB1) GN=hisB PE=3 SV=1 6 226 6.0E-43
sp|A0LTS3|HIS7_ACIC1 Imidazoleglycerol-phosphate dehydratase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=hisB PE=3 SV=1 8 226 6.0E-43
sp|Q3J6Q4|HIS7_NITOC Imidazoleglycerol-phosphate dehydratase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisB PE=3 SV=1 10 226 6.0E-43
sp|P34047|HIS5A_ARATH Imidazoleglycerol-phosphate dehydratase 1, chloroplastic OS=Arabidopsis thaliana GN=HISN5A PE=1 SV=1 8 227 7.0E-43
sp|A8ETG3|HIS7_ARCB4 Imidazoleglycerol-phosphate dehydratase OS=Arcobacter butzleri (strain RM4018) GN=hisB PE=3 SV=1 12 226 7.0E-43
sp|A8M909|HIS7_CALMQ Imidazoleglycerol-phosphate dehydratase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hisB PE=3 SV=1 8 226 7.0E-43
sp|Q162Q6|HIS7_ROSDO Imidazoleglycerol-phosphate dehydratase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hisB PE=3 SV=1 8 226 8.0E-43
sp|A5FR28|HIS7_DEHMB Imidazoleglycerol-phosphate dehydratase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=hisB PE=3 SV=1 6 226 9.0E-43
sp|Q43072|HIS7_PEA Imidazoleglycerol-phosphate dehydratase OS=Pisum sativum GN=HIS3 PE=2 SV=1 2 227 9.0E-43
sp|Q2JNK3|HIS7_SYNJB Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=hisB PE=3 SV=1 8 226 1.0E-42
sp|B3QMG8|HIS7_CHLP8 Imidazoleglycerol-phosphate dehydratase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hisB PE=3 SV=1 6 226 1.0E-42
sp|A8FHR2|HIS7_BACP2 Imidazoleglycerol-phosphate dehydratase OS=Bacillus pumilus (strain SAFR-032) GN=hisB PE=3 SV=1 8 226 1.0E-42
sp|Q5UZF0|HIS7_HALMA Imidazoleglycerol-phosphate dehydratase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisB PE=3 SV=1 6 226 1.0E-42
sp|A0RQ64|HIS7_CAMFF Imidazoleglycerol-phosphate dehydratase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hisB PE=3 SV=1 54 226 1.0E-42
sp|Q4A046|HIS7_STAS1 Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hisB PE=3 SV=1 56 226 1.0E-42
sp|Q6ANL7|HIS7_DESPS Imidazoleglycerol-phosphate dehydratase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hisB PE=3 SV=1 8 226 1.0E-42
sp|Q5N2A1|HIS7_SYNP6 Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hisB PE=3 SV=1 8 226 1.0E-42
sp|Q31S12|HIS7_SYNE7 Imidazoleglycerol-phosphate dehydratase OS=Synechococcus elongatus (strain PCC 7942) GN=hisB PE=3 SV=1 8 226 1.0E-42
sp|B1W0M1|HIS7_STRGG Imidazoleglycerol-phosphate dehydratase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=hisB PE=3 SV=1 6 226 1.0E-42
sp|Q81G05|HIS7_BACCR Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisB PE=3 SV=1 8 226 2.0E-42
sp|Q3IRM3|HIS7_NATPD Imidazoleglycerol-phosphate dehydratase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hisB PE=3 SV=1 6 226 2.0E-42
sp|B0RSL6|HIS7_XANCB Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas campestris pv. campestris (strain B100) GN=hisB PE=3 SV=1 8 226 2.0E-42
sp|A3CNT3|HIS7_STRSV Imidazoleglycerol-phosphate dehydratase OS=Streptococcus sanguinis (strain SK36) GN=hisB PE=3 SV=1 8 226 2.0E-42
sp|A9VLH4|HIS7_BACWK Imidazoleglycerol-phosphate dehydratase OS=Bacillus weihenstephanensis (strain KBAB4) GN=hisB PE=3 SV=1 8 226 2.0E-42
sp|A1W1K1|HIS7_CAMJJ Histidine biosynthesis bifunctional protein HisB OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hisB PE=3 SV=1 5 226 2.0E-42
sp|P58882|HIS7_XANCP Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hisB PE=3 SV=1 8 226 3.0E-42
sp|Q4UU42|HIS7_XANC8 Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hisB PE=3 SV=1 8 226 3.0E-42
sp|B9IUZ7|HIS7_BACCQ Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain Q1) GN=hisB PE=3 SV=1 8 226 3.0E-42
sp|B7HKD1|HIS7_BACC7 Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain AH187) GN=hisB PE=3 SV=1 8 226 3.0E-42
sp|A8AY27|HIS7_STRGC Imidazoleglycerol-phosphate dehydratase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=hisB PE=3 SV=1 8 226 3.0E-42
sp|Q9PM76|HIS7_CAMJE Histidine biosynthesis bifunctional protein HisB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hisB PE=3 SV=1 5 226 4.0E-42
sp|Q2JRL0|HIS7_SYNJA Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain JA-3-3Ab) GN=hisB PE=3 SV=1 4 226 4.0E-42
sp|Q5KVC7|HIS7_GEOKA Imidazoleglycerol-phosphate dehydratase OS=Geobacillus kaustophilus (strain HTA426) GN=hisB PE=3 SV=1 7 226 4.0E-42
sp|Q3BUF5|HIS7_XANC5 Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hisB PE=3 SV=1 8 226 4.0E-42
sp|B7JFZ2|HIS7_BACC0 Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain AH820) GN=hisB PE=3 SV=1 8 226 4.0E-42
sp|A8FNR1|HIS7_CAMJ8 Histidine biosynthesis bifunctional protein HisB OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=hisB PE=3 SV=1 5 226 5.0E-42
sp|Q5H0K9|HIS7_XANOR Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=hisB PE=3 SV=1 8 226 5.0E-42
sp|B2SKN6|HIS7_XANOP Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=hisB PE=3 SV=1 8 226 5.0E-42
sp|Q2P3K1|HIS7_XANOM Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hisB PE=3 SV=1 8 226 5.0E-42
sp|A1ATG7|HIS7_PELPD Imidazoleglycerol-phosphate dehydratase OS=Pelobacter propionicus (strain DSM 2379) GN=hisB PE=3 SV=1 8 226 5.0E-42
sp|Q6HLE6|HIS7_BACHK Imidazoleglycerol-phosphate dehydratase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisB PE=3 SV=1 8 226 5.0E-42
sp|Q81T61|HIS7_BACAN Imidazoleglycerol-phosphate dehydratase OS=Bacillus anthracis GN=hisB PE=3 SV=1 8 226 5.0E-42
sp|C3L9Q0|HIS7_BACAC Imidazoleglycerol-phosphate dehydratase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hisB PE=3 SV=1 8 226 5.0E-42
sp|C3P503|HIS7_BACAA Imidazoleglycerol-phosphate dehydratase OS=Bacillus anthracis (strain A0248) GN=hisB PE=3 SV=1 8 226 5.0E-42
sp|A8LGQ5|HIS7_FRASN Imidazoleglycerol-phosphate dehydratase OS=Frankia sp. (strain EAN1pec) GN=hisB PE=3 SV=1 7 226 5.0E-42
sp|C3KVX2|HIS7_CLOB6 Imidazoleglycerol-phosphate dehydratase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hisB PE=3 SV=1 60 226 5.0E-42
sp|B7HHG2|HIS7_BACC4 Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain B4264) GN=hisB PE=3 SV=1 8 226 5.0E-42
sp|Q64RE9|HIS7_BACFR Histidine biosynthesis bifunctional protein HisB OS=Bacteroides fragilis (strain YCH46) GN=hisB PE=3 SV=1 8 226 6.0E-42
sp|Q5LB00|HIS7_BACFN Histidine biosynthesis bifunctional protein HisB OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=hisB PE=3 SV=1 8 226 6.0E-42
sp|P58881|HIS7_XANAC Histidine biosynthesis bifunctional protein HisB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hisB PE=3 SV=1 8 226 7.0E-42
sp|A6WX56|HIS7_OCHA4 Imidazoleglycerol-phosphate dehydratase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hisB PE=3 SV=1 3 226 7.0E-42
sp|Q8KEF4|HIS7_CHLTE Imidazoleglycerol-phosphate dehydratase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisB PE=3 SV=1 6 226 7.0E-42
sp|B8I5V2|HIS7_CLOCE Imidazoleglycerol-phosphate dehydratase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hisB PE=3 SV=1 8 226 8.0E-42
sp|Q28NK7|HIS7_JANSC Imidazoleglycerol-phosphate dehydratase OS=Jannaschia sp. (strain CCS1) GN=hisB PE=3 SV=1 8 226 8.0E-42
sp|Q2NHQ1|HIS7_METST Imidazoleglycerol-phosphate dehydratase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisB PE=3 SV=1 8 226 1.0E-41
sp|Q63DX1|HIS7_BACCZ Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain ZK / E33L) GN=hisB PE=3 SV=1 8 226 1.0E-41
sp|Q2J8L0|HIS7_FRASC Imidazoleglycerol-phosphate dehydratase OS=Frankia sp. (strain CcI3) GN=hisB PE=3 SV=1 7 226 1.0E-41
sp|A1BF00|HIS7_CHLPD Imidazoleglycerol-phosphate dehydratase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hisB PE=3 SV=1 7 226 1.0E-41
sp|A4ISR5|HIS7_GEOTN Imidazoleglycerol-phosphate dehydratase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hisB PE=3 SV=1 7 226 2.0E-41
sp|B3EKC2|HIS7_CHLPB Imidazoleglycerol-phosphate dehydratase OS=Chlorobium phaeobacteroides (strain BS1) GN=hisB PE=3 SV=1 7 226 2.0E-41
sp|Q5HSJ2|HIS7_CAMJR Histidine biosynthesis bifunctional protein HisB OS=Campylobacter jejuni (strain RM1221) GN=hisB PE=3 SV=1 5 226 2.0E-41
sp|P64367|HIS7_BRUSU Imidazoleglycerol-phosphate dehydratase OS=Brucella suis biovar 1 (strain 1330) GN=hisB PE=3 SV=1 3 226 2.0E-41
sp|A5VT39|HIS7_BRUO2 Imidazoleglycerol-phosphate dehydratase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hisB PE=3 SV=1 3 226 2.0E-41
sp|P64366|HIS7_BRUME Imidazoleglycerol-phosphate dehydratase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisB PE=3 SV=1 3 226 2.0E-41
sp|C0RFW9|HIS7_BRUMB Imidazoleglycerol-phosphate dehydratase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hisB PE=3 SV=1 3 226 2.0E-41
sp|A9M9R5|HIS7_BRUC2 Imidazoleglycerol-phosphate dehydratase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hisB PE=3 SV=1 3 226 2.0E-41
sp|Q57AH7|HIS7_BRUAB Imidazoleglycerol-phosphate dehydratase OS=Brucella abortus biovar 1 (strain 9-941) GN=hisB PE=3 SV=1 3 226 2.0E-41
sp|Q2YQZ2|HIS7_BRUA2 Imidazoleglycerol-phosphate dehydratase OS=Brucella abortus (strain 2308) GN=hisB PE=3 SV=1 3 226 2.0E-41
sp|B2S980|HIS7_BRUA1 Imidazoleglycerol-phosphate dehydratase OS=Brucella abortus (strain S19) GN=hisB PE=3 SV=1 3 226 2.0E-41
sp|Q30RM3|HIS7_SULDN Imidazoleglycerol-phosphate dehydratase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hisB PE=3 SV=1 53 226 2.0E-41
sp|C1EMQ4|HIS7_BACC3 Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain 03BB102) GN=hisB PE=3 SV=1 8 226 2.0E-41
sp|A0RBL9|HIS7_BACAH Imidazoleglycerol-phosphate dehydratase OS=Bacillus thuringiensis (strain Al Hakam) GN=hisB PE=3 SV=1 8 226 2.0E-41
sp|Q93DQ9|HIS7_TRIEI Imidazoleglycerol-phosphate dehydratase OS=Trichodesmium erythraeum (strain IMS101) GN=hisB PE=3 SV=1 3 226 2.0E-41
sp|Q65RB3|HIS7_MANSM Histidine biosynthesis bifunctional protein HisB OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hisB PE=3 SV=1 8 226 3.0E-41
sp|Q7UNC2|HIS7_RHOBA Imidazoleglycerol-phosphate dehydratase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisB PE=3 SV=1 3 226 3.0E-41
sp|P64374|HIS7_STAAW Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain MW2) GN=hisB PE=3 SV=1 60 226 3.0E-41
sp|A8Z5H6|HIS7_STAAT Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hisB PE=3 SV=1 60 226 3.0E-41
sp|Q6G5Z9|HIS7_STAAS Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain MSSA476) GN=hisB PE=3 SV=1 60 226 3.0E-41
sp|P64373|HIS7_STAAN Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain N315) GN=hisB PE=1 SV=1 60 226 3.0E-41
sp|P64372|HIS7_STAAM Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisB PE=3 SV=1 60 226 3.0E-41
sp|A6QKG4|HIS7_STAAE Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain Newman) GN=hisB PE=3 SV=1 60 226 3.0E-41
sp|Q5HCM1|HIS7_STAAC Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain COL) GN=hisB PE=3 SV=1 60 226 3.0E-41
sp|A5IWA3|HIS7_STAA9 Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain JH9) GN=hisB PE=3 SV=1 60 226 3.0E-41
sp|Q2FUU0|HIS7_STAA8 Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain NCTC 8325) GN=hisB PE=3 SV=1 60 226 3.0E-41
sp|Q2FDI5|HIS7_STAA3 Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain USA300) GN=hisB PE=3 SV=1 60 226 3.0E-41
sp|A6U561|HIS7_STAA2 Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain JH1) GN=hisB PE=3 SV=1 60 226 3.0E-41
sp|A7X766|HIS7_STAA1 Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hisB PE=3 SV=1 60 226 3.0E-41
sp|P61658|HIS7_BACC1 Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisB PE=3 SV=1 8 226 3.0E-41
sp|P34048|HIS7_WHEAT Imidazoleglycerol-phosphate dehydratase (Fragment) OS=Triticum aestivum PE=2 SV=1 12 227 4.0E-41
sp|Q9HN13|HIS7_HALSA Imidazoleglycerol-phosphate dehydratase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisB PE=3 SV=1 6 226 4.0E-41
sp|B0R7J1|HIS7_HALS3 Imidazoleglycerol-phosphate dehydratase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hisB PE=3 SV=1 6 226 4.0E-41
sp|Q2YZ91|HIS7_STAAB Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hisB PE=3 SV=1 60 226 4.0E-41
sp|A7GMU7|HIS7_BACCN Imidazoleglycerol-phosphate dehydratase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hisB PE=3 SV=1 8 226 5.0E-41
sp|B7INA0|HIS7_BACC2 Imidazoleglycerol-phosphate dehydratase OS=Bacillus cereus (strain G9842) GN=hisB PE=3 SV=1 8 226 6.0E-41
sp|B0CJI2|HIS7_BRUSI Imidazoleglycerol-phosphate dehydratase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hisB PE=3 SV=1 3 226 7.0E-41
sp|A5GWD4|HIS7_SYNR3 Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain RCC307) GN=hisB PE=3 SV=1 8 226 8.0E-41
sp|A1WR21|HIS7_VEREI Imidazoleglycerol-phosphate dehydratase OS=Verminephrobacter eiseniae (strain EF01-2) GN=hisB PE=3 SV=1 5 226 8.0E-41
sp|Q7NMJ6|HIS7_GLOVI Imidazoleglycerol-phosphate dehydratase OS=Gloeobacter violaceus (strain PCC 7421) GN=hisB PE=3 SV=1 8 226 9.0E-41
sp|Q7M7V2|HIS7_WOLSU Imidazoleglycerol-phosphate dehydratase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hisB PE=3 SV=1 54 226 9.0E-41
sp|A9KNX4|HIS7_CLOPH Imidazoleglycerol-phosphate dehydratase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=hisB PE=3 SV=1 8 226 1.0E-40
sp|Q97KI1|HIS7_CLOAB Imidazoleglycerol-phosphate dehydratase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hisB PE=3 SV=1 8 226 1.0E-40
sp|P62455|HIS7_PHOPR Histidine biosynthesis bifunctional protein HisB OS=Photobacterium profundum GN=hisB PE=3 SV=1 4 226 1.0E-40
sp|Q98CT7|HIS7_RHILO Imidazoleglycerol-phosphate dehydratase OS=Rhizobium loti (strain MAFF303099) GN=hisB PE=3 SV=1 8 226 1.0E-40
sp|B1I559|HIS7_DESAP Imidazoleglycerol-phosphate dehydratase OS=Desulforudis audaxviator (strain MP104C) GN=hisB PE=3 SV=1 8 227 1.0E-40
sp|Q2RGV9|HIS7_MOOTA Imidazoleglycerol-phosphate dehydratase OS=Moorella thermoacetica (strain ATCC 39073) GN=hisB PE=3 SV=1 7 227 1.0E-40
sp|A7H5U9|HIS7_CAMJD Histidine biosynthesis bifunctional protein HisB OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=hisB PE=3 SV=1 5 226 2.0E-40
sp|A6Q330|HIS7_NITSB Imidazoleglycerol-phosphate dehydratase OS=Nitratiruptor sp. (strain SB155-2) GN=hisB PE=3 SV=1 12 226 2.0E-40
sp|Q05068|HIS7_NOSS1 Imidazoleglycerol-phosphate dehydratase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisB PE=3 SV=1 4 226 2.0E-40
sp|A5FYE1|HIS7_ACICJ Imidazoleglycerol-phosphate dehydratase OS=Acidiphilium cryptum (strain JF-5) GN=hisB PE=3 SV=1 7 226 3.0E-40
sp|C4XSN6|HIS7_DESMR Imidazoleglycerol-phosphate dehydratase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=hisB PE=3 SV=1 8 226 3.0E-40
sp|C0QUG8|HIS7_PERMH Imidazoleglycerol-phosphate dehydratase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=hisB PE=3 SV=1 8 226 3.0E-40
sp|B3GZG9|HIS7_ACTP7 Histidine biosynthesis bifunctional protein HisB OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=hisB PE=3 SV=1 8 226 3.0E-40
sp|B0BU51|HIS7_ACTPJ Histidine biosynthesis bifunctional protein HisB OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=hisB PE=3 SV=1 8 226 3.0E-40
sp|O34683|HIS7_BACSU Imidazoleglycerol-phosphate dehydratase OS=Bacillus subtilis (strain 168) GN=hisB PE=3 SV=1 8 226 3.0E-40
sp|A0AG18|HIS7_LISW6 Imidazoleglycerol-phosphate dehydratase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=hisB PE=3 SV=1 8 226 3.0E-40
sp|P57920|HIS7_PASMU Histidine biosynthesis bifunctional protein HisB OS=Pasteurella multocida (strain Pm70) GN=hisB PE=3 SV=1 8 226 3.0E-40
sp|A7ZEG5|HIS7_CAMC1 Imidazoleglycerol-phosphate dehydratase OS=Campylobacter concisus (strain 13826) GN=hisB PE=3 SV=1 12 226 5.0E-40
sp|Q9PBC7|HIS7_XYLFA Histidine biosynthesis bifunctional protein HisB OS=Xylella fastidiosa (strain 9a5c) GN=hisB PE=3 SV=1 8 226 6.0E-40
sp|Q6GDC8|HIS7_STAAR Imidazoleglycerol-phosphate dehydratase OS=Staphylococcus aureus (strain MRSA252) GN=hisB PE=3 SV=1 60 226 7.0E-40
sp|Q722Y4|HIS7_LISMF Imidazoleglycerol-phosphate dehydratase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hisB PE=3 SV=1 8 226 7.0E-40
sp|C1L0J5|HIS7_LISMC Imidazoleglycerol-phosphate dehydratase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hisB PE=3 SV=1 8 226 7.0E-40
sp|Q87C31|HIS7_XYLFT Histidine biosynthesis bifunctional protein HisB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hisB PE=3 SV=1 8 226 8.0E-40
sp|B2I5X9|HIS7_XYLF2 Histidine biosynthesis bifunctional protein HisB OS=Xylella fastidiosa (strain M23) GN=hisB PE=3 SV=1 8 226 8.0E-40
sp|B1H0E9|HIS7_UNCTG Imidazoleglycerol-phosphate dehydratase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=hisB PE=3 SV=1 8 226 8.0E-40
sp|A4J710|HIS7_DESRM Imidazoleglycerol-phosphate dehydratase OS=Desulfotomaculum reducens (strain MI-1) GN=hisB PE=3 SV=1 8 226 1.0E-39
sp|O66455|HIS7_AQUAE Imidazoleglycerol-phosphate dehydratase OS=Aquifex aeolicus (strain VF5) GN=hisB PE=3 SV=1 8 226 1.0E-39
sp|Q8DMI3|HIS7_THEEB Imidazoleglycerol-phosphate dehydratase OS=Thermosynechococcus elongatus (strain BP-1) GN=hisB PE=3 SV=1 2 228 1.0E-39
sp|Q24QJ2|HIS7_DESHY Imidazoleglycerol-phosphate dehydratase OS=Desulfitobacterium hafniense (strain Y51) GN=hisB PE=3 SV=1 8 226 1.0E-39
sp|Q2NTX3|HIS7_SODGM Histidine biosynthesis bifunctional protein HisB OS=Sodalis glossinidius (strain morsitans) GN=hisB PE=3 SV=1 60 226 1.0E-39
sp|Q9K6Z3|HIS7_BACHD Imidazoleglycerol-phosphate dehydratase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisB PE=3 SV=1 8 226 1.0E-39
sp|A5N7Q8|HIS7_CLOK5 Imidazoleglycerol-phosphate dehydratase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=hisB PE=3 SV=1 8 226 1.0E-39
sp|B9E169|HIS7_CLOK1 Imidazoleglycerol-phosphate dehydratase OS=Clostridium kluyveri (strain NBRC 12016) GN=hisB PE=3 SV=1 8 226 1.0E-39
sp|Q8ABA7|HIS7_BACTN Histidine biosynthesis bifunctional protein HisB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisB PE=3 SV=1 8 226 2.0E-39
sp|Q9ZHE4|HIS7_BUCAP Histidine biosynthesis bifunctional protein HisB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=hisB PE=3 SV=1 8 226 2.0E-39
sp|A7Z965|HIS7_BACMF Imidazoleglycerol-phosphate dehydratase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hisB PE=3 SV=1 8 226 2.0E-39
sp|A6UTB1|HIS7_META3 Imidazoleglycerol-phosphate dehydratase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisB PE=3 SV=1 8 226 2.0E-39
sp|B8DA59|HIS7_LISMH Imidazoleglycerol-phosphate dehydratase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=hisB PE=3 SV=1 8 226 2.0E-39
sp|B0U3B1|HIS7_XYLFM Histidine biosynthesis bifunctional protein HisB OS=Xylella fastidiosa (strain M12) GN=hisB PE=3 SV=1 8 226 2.0E-39
sp|B9LAD4|HIS7_NAUPA Imidazoleglycerol-phosphate dehydratase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=hisB PE=3 SV=1 12 226 2.0E-39
sp|Q92E85|HIS7_LISIN Imidazoleglycerol-phosphate dehydratase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisB PE=3 SV=1 8 226 2.0E-39
sp|Q8Y9G2|HIS7_LISMO Imidazoleglycerol-phosphate dehydratase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisB PE=3 SV=1 8 226 2.0E-39
sp|Q01ZU4|HIS7_SOLUE Imidazoleglycerol-phosphate dehydratase OS=Solibacter usitatus (strain Ellin6076) GN=hisB PE=3 SV=1 8 226 3.0E-39
sp|Q3AN36|HIS7_SYNSC Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain CC9605) GN=hisB PE=3 SV=1 7 226 3.0E-39
sp|A1SL60|HIS7_NOCSJ Imidazoleglycerol-phosphate dehydratase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=hisB PE=3 SV=1 8 226 3.0E-39
sp|A6TKT3|HIS7_ALKMQ Imidazoleglycerol-phosphate dehydratase OS=Alkaliphilus metalliredigens (strain QYMF) GN=hisB PE=3 SV=1 14 226 3.0E-39
sp|P06987|HIS7_ECOLI Histidine biosynthesis bifunctional protein HisB OS=Escherichia coli (strain K12) GN=hisB PE=1 SV=1 8 226 3.0E-39
sp|Q83R05|HIS7_SHIFL Histidine biosynthesis bifunctional protein HisB OS=Shigella flexneri GN=hisB PE=3 SV=2 8 226 4.0E-39
sp|Q9S5G5|HIS7_ECO57 Histidine biosynthesis bifunctional protein HisB OS=Escherichia coli O157:H7 GN=hisB PE=1 SV=1 8 226 4.0E-39
sp|Q8FG50|HIS7_ECOL6 Histidine biosynthesis bifunctional protein HisB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hisB PE=3 SV=2 8 226 4.0E-39
sp|A3N3W1|HIS7_ACTP2 Histidine biosynthesis bifunctional protein HisB OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=hisB PE=3 SV=1 8 226 5.0E-39
sp|A6WCV0|HIS7_KINRD Imidazoleglycerol-phosphate dehydratase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=hisB PE=3 SV=1 7 226 5.0E-39
sp|Q2FN13|HIS7_METHJ Imidazoleglycerol-phosphate dehydratase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=hisB PE=3 SV=1 8 226 6.0E-39
sp|A0PXP6|HIS7_CLONN Imidazoleglycerol-phosphate dehydratase OS=Clostridium novyi (strain NT) GN=hisB PE=3 SV=1 6 226 6.0E-39
sp|A0RZ75|HIS7_CENSY Imidazoleglycerol-phosphate dehydratase OS=Cenarchaeum symbiosum (strain A) GN=hisB PE=3 SV=1 14 226 6.0E-39
sp|Q7V4R6|HIS7_PROMM Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9313) GN=hisB PE=3 SV=1 1 226 6.0E-39
sp|Q02YW7|HIS7_LACLS Imidazoleglycerol-phosphate dehydratase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=hisB PE=3 SV=1 8 228 6.0E-39
sp|B0JJ52|HIS7_MICAN Imidazoleglycerol-phosphate dehydratase OS=Microcystis aeruginosa (strain NIES-843) GN=hisB PE=3 SV=1 5 226 7.0E-39
sp|P48054|HIS7_SYNY3 Imidazoleglycerol-phosphate dehydratase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisB PE=3 SV=1 8 226 7.0E-39
sp|C5D7P1|HIS7_GEOSW Imidazoleglycerol-phosphate dehydratase OS=Geobacillus sp. (strain WCH70) GN=hisB PE=3 SV=1 7 226 8.0E-39
sp|Q0IDH6|HIS7_SYNS3 Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain CC9311) GN=hisB PE=3 SV=1 8 226 9.0E-39
sp|Q4QN72|HIS7_HAEI8 Histidine biosynthesis bifunctional protein HisB OS=Haemophilus influenzae (strain 86-028NP) GN=hisB PE=3 SV=1 8 226 1.0E-38
sp|P58879|HIS7_METKA Imidazoleglycerol-phosphate dehydratase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisB PE=3 SV=1 5 226 1.0E-38
sp|B8GJY3|HIS7_METPE Imidazoleglycerol-phosphate dehydratase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=hisB PE=3 SV=1 8 226 1.0E-38
sp|A1A2H5|HIS7_BIFAA Imidazoleglycerol-phosphate dehydratase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=hisB PE=3 SV=1 7 226 1.0E-38
sp|A5UGY3|HIS7_HAEIG Histidine biosynthesis bifunctional protein HisB OS=Haemophilus influenzae (strain PittGG) GN=hisB PE=3 SV=1 8 226 1.0E-38
sp|A5UA18|HIS7_HAEIE Histidine biosynthesis bifunctional protein HisB OS=Haemophilus influenzae (strain PittEE) GN=hisB PE=3 SV=1 8 226 1.0E-38
sp|A2CCN3|HIS7_PROM3 Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9303) GN=hisB PE=3 SV=1 1 226 1.0E-38
sp|B5EDR7|HIS7_GEOBB Imidazoleglycerol-phosphate dehydratase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hisB PE=3 SV=1 7 226 1.0E-38
sp|A9BDS9|HIS7_PROM4 Imidazoleglycerol-phosphate dehydratase OS=Prochlorococcus marinus (strain MIT 9211) GN=hisB PE=3 SV=1 5 226 1.0E-38
sp|A6VM11|HIS7_ACTSZ Histidine biosynthesis bifunctional protein HisB OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=hisB PE=3 SV=1 6 226 1.0E-38
sp|Q58109|HIS7_METJA Imidazoleglycerol-phosphate dehydratase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisB PE=3 SV=1 8 226 2.0E-38
sp|C6E7F7|HIS7_GEOSM Imidazoleglycerol-phosphate dehydratase OS=Geobacter sp. (strain M21) GN=hisB PE=3 SV=1 7 226 2.0E-38
sp|Q47XB6|HIS7_COLP3 Histidine biosynthesis bifunctional protein HisB OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=hisB PE=3 SV=1 8 226 2.0E-38
sp|Q0SHY0|HIS7_RHOJR Imidazoleglycerol-phosphate dehydratase OS=Rhodococcus jostii (strain RHA1) GN=hisB PE=3 SV=1 6 226 2.0E-38
sp|P44327|HIS7_HAEIN Histidine biosynthesis bifunctional protein HisB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisB PE=3 SV=1 8 226 2.0E-38
sp|Q6D409|HIS7_PECAS Histidine biosynthesis bifunctional protein HisB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hisB PE=3 SV=1 51 226 2.0E-38
sp|A5G8T2|HIS7_GEOUR Imidazoleglycerol-phosphate dehydratase OS=Geobacter uraniireducens (strain Rf4) GN=hisB PE=3 SV=1 7 226 2.0E-38
sp|Q7U9M8|HIS7_SYNPX Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain WH8102) GN=hisB PE=3 SV=1 7 226 2.0E-38
sp|B3E4Y5|HIS7_GEOLS Imidazoleglycerol-phosphate dehydratase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=hisB PE=3 SV=1 8 226 2.0E-38
sp|P60885|HIS7_GEOSL Imidazoleglycerol-phosphate dehydratase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hisB PE=3 SV=1 7 226 2.0E-38
sp|C1ATZ4|HIS7_RHOOB Imidazoleglycerol-phosphate dehydratase OS=Rhodococcus opacus (strain B4) GN=hisB PE=3 SV=1 6 226 3.0E-38
sp|B8DSW4|HIS7_BIFA0 Imidazoleglycerol-phosphate dehydratase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=hisB PE=3 SV=1 7 226 3.0E-38
sp|Q8Z5J8|HIS7_SALTI Histidine biosynthesis bifunctional protein HisB OS=Salmonella typhi GN=hisB PE=3 SV=1 8 226 3.0E-38
sp|P10368|HIS7_SALTY Histidine biosynthesis bifunctional protein HisB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hisB PE=3 SV=2 8 226 3.0E-38
sp|Q5PDP5|HIS7_SALPA Histidine biosynthesis bifunctional protein HisB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hisB PE=3 SV=1 8 226 3.0E-38
sp|Q65EG0|HIS7_BACLD Imidazoleglycerol-phosphate dehydratase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hisB PE=3 SV=1 8 226 3.0E-38
sp|B4S729|HIS7_PROA2 Imidazoleglycerol-phosphate dehydratase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hisB PE=3 SV=1 54 226 4.0E-38
sp|Q6AE13|HIS7_LEIXX Imidazoleglycerol-phosphate dehydratase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hisB PE=3 SV=1 6 226 4.0E-38
sp|A7I064|HIS7_CAMHC Imidazoleglycerol-phosphate dehydratase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=hisB PE=3 SV=1 54 226 4.0E-38
sp|C3MW64|HIS7_SULIM Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=hisB PE=3 SV=1 7 226 4.0E-38
sp|C4KHS1|HIS7_SULIK Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=hisB PE=3 SV=1 7 226 4.0E-38
sp|Q3B0A6|HIS7_SYNS9 Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain CC9902) GN=hisB PE=3 SV=1 8 226 4.0E-38
sp|C3N6A7|HIS7_SULIA Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain M.16.27) GN=hisB PE=3 SV=1 7 226 6.0E-38
sp|B0RHB5|HIS7_CLAMS Imidazoleglycerol-phosphate dehydratase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=hisB PE=3 SV=1 4 226 6.0E-38
sp|Q8ZFX7|HIS7_YERPE Histidine biosynthesis bifunctional protein HisB OS=Yersinia pestis GN=hisB PE=3 SV=1 60 226 7.0E-38
sp|A0LQG8|HIS7_SYNFM Imidazoleglycerol-phosphate dehydratase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=hisB PE=3 SV=1 8 226 7.0E-38
sp|Q66C51|HIS7_YERPS Histidine biosynthesis bifunctional protein HisB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hisB PE=3 SV=1 60 226 7.0E-38
sp|B3DQA1|HIS7_BIFLD Imidazoleglycerol-phosphate dehydratase OS=Bifidobacterium longum (strain DJO10A) GN=hisB PE=3 SV=1 7 226 8.0E-38
sp|C3NGY0|HIS7_SULIN Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=hisB PE=3 SV=1 7 226 8.0E-38
sp|C3MQI6|HIS7_SULIL Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=hisB PE=3 SV=1 7 226 8.0E-38
sp|P60884|HIS7_CORDI Imidazoleglycerol-phosphate dehydratase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hisB PE=3 SV=1 4 226 9.0E-38
sp|A5CSK8|HIS7_CLAM3 Imidazoleglycerol-phosphate dehydratase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=hisB PE=3 SV=1 4 226 1.0E-37
sp|Q7N6I2|HIS7_PHOLL Histidine biosynthesis bifunctional protein HisB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hisB PE=3 SV=1 60 226 1.0E-37
sp|O33773|HIS7_SULSO Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hisB PE=3 SV=1 7 226 1.0E-37
sp|A5GID0|HIS7_SYNPW Imidazoleglycerol-phosphate dehydratase OS=Synechococcus sp. (strain WH7803) GN=hisB PE=3 SV=1 8 226 1.0E-37
sp|C6BSE1|HIS7_DESAD Imidazoleglycerol-phosphate dehydratase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=hisB PE=3 SV=1 6 226 1.0E-37
sp|Q5ZW89|HIS7_LEGPH Histidine biosynthesis bifunctional protein HisB OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hisB PE=3 SV=1 7 226 1.0E-37
sp|Q8G4S7|HIS7_BIFLO Imidazoleglycerol-phosphate dehydratase OS=Bifidobacterium longum (strain NCC 2705) GN=hisB PE=3 SV=1 7 226 1.0E-37
sp|B7GQ48|HIS7_BIFLS Imidazoleglycerol-phosphate dehydratase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=hisB PE=3 SV=1 7 226 2.0E-37
sp|A6TBC5|HIS7_KLEP7 Histidine biosynthesis bifunctional protein HisB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hisB PE=3 SV=1 4 226 2.0E-37
sp|Q0AW39|HIS7_SYNWW Imidazoleglycerol-phosphate dehydratase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=hisB PE=3 SV=1 8 226 2.0E-37
sp|Q4JW57|HIS7_CORJK Imidazoleglycerol-phosphate dehydratase OS=Corynebacterium jeikeium (strain K411) GN=hisB PE=3 SV=1 1 226 2.0E-37
sp|Q39YP5|HIS7_GEOMG Imidazoleglycerol-phosphate dehydratase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisB PE=3 SV=1 7 226 3.0E-37
sp|Q5X5X1|HIS7_LEGPA Histidine biosynthesis bifunctional protein HisB OS=Legionella pneumophila (strain Paris) GN=hisB PE=3 SV=1 7 226 3.0E-37
sp|A2RKS1|HIS7_LACLM Imidazoleglycerol-phosphate dehydratase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=hisB PE=3 SV=1 8 226 3.0E-37
sp|A5CZ77|HIS7_PELTS Imidazoleglycerol-phosphate dehydratase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hisB PE=3 SV=1 8 226 3.0E-37
sp|A6Q9M2|HIS7_SULNB Imidazoleglycerol-phosphate dehydratase OS=Sulfurovum sp. (strain NBC37-1) GN=hisB PE=3 SV=1 12 226 3.0E-37
sp|Q1LT69|HIS7_BAUCH Histidine biosynthesis bifunctional protein HisB OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=hisB PE=3 SV=1 4 227 3.0E-37
sp|C3NER4|HIS7_SULIY Imidazoleglycerol-phosphate dehydratase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=hisB PE=3 SV=1 7 226 3.0E-37
sp|Q9X7B9|HIS7_MYCLE Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium leprae (strain TN) GN=hisB PE=3 SV=1 6 226 3.0E-37
sp|B8ZRB1|HIS7_MYCLB Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium leprae (strain Br4923) GN=hisB PE=3 SV=1 6 226 3.0E-37
sp|A0QX83|HIS7_MYCS2 Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=hisB PE=1 SV=1 8 226 4.0E-37
sp|Q02134|HIS7_LACLA Imidazoleglycerol-phosphate dehydratase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hisB PE=3 SV=3 7 226 4.0E-37
sp|Q5WX93|HIS7_LEGPL Histidine biosynthesis bifunctional protein HisB OS=Legionella pneumophila (strain Lens) GN=hisB PE=3 SV=1 7 226 5.0E-37
sp|Q5WDH9|HIS7_BACSK Imidazoleglycerol-phosphate dehydratase OS=Bacillus clausii (strain KSM-K16) GN=hisB PE=3 SV=1 7 226 6.0E-37
sp|A1T8W3|HIS7_MYCVP Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hisB PE=3 SV=1 7 226 6.0E-37
sp|A8ZUC7|HIS7_DESOH Imidazoleglycerol-phosphate dehydratase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=hisB PE=3 SV=1 8 226 7.0E-37
sp|Q67KH7|HIS7_SYMTH Imidazoleglycerol-phosphate dehydratase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisB PE=3 SV=1 8 226 8.0E-37
sp|Q6A8L3|HIS7_PROAC Imidazoleglycerol-phosphate dehydratase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hisB PE=3 SV=1 6 226 9.0E-37
sp|A0JUZ5|HIS7_ARTS2 Imidazoleglycerol-phosphate dehydratase OS=Arthrobacter sp. (strain FB24) GN=hisB PE=3 SV=1 4 226 1.0E-36
sp|A4YI33|HIS7_METS5 Imidazoleglycerol-phosphate dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=hisB PE=3 SV=1 7 226 1.0E-36
sp|Q1B7G6|HIS7_MYCSS Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium sp. (strain MCS) GN=hisB PE=3 SV=1 8 226 2.0E-36
sp|A1UHK6|HIS7_MYCSK Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium sp. (strain KMS) GN=hisB PE=3 SV=1 8 226 2.0E-36
sp|A3Q129|HIS7_MYCSJ Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium sp. (strain JLS) GN=hisB PE=3 SV=1 8 226 2.0E-36
sp|B8D708|HIS7_BUCAT Histidine biosynthesis bifunctional protein HisB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=hisB PE=3 SV=1 8 226 2.0E-36
sp|P57203|HIS7_BUCAI Histidine biosynthesis bifunctional protein HisB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hisB PE=3 SV=1 8 226 2.0E-36
sp|B8D8Q4|HIS7_BUCA5 Histidine biosynthesis bifunctional protein HisB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=hisB PE=3 SV=1 8 226 2.0E-36
sp|Q2LVF5|HIS7_SYNAS Imidazoleglycerol-phosphate dehydratase OS=Syntrophus aciditrophicus (strain SB) GN=hisB PE=3 SV=1 8 226 2.0E-36
sp|Q9KJU3|HIS7_CORGL Imidazoleglycerol-phosphate dehydratase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hisB PE=3 SV=2 8 226 3.0E-36
sp|A4QFG5|HIS7_CORGB Imidazoleglycerol-phosphate dehydratase OS=Corynebacterium glutamicum (strain R) GN=hisB PE=3 SV=1 8 226 3.0E-36
sp|B9M0L7|HIS7_GEODF Imidazoleglycerol-phosphate dehydratase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hisB PE=3 SV=1 7 226 3.0E-36
sp|A1R559|HIS7_ARTAT Imidazoleglycerol-phosphate dehydratase OS=Arthrobacter aurescens (strain TC1) GN=hisB PE=3 SV=1 3 226 4.0E-36
sp|A7I774|HIS7_METB6 Imidazoleglycerol-phosphate dehydratase OS=Methanoregula boonei (strain 6A8) GN=hisB PE=3 SV=1 10 226 5.0E-36
sp|A4T9M6|HIS7_MYCGI Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium gilvum (strain PYR-GCK) GN=hisB PE=3 SV=1 7 226 7.0E-36
sp|P9WML9|HIS7_MYCTU Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hisB PE=1 SV=1 54 226 8.0E-36
sp|P9WML8|HIS7_MYCTO Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hisB PE=3 SV=1 54 226 8.0E-36
sp|A5U2V7|HIS7_MYCTA Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hisB PE=3 SV=1 54 226 8.0E-36
sp|C1ANM3|HIS7_MYCBT Imidazoleglycerol-phosphate dehydratase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hisB PE=3 SV=1 54 226 8.0E-36
[Show less]

GO

GO Term Description Terminal node
GO:0004424 imidazoleglycerol-phosphate dehydratase activity Yes
GO:0000105 histidine biosynthetic process Yes
GO:0043436 oxoacid metabolic process No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0006082 organic acid metabolic process No
GO:0016836 hydro-lyase activity No
GO:0006547 histidine metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016835 carbon-oxygen lyase activity No
GO:0044238 primary metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0016829 lyase activity No
GO:0008652 cellular amino acid biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4086 0.4923 0.0311 0.1197 0.4833 0.0159 0.2239 0.4522 0.1487 0.0727

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1824
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2663
Ophiocordyceps australis map64 (Brazil) OphauB2|1612
Ophiocordyceps camponoti-floridani Ophcf2|05853
Ophiocordyceps camponoti-rufipedis Ophun1|924
Ophiocordyceps kimflemingae Ophio5|7066
Ophiocordyceps subramaniannii Hirsu2|180 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|180
MGSSSTARAAALARDTNETKIQLALNLDGGDLPADTHPRLRERAAAAHASQSSGSQTIAVNTGIGFLDHMLHALA
KHAGWSLALHCDGDLHIDDHHTAEDCCIALGYVFNKALGTPTGLARFGSAYAPLDEALSRAVVDLSNRPYSVVDL
GLKREWLGKLSTEMVPHCLQSFAQAARITMHVDCIRGDNDHHRAESAFKALAVAIRLATSKVQGKEGEVPSTKGT
LTA*
Coding >Hirsu2|180
ATGGGCTCCTCAAGCACGGCGCGGGCGGCGGCCCTGGCCCGCGACACCAACGAGACCAAGATCCAGCTGGCGCTC
AACCTCGACGGCGGCGACCTGCCGGCCGACACGCACCCGCGCCTGCGCGAGCGCGCCGCCGCCGCCCACGCCTCG
CAGTCGTCCGGGTCGCAGACCATCGCCGTCAACACCGGCATCGGCTTCCTCGACCACATGCTGCACGCCCTGGCC
AAGCACGCGGGCTGGAGCCTGGCCCTGCACTGCGACGGCGACCTCCACATCGACGACCACCACACTGCCGAAGAC
TGCTGCATCGCCCTCGGCTACGTCTTCAACAAGGCGCTCGGCACCCCGACCGGCCTCGCCCGCTTCGGCTCCGCC
TACGCCCCGCTCGACGAGGCCCTCTCGCGCGCCGTCGTCGACCTGTCCAACCGCCCCTACAGCGTCGTCGACCTC
GGCCTCAAGCGCGAGTGGCTGGGCAAGCTCAGCACCGAGATGGTGCCCCACTGCCTGCAGAGCTTCGCCCAGGCC
GCCCGCATCACCATGCACGTCGACTGCATCCGCGGCGACAACGACCACCACCGCGCCGAGAGCGCCTTCAAGGCC
CTTGCCGTCGCCATCCGCCTCGCCACCTCCAAGGTCCAGGGCAAGGAGGGCGAGGTCCCGAGCACCAAGGGCACC
CTGACGGCCTGA
Transcript >Hirsu2|180
ATGGGCTCCTCAAGCACGGCGCGGGCGGCGGCCCTGGCCCGCGACACCAACGAGACCAAGATCCAGCTGGCGCTC
AACCTCGACGGCGGCGACCTGCCGGCCGACACGCACCCGCGCCTGCGCGAGCGCGCCGCCGCCGCCCACGCCTCG
CAGTCGTCCGGGTCGCAGACCATCGCCGTCAACACCGGCATCGGCTTCCTCGACCACATGCTGCACGCCCTGGCC
AAGCACGCGGGCTGGAGCCTGGCCCTGCACTGCGACGGCGACCTCCACATCGACGACCACCACACTGCCGAAGAC
TGCTGCATCGCCCTCGGCTACGTCTTCAACAAGGCGCTCGGCACCCCGACCGGCCTCGCCCGCTTCGGCTCCGCC
TACGCCCCGCTCGACGAGGCCCTCTCGCGCGCCGTCGTCGACCTGTCCAACCGCCCCTACAGCGTCGTCGACCTC
GGCCTCAAGCGCGAGTGGCTGGGCAAGCTCAGCACCGAGATGGTGCCCCACTGCCTGCAGAGCTTCGCCCAGGCC
GCCCGCATCACCATGCACGTCGACTGCATCCGCGGCGACAACGACCACCACCGCGCCGAGAGCGCCTTCAAGGCC
CTTGCCGTCGCCATCCGCCTCGCCACCTCCAAGGTCCAGGGCAAGGAGGGCGAGGTCCCGAGCACCAAGGGCACC
CTGACGGCCTGA
Gene >Hirsu2|180
ATGGGCTCCTCAAGCACGGCGCGGGCGGCGGCCCTGGCCCGCGACACCAACGAGACCAAGATCCAGCTGGCGCTC
AACCTCGACGGCGGCGACCTGCCGGCCGACACGCACCCGCGCCTGCGCGAGCGCGCCGCCGCCGCCCACGCCTCG
CAGTCGTCCGGGTCGCAGACCATCGCCGTCAACACCGGCATCGGCTTCCTCGACCACATGCTGCACGCCCTGGCC
AAGCACGCGGGCTGGAGCCTGGCCCTGCACTGCGACGGCGACCTCCACAGTCCGTTCCTGACCCCCACCCCCCTT
CCTTGTCGTCCTCCTCGCTCCCCATCGCTGCGCTGACGACATCAAAAACAGTCGACGACCACCACACTGCCGAAG
ACTGCTGCATCGCCCTCGGCTACGTCTTCAACAAGGCGCTCGGCACCCCGACCGGCCTCGCCCGCTTCGGCTCCG
CCTACGCCCCGCTCGACGAGGCCCTCTCGCGCGCCGTCGTCGACCTGTCCAACCGCCCCTACAGCGTCGTCGACC
TCGGCCTCAAGCGCGAGTGGCTGGGCAAGCTCAGCACCGAGATGGTGCCCCACTGCCTGCAGAGCTTCGCCCAGG
CCGCCCGCATCACCATGCACGTCGACTGCATCCGCGGCGACAACGACCACCACCGCGCCGAGAGCGCCTTCAAGG
CCCTTGCCGTCGCCATCCGCCTCGCCACCTCCAAGGTCCAGGGCAAGGAGGGCGAGGTCCCGAGCACCAAGGGCA
CCCTGACGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail