Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1799
Gene name
LocationContig_1406:778..3101
Strand-
Gene length (bp)2323
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 3.1E-46 48 264
PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain 1.6E-40 367 471
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 4.3E-15 290 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01520|EF1A_PODAS Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1 37 491 0.0E+00
sp|Q01765|EF1A_PODCU Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1 37 491 0.0E+00
sp|Q09069|EF1A_SORMA Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1 37 482 0.0E+00
sp|Q01372|EF1A_NEUCR Elongation factor 1-alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tef-1 PE=3 SV=2 37 482 0.0E+00
sp|P34825|EF1A_HYPJE Elongation factor 1-alpha OS=Hypocrea jecorina GN=tef1 PE=3 SV=1 37 475 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01520|EF1A_PODAS Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1 37 491 0.0E+00
sp|Q01765|EF1A_PODCU Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1 37 491 0.0E+00
sp|Q09069|EF1A_SORMA Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1 37 482 0.0E+00
sp|Q01372|EF1A_NEUCR Elongation factor 1-alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tef-1 PE=3 SV=2 37 482 0.0E+00
sp|P34825|EF1A_HYPJE Elongation factor 1-alpha OS=Hypocrea jecorina GN=tef1 PE=3 SV=1 37 475 0.0E+00
sp|Q9Y713|EF1A_ASPOR Elongation factor 1-alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tef1 PE=3 SV=1 37 491 0.0E+00
sp|Q00251|EF1A_AURPU Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1 37 491 0.0E+00
sp|P40911|EF1A_AJECG Elongation factor 1-alpha OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=TEF PE=2 SV=1 37 491 0.0E+00
sp|Q96WZ1|EF1A_COCIM Elongation factor 1-alpha OS=Coccidioides immitis (strain RS) GN=TEF PE=2 SV=2 37 482 0.0E+00
sp|A5DPE3|EF1A_PICGU Elongation factor 1-alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TEF1 PE=3 SV=2 37 482 0.0E+00
sp|Q59QD6|EF1A2_CANAL Elongation factor 1-alpha 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF2 PE=3 SV=1 37 482 0.0E+00
sp|P28295|EF1A_ABSGL Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1 37 491 0.0E+00
sp|P0CY35|EF1A1_CANAL Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1 37 482 0.0E+00
sp|P41752|EF1A_ASHGO Elongation factor 1-alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF PE=3 SV=1 37 491 0.0E+00
sp|Q9HDF6|EF1A_PIRIN Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1 37 482 0.0E+00
sp|P0CT55|EF1A3_SCHPO Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef103 PE=1 SV=1 37 482 0.0E+00
sp|P0CT54|EF1A2_SCHPO Elongation factor 1-alpha-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef102 PE=1 SV=1 37 482 0.0E+00
sp|P0CT53|EF1A1_SCHPO Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef101 PE=1 SV=1 37 482 0.0E+00
sp|P41745|EF1A_BLAAD Elongation factor 1-alpha OS=Blastobotrys adeninivorans GN=TEF PE=3 SV=1 37 482 0.0E+00
sp|O42820|EF1A_SCHCO Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1 37 482 0.0E+00
sp|P13549|EF1A0_XENLA Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1 37 490 0.0E+00
sp|P32186|EF1A_PUCGR Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2 37 487 0.0E+00
sp|O59949|EF1A_YARLI Elongation factor 1-alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEF PE=2 SV=2 37 482 0.0E+00
sp|P68105|EF1A1_RABIT Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1 37 490 0.0E+00
sp|Q5R4R8|EF1A1_PONAB Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2 37 490 0.0E+00
sp|Q5R1X2|EF1A1_PANTR Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1 37 490 0.0E+00
sp|P68104|EF1A1_HUMAN Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1 37 490 0.0E+00
sp|Q66RN5|EF1A1_FELCA Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1 37 490 0.0E+00
sp|P68103|EF1A1_BOVIN Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=1 SV=1 37 490 0.0E+00
sp|P62630|EF1A1_RAT Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1 37 490 0.0E+00
sp|P10126|EF1A1_MOUSE Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3 37 490 0.0E+00
sp|P62629|EF1A1_CRIGR Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1 37 490 0.0E+00
sp|P0CN30|EF1A_CRYNJ Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEF1 PE=3 SV=1 37 482 0.0E+00
sp|P0CN31|EF1A_CRYNB Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEF1 PE=2 SV=1 37 482 0.0E+00
sp|P02994|EF1A_YEAST Elongation factor 1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF1 PE=1 SV=1 37 473 0.0E+00
sp|Q92005|EF1A_DANRE Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1 37 490 0.0E+00
sp|P17508|EF1A3_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2 37 491 0.0E+00
sp|Q90835|EF1A_CHICK Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1 37 490 0.0E+00
sp|A2Q0Z0|EF1A1_HORSE Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1 37 490 0.0E+00
sp|P14864|EF1A2_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-2 PE=3 SV=1 37 473 0.0E+00
sp|Q5VTE0|EF1A3_HUMAN Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1A1P5 PE=5 SV=1 37 490 0.0E+00
sp|P17507|EF1A2_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1 37 491 0.0E+00
sp|P06805|EF1A1_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-1 PE=3 SV=1 37 473 0.0E+00
sp|P14865|EF1A3_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-3 PE=3 SV=1 37 473 0.0E+00
sp|Q71V39|EF1A2_RABIT Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1 37 490 0.0E+00
sp|Q05639|EF1A2_HUMAN Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1 37 490 0.0E+00
sp|Q32PH8|EF1A2_BOVIN Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1 37 490 0.0E+00
sp|P62632|EF1A2_RAT Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=1 SV=1 37 490 0.0E+00
sp|P62631|EF1A2_MOUSE Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1 37 490 0.0E+00
sp|P53013|EF1A_CAEEL Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=3 SV=1 37 491 0.0E+00
sp|P29520|EF1A_BOMMO Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1 37 490 0.0E+00
sp|Q2HJN8|EF1A2_OSCTI Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1 37 487 0.0E+00
sp|Q2HJN6|EF1A3_OSCTI Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1 37 487 0.0E+00
sp|Q2HJN9|EF1A4_OSCTI Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1 37 487 0.0E+00
sp|Q2HJN4|EF1A1_OSCTI Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1 37 487 0.0E+00
sp|P08736|EF1A1_DROME Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2 37 490 0.0E+00
sp|P27592|EF1A_ONCVO Elongation factor 1-alpha OS=Onchocerca volvulus PE=2 SV=1 37 489 0.0E+00
sp|P05303|EF1A2_DROME Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=2 SV=2 37 482 0.0E+00
sp|P02993|EF1A_ARTSA Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2 37 482 0.0E+00
sp|Q9YIC0|EF1A_ORYLA Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1 37 482 0.0E+00
sp|P51554|EF1A_HYDVU Elongation factor 1-alpha OS=Hydra vulgaris PE=2 SV=1 37 488 0.0E+00
sp|P19039|EF1A_APIME Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1 37 471 0.0E+00
sp|Q26487|EF1A_SPOFR Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1 51 457 0.0E+00
sp|P86939|EF1A2_TRYB2 Elongation factor 1-alpha 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.5670 PE=1 SV=1 37 491 0.0E+00
sp|P86934|EF1A1_TRYB2 Elongation factor 1-alpha 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=TEF1 PE=1 SV=1 37 491 0.0E+00
sp|P84316|EF1A_HELZE Elongation factor 1-alpha (Fragment) OS=Helicoverpa zea PE=3 SV=1 51 457 0.0E+00
sp|P84315|EF1A_HELVI Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1 51 457 0.0E+00
sp|P84318|EF1A_HELGL Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1 51 457 0.0E+00
sp|P84320|EF1A_HELDI Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1 51 457 0.0E+00
sp|P84317|EF1A_HELAM Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1 51 457 0.0E+00
sp|P84319|EF1A_HELAL Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1 51 457 0.0E+00
sp|P84322|EF1A_ANIIF Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1 51 457 0.0E+00
sp|P84321|EF1A_ADIBE Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1 51 457 0.0E+00
sp|P86933|EF1A_TRYBB Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=2 SV=1 37 491 0.0E+00
sp|P0CT32|EF1A2_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a2 PE=1 SV=1 37 491 0.0E+00
sp|P0CT31|EF1A1_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=1 37 491 0.0E+00
sp|O49169|EF1A_MANES Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1 37 491 0.0E+00
sp|Q8GTY0|EF1A4_ARATH Elongation factor 1-alpha 4 OS=Arabidopsis thaliana GN=A4 PE=1 SV=2 37 491 0.0E+00
sp|Q0WL56|EF1A3_ARATH Elongation factor 1-alpha 3 OS=Arabidopsis thaliana GN=A3 PE=1 SV=2 37 491 0.0E+00
sp|Q8W4H7|EF1A2_ARATH Elongation factor 1-alpha 2 OS=Arabidopsis thaliana GN=A2 PE=1 SV=2 37 491 0.0E+00
sp|P0DH99|EF1A1_ARATH Elongation factor 1-alpha 1 OS=Arabidopsis thaliana GN=A1 PE=1 SV=1 37 491 0.0E+00
sp|Q04634|EF1A_TETPY Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1 37 473 0.0E+00
sp|P17786|EF1A_SOLLC Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1 37 490 0.0E+00
sp|Q03033|EF1A_WHEAT Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1 37 487 0.0E+00
sp|P43643|EF1A_TOBAC Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1 37 487 0.0E+00
sp|P14963|EF1A_EUGGR Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1 37 487 0.0E+00
sp|P25698|EF1A_SOYBN Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2 37 487 0.0E+00
sp|P50256|EF1AC_PORPU Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1 37 487 0.0E+00
sp|P34823|EF1A2_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1 37 487 0.0E+00
sp|O64937|EF1A_ORYSJ Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2 37 473 0.0E+00
sp|P25166|EF1A_STYLE Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1 41 487 0.0E+00
sp|Q8LPC4|EF1A_PYRYE Elongation factor 1-alpha OS=Pyropia yezoensis PE=2 SV=1 37 487 0.0E+00
sp|Q40034|EF1A2_HORVU Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1 37 487 0.0E+00
sp|P34824|EF1A1_HORVU Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1 37 487 0.0E+00
sp|O24534|EF1A_VICFA Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1 37 473 0.0E+00
sp|Q41803|EF1A_MAIZE Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1 37 473 0.0E+00
sp|P31018|EF1A_ENTHI Elongation factor 1-alpha OS=Entamoeba histolytica PE=2 SV=1 41 471 0.0E+00
sp|P29521|EF1A1_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=1 SV=1 37 473 0.0E+00
sp|P90519|EF1A_CRYPV Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1 37 480 0.0E+00
sp|Q41011|EF1A_PEA Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1 37 473 0.0E+00
sp|P27634|EF1A_RHYAM Elongation factor 1-alpha (Fragment) OS=Rhynchosciara americana PE=2 SV=1 84 490 0.0E+00
sp|P17506|EF1A1_XENLA Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2 42 480 0.0E+00
sp|Q00080|EF1A_PLAFK Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1 37 478 0.0E+00
sp|P54959|EF1A_BLAHO Elongation factor 1-alpha OS=Blastocystis hominis PE=2 SV=1 37 474 0.0E+00
sp|Q27139|EF1A1_EUPCR Elongation factor 1-alpha 1 OS=Euplotes crassus GN=EFA1 PE=3 SV=1 37 475 0.0E+00
sp|Q27140|EF1A2_EUPCR Elongation factor 1-alpha 2 OS=Euplotes crassus GN=EFA2 PE=3 SV=1 37 471 0.0E+00
sp|Q07051|EF1A_EIMBO Elongation factor 1-alpha (Fragment) OS=Eimeria bovis PE=2 SV=1 137 491 0.0E+00
sp|Q08046|EF1A_GIAIN Elongation factor 1-alpha (Fragment) OS=Giardia intestinalis GN=TEF1 PE=2 SV=1 53 457 1.0E-180
sp|P50257|EF1AS_PORPU Elongation factor 1-alpha S OS=Porphyra purpurea GN=TEF-S PE=2 SV=1 37 472 1.0E-171
sp|A8ABM5|EF1A_IGNH4 Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1 37 474 1.0E-171
sp|A3DMQ1|EF1A_STAMF Elongation factor 1-alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=tuf PE=3 SV=1 42 472 1.0E-169
sp|A2BN41|EF1A_HYPBU Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=tuf PE=3 SV=1 42 474 7.0E-166
sp|P41203|EF1A_DESMO Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1 37 474 2.0E-164
sp|B8GIQ3|EF1A_METPE Elongation factor 1-alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tuf PE=3 SV=1 40 472 3.0E-161
sp|A1RXW9|EF1A_THEPD Elongation factor 1-alpha OS=Thermofilum pendens (strain Hrk 5) GN=tuf PE=3 SV=1 40 474 7.0E-161
sp|A7I656|EF1A_METB6 Elongation factor 1-alpha OS=Methanoregula boonei (strain 6A8) GN=tuf PE=3 SV=1 41 472 1.0E-160
sp|Q2FRI3|EF1A_METHJ Elongation factor 1-alpha OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=tuf PE=3 SV=1 41 473 1.0E-159
sp|Q9YAV0|EF1A_AERPE Elongation factor 1-alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tuf PE=1 SV=1 41 474 3.0E-159
sp|A2STF0|EF1A_METLZ Elongation factor 1-alpha OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tuf PE=3 SV=1 42 472 8.0E-159
sp|A0RUM4|EF1A_CENSY Elongation factor 1-alpha OS=Cenarchaeum symbiosum (strain A) GN=tuf PE=3 SV=1 34 471 5.0E-158
sp|O29325|EF1A_ARCFU Elongation factor 1-alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tuf PE=3 SV=1 41 468 2.0E-157
sp|Q57770|EF1A_METJA Elongation factor 1-alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tuf PE=3 SV=1 51 467 3.0E-156
sp|P35021|EF1A_SULSO Elongation factor 1-alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tuf PE=1 SV=3 42 474 4.0E-156
sp|P17196|EF1A_SULAC Elongation factor 1-alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tuf PE=3 SV=1 42 472 2.0E-155
sp|A4YCR6|EF1A_METS5 Elongation factor 1-alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=tuf PE=3 SV=1 42 472 2.0E-154
sp|P19486|EF1A_THEAC Elongation factor 1-alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tuf PE=3 SV=2 42 473 2.0E-153
sp|A3CTG3|EF1A_METMJ Elongation factor 1-alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tuf PE=3 SV=1 41 471 4.0E-153
sp|Q979T1|EF1A_THEVO Elongation factor 1-alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tuf PE=3 SV=2 42 473 5.0E-153
sp|C6A4R7|EF1A_THESM Elongation factor 1-alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tuf PE=3 SV=1 41 473 9.0E-153
sp|Q8TRC4|EF1A_METAC Elongation factor 1-alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tuf PE=3 SV=1 41 473 2.0E-152
sp|Q6L202|EF1A_PICTO Elongation factor 1-alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tuf PE=3 SV=1 41 474 4.0E-152
sp|A6UQ14|EF1A_METVS Elongation factor 1-alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tuf PE=3 SV=1 51 467 6.0E-152
sp|P07810|EF1A_METVA Elongation factor 1-alpha OS=Methanococcus vannielii GN=tuf PE=3 SV=1 51 467 3.0E-151
sp|A4FWE9|EF1A_METM5 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tuf PE=3 SV=1 41 467 1.0E-150
sp|A9A9U3|EF1A_METM6 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tuf PE=3 SV=1 41 467 1.0E-150
sp|A6VGV6|EF1A_METM7 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tuf PE=3 SV=1 41 467 2.0E-150
sp|O93729|EF1A_PYRAE Elongation factor 1-alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tuf PE=3 SV=1 42 474 4.0E-149
sp|Q6LXI1|EF1A_METMP Elongation factor 1-alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=tuf PE=3 SV=1 41 467 5.0E-149
sp|A0B7D6|EF1A_METTP Elongation factor 1-alpha OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tuf PE=3 SV=1 40 471 1.0E-148
sp|Q3IUD8|EF1A_NATPD Elongation factor 1-alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tuf PE=3 SV=1 40 473 1.0E-148
sp|A8MAJ1|EF1A_CALMQ Elongation factor 1-alpha OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tuf PE=3 SV=1 42 474 3.0E-147
sp|Q976B1|EF1A_SULTO Elongation factor 1-alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tuf PE=3 SV=1 42 472 3.0E-147
sp|A3MV69|EF1A_PYRCJ Elongation factor 1-alpha OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tuf PE=3 SV=1 42 474 6.0E-147
sp|A6UV43|EF1A_META3 Elongation factor 1-alpha OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tuf PE=3 SV=1 41 467 7.0E-147
sp|A1RRJ3|EF1A_PYRIL Elongation factor 1-alpha OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tuf PE=3 SV=1 42 474 1.0E-146
sp|Q12WT3|EF1A_METBU Elongation factor 1-alpha OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=tuf PE=3 SV=1 41 473 2.0E-146
sp|A4WKK8|EF1A_PYRAR Elongation factor 1-alpha OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tuf PE=3 SV=1 42 474 3.0E-146
sp|Q0W8G2|EF1A_METAR Elongation factor 1-alpha OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=tuf PE=3 SV=1 42 471 4.0E-146
sp|Q8TYP6|EF1A_METKA Elongation factor 1-alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tuf PE=3 SV=1 41 473 7.0E-146
sp|Q8U152|EF1A_PYRFU Elongation factor 1-alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tuf PE=3 SV=1 41 474 3.0E-145
sp|Q18EY5|EF1A_HALWD Elongation factor 1-alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=tuf PE=3 SV=1 41 473 5.0E-145
sp|A5ULM5|EF1A_METS3 Elongation factor 1-alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tuf PE=3 SV=2 42 474 5.0E-145
sp|Q8PUR8|EF1A_METMA Elongation factor 1-alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tuf PE=3 SV=1 41 473 6.0E-145
sp|P26751|EF1A_PYRWO Elongation factor 1-alpha OS=Pyrococcus woesei GN=tuf PE=3 SV=1 36 474 8.0E-145
sp|Q464Z4|EF1A_METBF Elongation factor 1-alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tuf PE=3 SV=1 41 473 2.0E-144
sp|Q5JFZ4|EF1A_THEKO Elongation factor 1-alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tuf PE=3 SV=1 41 474 2.0E-144
sp|B6YVG2|EF1A_THEON Elongation factor 1-alpha OS=Thermococcus onnurineus (strain NA1) GN=tuf PE=3 SV=1 41 474 6.0E-144
sp|P17197|EF1A_THECE Elongation factor 1-alpha OS=Thermococcus celer GN=tuf PE=3 SV=1 41 474 2.0E-143
sp|Q9HM89|EF1A_HALSA Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tuf PE=3 SV=1 41 474 2.0E-143
sp|B0R8C3|EF1A_HALS3 Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=tuf PE=3 SV=1 41 474 2.0E-143
sp|C5A5P4|EF1A_THEGJ Elongation factor 1-alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=tuf PE=3 SV=1 41 474 3.0E-143
sp|O27132|EF1A_METTH Elongation factor 1-alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tuf PE=1 SV=1 41 467 5.0E-143
sp|O59153|EF1A_PYRHO Elongation factor 1-alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tuf PE=1 SV=1 41 474 1.0E-142
sp|P16018|EF1A_HALMA Elongation factor 1-alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tuf PE=1 SV=2 41 473 7.0E-142
sp|Q9V0V7|EF1A_PYRAB Elongation factor 1-alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tuf PE=3 SV=1 41 474 4.0E-141
sp|Q2NEL1|EF1A_METST Elongation factor 1-alpha OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tuf PE=3 SV=1 41 474 3.0E-139
sp|Q74MI6|EF1A_NANEQ Elongation factor 1-alpha OS=Nanoarchaeum equitans (strain Kin4-M) GN=tuf PE=3 SV=1 41 471 3.0E-124
sp|Q9Y450|HBS1L_HUMAN HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV=1 42 473 3.0E-102
sp|Q5R6Y0|HBS1L_PONAB HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV=1 42 473 4.0E-102
sp|Q69ZS7|HBS1L_MOUSE HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV=2 42 473 9.0E-99
sp|Q6AXM7|HBS1L_RAT HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE=1 SV=1 42 473 4.0E-98
sp|Q2KHZ2|HBS1L_BOVIN HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1 42 472 5.0E-98
sp|P15170|ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens GN=GSPT1 PE=1 SV=1 32 471 5.0E-97
sp|Q8R050|ERF3A_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Mus musculus GN=Gspt1 PE=1 SV=2 32 471 9.0E-96
sp|Q149F3|ERF3B_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Mus musculus GN=Gspt2 PE=1 SV=1 38 468 2.0E-93
sp|Q8IYD1|ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens GN=GSPT2 PE=1 SV=2 38 471 2.0E-93
sp|Q5R4B3|ERF3B_PONAB Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Pongo abelii GN=GSPT2 PE=2 SV=1 38 471 2.0E-93
sp|O74718|ERF3_SCHPO Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sup35 PE=1 SV=2 42 468 2.0E-90
sp|Q9HGI4|ERF3_ZYGRO Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2 42 472 4.0E-89
sp|Q9HGI7|ERF3_CANMA Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2 42 468 2.0E-88
sp|Q9HGI8|ERF3_KLULA Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUP35 PE=3 SV=1 42 468 5.0E-87
sp|O13354|ERF3_CANAX Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1 42 468 9.0E-85
sp|P23637|ERF3_OGAPI Eukaryotic peptide chain release factor GTP-binding subunit OS=Ogataea pini GN=SUP2 PE=3 SV=1 42 468 6.0E-84
sp|Q9HGI6|ERF3_DEBHA Eukaryotic peptide chain release factor GTP-binding subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUP35 PE=3 SV=4 42 471 2.0E-83
sp|P05453|ERF3_YEAST Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUP35 PE=1 SV=1 42 468 6.0E-83
sp|Q8SS29|EF1A_ENCCU Elongation factor 1-alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TEF1 PE=1 SV=2 36 466 3.0E-76
sp|O74774|HBS1_SCHPO Elongation factor 1 alpha-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hbs1 PE=1 SV=4 51 471 5.0E-76
sp|Q7YZN9|ERF3_DICDI Eukaryotic peptide chain release factor GTP-binding subunit OS=Dictyostelium discoideum GN=erf3 PE=2 SV=1 37 475 2.0E-72
sp|P32769|HBS1_YEAST Elongation factor 1 alpha-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HBS1 PE=1 SV=2 24 357 7.0E-56
sp|B9MQH1|EFTU_CALBD Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 82 471 2.0E-47
sp|A4XI37|EFTU_CALS8 Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 82 471 1.0E-46
sp|A8F4Q9|EFTU_PSELT Elongation factor Tu OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=tuf PE=3 SV=1 82 471 2.0E-46
sp|A5D5K0|EFTU1_PELTS Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 79 473 1.0E-45
sp|O50340|EFTU_FERIS Elongation factor Tu OS=Fervidobacterium islandicum GN=tuf PE=3 SV=1 91 471 1.0E-45
sp|Q01698|EFTU_THEAQ Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 42 471 1.0E-45
sp|P17245|EFTU_CYAPA Elongation factor Tu, cyanelle OS=Cyanophora paradoxa GN=tufA PE=3 SV=2 82 473 1.0E-45
sp|P13442|NODQ_RHIME Bifunctional enzyme NodQ OS=Rhizobium meliloti (strain 1021) GN=nodQ PE=3 SV=1 24 491 1.0E-45
sp|A5D5I8|EFTU2_PELTS Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 79 473 1.0E-45
sp|P02992|EFTU_YEAST Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 3 471 1.0E-45
sp|Q72GW4|EFTU_THET2 Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 42 471 2.0E-45
sp|A6LLL1|EFTU_THEM4 Elongation factor Tu OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tuf PE=3 SV=1 81 471 2.0E-45
sp|P60338|EFTU1_THETH Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 42 471 2.0E-45
sp|Q5SHN6|EFTU1_THET8 Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 42 471 2.0E-45
sp|B1LBP2|EFTU_THESQ Elongation factor Tu OS=Thermotoga sp. (strain RQ2) GN=tuf PE=3 SV=1 92 471 2.0E-45
sp|A5IM81|EFTU_THEP1 Elongation factor Tu OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tuf PE=3 SV=1 92 471 2.0E-45
sp|P13537|EFTU_THEMA Elongation factor Tu OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tuf PE=3 SV=2 92 471 3.0E-45
sp|Q1D7V1|EFTU1_MYXXD Elongation factor Tu 1 OS=Myxococcus xanthus (strain DK 1622) GN=tuf1 PE=3 SV=1 76 471 4.0E-45
sp|Q1D776|EFTU2_MYXXD Elongation factor Tu 2 OS=Myxococcus xanthus (strain DK 1622) GN=tuf2 PE=3 SV=1 76 471 4.0E-45
sp|Q9TJQ8|EFTU_PROWI Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 82 473 4.0E-45
sp|P60339|EFTU2_THET8 Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 92 471 4.0E-45
sp|A5FZW7|EFTU_ACICJ Elongation factor Tu OS=Acidiphilium cryptum (strain JF-5) GN=tuf PE=3 SV=1 76 473 9.0E-45
sp|Q6AP73|EFTU2_DESPS Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 82 471 3.0E-44
sp|A5V604|EFTU_SPHWW Elongation factor Tu OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=tuf PE=3 SV=1 76 473 6.0E-44
sp|Q250N4|EFTU_DESHY Elongation factor Tu OS=Desulfitobacterium hafniense (strain Y51) GN=tuf PE=3 SV=1 92 471 7.0E-44
sp|B8G1W4|EFTU_DESHD Elongation factor Tu OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=tuf PE=3 SV=1 92 471 7.0E-44
sp|A7HM54|EFTU_FERNB Elongation factor Tu OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tuf PE=3 SV=1 91 471 8.0E-44
sp|B7IHU4|EFTU_THEAB Elongation factor Tu OS=Thermosipho africanus (strain TCF52B) GN=tuf PE=3 SV=1 81 471 9.0E-44
sp|C4LAG3|CYSN_TOLAT Sulfate adenylyltransferase subunit 1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysN PE=3 SV=1 51 488 1.0E-43
sp|O50274|CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysNC PE=3 SV=1 51 478 1.0E-43
sp|Q2RFP5|EFTU_MOOTA Elongation factor Tu OS=Moorella thermoacetica (strain ATCC 39073) GN=tuf PE=3 SV=1 92 471 2.0E-43
sp|A0LRL8|EFTU_ACIC1 Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 92 473 2.0E-43
sp|A8ANW5|CYSN_CITK8 Sulfate adenylyltransferase subunit 1 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysN PE=3 SV=1 51 476 2.0E-43
sp|A7HBL7|EFTU_ANADF Elongation factor Tu OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tuf1 PE=3 SV=1 41 471 2.0E-43
sp|A7I3U7|EFTU_CAMHC Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1 92 471 3.0E-43
sp|O07309|NODQ_RHISB Bifunctional enzyme NodQ OS=Rhizobium sp. (strain BR816) GN=nodQ PE=3 SV=1 16 466 3.0E-43
sp|B9K884|EFTU_THENN Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 92 471 4.0E-43
sp|B0TC54|EFTU_HELMI Elongation factor Tu OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=tuf PE=3 SV=1 79 471 4.0E-43
sp|A1ALS6|EFTU_PELPD Elongation factor Tu OS=Pelobacter propionicus (strain DSM 2379) GN=tuf1 PE=3 SV=1 82 471 5.0E-43
sp|Q6AP86|EFTU1_DESPS Elongation factor Tu 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf1 PE=3 SV=1 82 471 8.0E-43
sp|Q3A9P8|EFTU2_CARHZ Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 92 473 8.0E-43
sp|Q3A9R3|EFTU1_CARHZ Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 92 473 9.0E-43
sp|Q47LJ1|EFTU_THEFY Elongation factor Tu OS=Thermobifida fusca (strain YX) GN=tuf PE=3 SV=1 92 473 1.0E-42
sp|A8Z5T8|EFTU_SULMW Elongation factor Tu OS=Sulcia muelleri (strain GWSS) GN=tuf PE=3 SV=1 39 472 1.0E-42
sp|A6Q1L5|EFTU_NITSB Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 92 471 1.0E-42
sp|Q2EEV7|EFTU_HELSJ Elongation factor Tu, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=tufA PE=3 SV=2 79 471 1.0E-42
sp|Q1MPT8|EFTU_LAWIP Elongation factor Tu OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=tuf PE=3 SV=1 92 471 1.0E-42
sp|P49410|EFTU_BOVIN Elongation factor Tu, mitochondrial OS=Bos taurus GN=TUFM PE=1 SV=1 41 468 1.0E-42
sp|O66429|EFTU_AQUAE Elongation factor Tu OS=Aquifex aeolicus (strain VF5) GN=tufA PE=3 SV=1 86 471 2.0E-42
sp|Q01SX2|EFTU_SOLUE Elongation factor Tu OS=Solibacter usitatus (strain Ellin6076) GN=tuf1 PE=3 SV=1 83 473 2.0E-42
sp|Q64VQ9|CYSN_BACFR Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain YCH46) GN=cysN PE=3 SV=1 51 473 2.0E-42
sp|Q2JUX4|EFTU_SYNJA Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1 79 473 3.0E-42
sp|Q9Y700|EFTU_SCHPO Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tuf1 PE=3 SV=1 42 439 3.0E-42
sp|Q5LES3|CYSN_BACFN Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=cysN PE=3 SV=1 51 473 3.0E-42
sp|O50293|EFTU_AQUPY Elongation factor Tu OS=Aquifex pyrophilus GN=tuf PE=3 SV=1 86 471 4.0E-42
sp|A7MJ69|CYSN_CROS8 Sulfate adenylyltransferase subunit 1 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysN PE=3 SV=1 51 466 4.0E-42
sp|Q8BFR5|EFTU_MOUSE Elongation factor Tu, mitochondrial OS=Mus musculus GN=Tufm PE=1 SV=1 41 471 5.0E-42
sp|C5C0J3|EFTU_BEUC1 Elongation factor Tu OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=tuf PE=3 SV=1 92 378 5.0E-42
sp|A3DJ00|EFTU_CLOTH Elongation factor Tu OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tuf PE=3 SV=1 82 471 5.0E-42
sp|Q5NQ65|EFTU_ZYMMO Elongation factor Tu OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=tuf PE=3 SV=1 76 473 7.0E-42
sp|Q2G8Y2|EFTU_NOVAD Elongation factor Tu OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=tuf PE=3 SV=1 76 473 7.0E-42
sp|A5CCL4|EFTU2_ORITB Elongation factor Tu 2 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf2 PE=3 SV=2 78 473 7.0E-42
sp|Q8AAP9|CYSN_BACTN Sulfate adenylyltransferase subunit 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cysN PE=3 SV=1 51 375 7.0E-42
sp|A5CCA0|EFTU1_ORITB Elongation factor Tu 1 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf1 PE=3 SV=1 78 473 8.0E-42
sp|Q748X8|EFTU_GEOSL Elongation factor Tu OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tuf1 PE=3 SV=1 76 471 8.0E-42
sp|P42479|EFTU_STIAU Elongation factor Tu OS=Stigmatella aurantiaca GN=tuf PE=3 SV=2 76 471 8.0E-42
sp|A5N4N1|EFTU_CLOK5 Elongation factor Tu OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=tuf1 PE=3 SV=1 79 471 1.0E-41
sp|P49411|EFTU_HUMAN Elongation factor Tu, mitochondrial OS=Homo sapiens GN=TUFM PE=1 SV=2 41 468 1.0E-41
sp|A0KP35|CYSN_AERHH Sulfate adenylyltransferase subunit 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysN PE=3 SV=1 51 476 1.0E-41
sp|C5CGR6|EFTU_KOSOT Elongation factor Tu OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tuf PE=3 SV=1 76 471 1.0E-41
sp|A2BT83|EFTU_PROMS Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 92 473 1.0E-41
sp|Q3AMT6|EFTU_SYNSC Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 79 471 1.0E-41
sp|Q1QN32|EFTU_NITHX Elongation factor Tu OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=tuf PE=3 SV=1 76 471 1.0E-41
sp|Q5GWR8|EFTU_XANOR Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tuf1 PE=3 SV=1 42 473 1.0E-41
sp|Q2NZX1|EFTU_XANOM Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tuf1 PE=3 SV=1 42 473 1.0E-41
sp|Q3SSW8|EFTU_NITWN Elongation factor Tu OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=tuf PE=3 SV=1 76 471 2.0E-41
sp|B2VG01|CYSN_ERWT9 Sulfate adenylyltransferase subunit 1 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cysN PE=3 SV=1 51 478 2.0E-41
sp|P85834|EFTU_RAT Elongation factor Tu, mitochondrial OS=Rattus norvegicus GN=Tufm PE=1 SV=1 41 471 2.0E-41
sp|Q07KJ2|EFTU_RHOP5 Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisA53) GN=tuf1 PE=3 SV=1 76 471 2.0E-41
sp|Q1IHG6|EFTU_KORVE Elongation factor Tu OS=Koribacter versatilis (strain Ellin345) GN=tuf1 PE=3 SV=1 83 471 2.0E-41
sp|A3PEZ7|EFTU_PROM0 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 92 473 2.0E-41
sp|A0QS98|EFTU_MYCS2 Elongation factor Tu OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=tuf PE=1 SV=1 92 473 2.0E-41
sp|A2BYN4|EFTU_PROM5 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 92 471 2.0E-41
sp|Q211E6|EFTU_RHOPB Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisB18) GN=tuf PE=3 SV=1 76 471 3.0E-41
sp|Q0AUG3|EFTU2_SYNWW Elongation factor Tu 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf2 PE=3 SV=1 92 473 3.0E-41
sp|A9BHA7|EFTU_PETMO Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1 42 471 3.0E-41
sp|Q1QUF9|CYSN_CHRSD Sulfate adenylyltransferase subunit 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysN PE=3 SV=1 51 481 3.0E-41
sp|A8G708|EFTU_PROM2 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 92 473 4.0E-41
sp|A1VAK4|EFTU_DESVV Elongation factor Tu OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=tuf PE=3 SV=1 76 471 4.0E-41
sp|Q727D5|EFTU_DESVH Elongation factor Tu OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=tuf PE=3 SV=1 76 471 4.0E-41
sp|Q318N5|EFTU_PROM9 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 92 473 4.0E-41
sp|Q1GP97|EFTU_SPHAL Elongation factor Tu OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=tuf PE=3 SV=1 82 473 4.0E-41
sp|A9H3R7|EFTU_GLUDA Elongation factor Tu OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=tuf PE=3 SV=1 76 471 4.0E-41
sp|Q482Z9|CYSN_COLP3 Sulfate adenylyltransferase subunit 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysN PE=3 SV=1 51 466 4.0E-41
sp|Q9PD78|CYSNC_XYLFA Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain 9a5c) GN=cysNC PE=3 SV=2 51 466 5.0E-41
sp|Q02WY9|EFTU_LACLS Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=tuf PE=3 SV=1 92 471 6.0E-41
sp|A2RMT1|EFTU_LACLM Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=tuf PE=3 SV=1 92 471 6.0E-41
sp|Q9CEI0|EFTU_LACLA Elongation factor Tu OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=tuf PE=3 SV=1 92 471 6.0E-41
sp|Q92GW4|EFTU_RICCN Elongation factor Tu OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tuf PE=3 SV=1 92 471 6.0E-41
sp|A1T4L6|EFTU_MYCVP Elongation factor Tu OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tuf PE=3 SV=1 92 473 6.0E-41
sp|Q3SLQ1|EFTU_THIDA Elongation factor Tu OS=Thiobacillus denitrificans (strain ATCC 25259) GN=tuf1 PE=3 SV=1 84 473 7.0E-41
sp|Q0AUH8|EFTU1_SYNWW Elongation factor Tu 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf1 PE=3 SV=1 92 473 7.0E-41
sp|P72339|NODQ_RHIS3 Bifunctional enzyme NodQ OS=Rhizobium sp. (strain N33) GN=nodQ PE=3 SV=1 51 474 8.0E-41
sp|Q7UZY7|EFTU_PROMP Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 92 471 8.0E-41
sp|A7ZCN0|EFTU_CAMC1 Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 92 471 8.0E-41
sp|C5BSJ5|CYSN_TERTT Sulfate adenylyltransferase subunit 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cysN PE=3 SV=1 51 466 8.0E-41
sp|P9WNM5|CYSNC_MYCTU Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysNC PE=1 SV=1 51 468 8.0E-41
sp|P9WNM4|CYSNC_MYCTO Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysNC PE=3 SV=1 51 468 8.0E-41
sp|P09953|EFTU_MICLU Elongation factor Tu OS=Micrococcus luteus GN=tuf PE=3 SV=1 92 473 1.0E-40
sp|B2GIL2|EFTU_KOCRD Elongation factor Tu OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=tuf PE=3 SV=1 92 483 1.0E-40
sp|Q5PBH1|EFTU_ANAMM Elongation factor Tu OS=Anaplasma marginale (strain St. Maries) GN=tuf1 PE=3 SV=1 92 471 1.0E-40
sp|A8GT71|EFTU_RICRS Elongation factor Tu OS=Rickettsia rickettsii (strain Sheila Smith) GN=tuf PE=3 SV=1 92 471 1.0E-40
sp|B0BUR2|EFTU_RICRO Elongation factor Tu OS=Rickettsia rickettsii (strain Iowa) GN=tuf PE=3 SV=1 92 471 1.0E-40
sp|C4K2I2|EFTU_RICPU Elongation factor Tu OS=Rickettsia peacockii (strain Rustic) GN=tuf PE=3 SV=1 92 471 1.0E-40
sp|C3PPA9|EFTU_RICAE Elongation factor Tu OS=Rickettsia africae (strain ESF-5) GN=tuf PE=3 SV=1 92 471 1.0E-40
sp|Q5YPG4|EFTU_NOCFA Elongation factor Tu OS=Nocardia farcinica (strain IFM 10152) GN=tuf PE=3 SV=2 85 473 1.0E-40
sp|P42477|EFTU_HERAU Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1 41 471 1.0E-40
sp|A4SRG8|CYSN_AERS4 Sulfate adenylyltransferase subunit 1 OS=Aeromonas salmonicida (strain A449) GN=cysN PE=3 SV=1 51 476 1.0E-40
sp|A5GIP0|EFTU_SYNPW Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 92 471 1.0E-40
sp|A4FPM7|EFTU_SACEN Elongation factor Tu OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tuf PE=3 SV=1 41 473 1.0E-40
sp|Q8R7T8|EFTU2_CALS4 Elongation factor Tu-B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufB PE=3 SV=1 92 471 1.0E-40
sp|P0A3B0|EFTU_RICSI Elongation factor Tu OS=Rickettsia sibirica GN=tuf PE=3 SV=1 92 471 1.0E-40
sp|P0A3A9|EFTU_RICRI Elongation factor Tu OS=Rickettsia rickettsii GN=tuf PE=3 SV=1 92 471 1.0E-40
sp|A5GAW4|EFTU_GEOUR Elongation factor Tu OS=Geobacter uraniireducens (strain Rf4) GN=tuf1 PE=3 SV=1 82 471 1.0E-40
sp|A8F2E9|EFTU_RICM5 Elongation factor Tu OS=Rickettsia massiliae (strain Mtu5) GN=tuf PE=3 SV=2 92 471 1.0E-40
sp|Q8R7V2|EFTU1_CALS4 Elongation factor Tu-A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufA PE=3 SV=1 92 471 2.0E-40
sp|B1WQY4|EFTU_CYAA5 Elongation factor Tu OS=Cyanothece sp. (strain ATCC 51142) GN=tuf PE=3 SV=1 92 473 2.0E-40
sp|B3QY22|EFTU_CHLT3 Elongation factor Tu OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=tuf PE=3 SV=1 39 471 2.0E-40
sp|Q1ACI3|EFTU_CHAVU Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1 92 471 2.0E-40
sp|Q8KTA1|EFTU_RICMO Elongation factor Tu OS=Rickettsia montanensis GN=tuf PE=3 SV=1 92 471 2.0E-40
sp|P48865|EFTU_RICPR Elongation factor Tu OS=Rickettsia prowazekii (strain Madrid E) GN=tuf PE=3 SV=2 92 471 2.0E-40
sp|Q877L9|EFTU_CLOTE Elongation factor Tu OS=Clostridium tetani (strain Massachusetts / E88) GN=tufA PE=3 SV=1 85 471 2.0E-40
sp|A9ISD9|EFTU_BART1 Elongation factor Tu OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=tuf1 PE=3 SV=1 84 471 2.0E-40
sp|O21245|EFTU_RECAM Elongation factor Tu, mitochondrial OS=Reclinomonas americana GN=TUFA PE=3 SV=1 76 471 2.0E-40
sp|Q8UH69|CYSN_AGRFC Sulfate adenylyltransferase subunit 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysN PE=3 SV=1 51 386 2.0E-40
sp|Q46IW4|EFTU_PROMT Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 92 471 2.0E-40
sp|Q134R0|EFTU2_RHOPS Elongation factor Tu 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf2 PE=3 SV=1 76 471 2.0E-40
sp|Q826Z7|EFTU2_STRAW Elongation factor Tu 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tuf2 PE=3 SV=1 76 472 2.0E-40
sp|P52978|NODQ_RHITR Bifunctional enzyme NodQ OS=Rhizobium tropici GN=nodQ PE=3 SV=1 19 466 2.0E-40
sp|Q8KTA6|EFTU_RICPA Elongation factor Tu OS=Rickettsia parkeri GN=tuf PE=3 SV=1 92 471 2.0E-40
sp|A8EZL8|EFTU_RICCK Elongation factor Tu OS=Rickettsia canadensis (strain McKiel) GN=tuf PE=3 SV=1 92 471 2.0E-40
sp|Q134S7|EFTU1_RHOPS Elongation factor Tu 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf1 PE=3 SV=1 76 471 3.0E-40
sp|Q4FLK5|EFTU_PELUB Elongation factor Tu OS=Pelagibacter ubique (strain HTCC1062) GN=tuf PE=3 SV=1 80 471 3.0E-40
sp|Q6A6L7|EFTU_PROAC Elongation factor Tu OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tuf PE=3 SV=1 92 473 3.0E-40
sp|A0JZ88|EFTU_ARTS2 Elongation factor Tu OS=Arthrobacter sp. (strain FB24) GN=tuf PE=3 SV=1 92 483 3.0E-40
sp|A8GPF2|EFTU_RICAH Elongation factor Tu OS=Rickettsia akari (strain Hartford) GN=tuf PE=3 SV=1 92 471 3.0E-40
sp|A9BCK0|EFTU_PROM4 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 92 473 3.0E-40
sp|Q8KT99|EFTU_RICHE Elongation factor Tu OS=Rickettsia helvetica GN=tuf PE=3 SV=1 92 471 3.0E-40
sp|Q7V500|EFTU_PROMM Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1 79 471 3.0E-40
sp|Q03LX0|EFTU_STRTD Elongation factor Tu OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=tuf PE=3 SV=1 92 472 3.0E-40
sp|Q5M5I8|EFTU_STRT2 Elongation factor Tu OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=tuf PE=3 SV=1 92 472 3.0E-40
sp|Q5M101|EFTU_STRT1 Elongation factor Tu OS=Streptococcus thermophilus (strain CNRZ 1066) GN=tuf PE=3 SV=1 92 472 3.0E-40
sp|Q7VA05|EFTU_PROMA Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 92 473 3.0E-40
sp|A1JJT0|CYSN_YERE8 Sulfate adenylyltransferase subunit 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysN PE=3 SV=1 51 466 3.0E-40
sp|B9KFF9|EFTU_CAMLR Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 92 473 4.0E-40
sp|A2C4U5|EFTU_PROM1 Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 92 471 4.0E-40
sp|P50371|EFTU_CHACO Elongation factor Tu, chloroplastic OS=Chara connivens GN=tufA PE=3 SV=1 92 468 4.0E-40
sp|Q2JMX7|EFTU_SYNJB Elongation factor Tu OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=tuf PE=3 SV=1 82 473 4.0E-40
sp|B7JUP5|EFTU_CYAP8 Elongation factor Tu OS=Cyanothece sp. (strain PCC 8801) GN=tuf PE=3 SV=1 79 473 4.0E-40
sp|C1CSB0|EFTU_STRZT Elongation factor Tu OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=tuf PE=3 SV=1 92 472 4.0E-40
sp|C1CLI6|EFTU_STRZP Elongation factor Tu OS=Streptococcus pneumoniae (strain P1031) GN=tuf PE=3 SV=1 92 472 4.0E-40
sp|C1CF71|EFTU_STRZJ Elongation factor Tu OS=Streptococcus pneumoniae (strain JJA) GN=tuf PE=3 SV=1 92 472 4.0E-40
sp|P64031|EFTU_STRR6 Elongation factor Tu OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=tuf PE=3 SV=1 92 472 4.0E-40
sp|P64030|EFTU_STRPN Elongation factor Tu OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=tuf PE=3 SV=1 92 472 4.0E-40
sp|B8ZL95|EFTU_STRPJ Elongation factor Tu OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=tuf PE=3 SV=1 92 472 4.0E-40
sp|B1ICR4|EFTU_STRPI Elongation factor Tu OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=tuf PE=3 SV=1 92 472 4.0E-40
sp|C1C881|EFTU_STRP7 Elongation factor Tu OS=Streptococcus pneumoniae (strain 70585) GN=tuf PE=3 SV=1 92 472 4.0E-40
sp|B5E653|EFTU_STRP4 Elongation factor Tu OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=tuf PE=3 SV=1 92 472 4.0E-40
sp|Q04N79|EFTU_STRP2 Elongation factor Tu OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=tuf PE=3 SV=1 92 472 4.0E-40
sp|A1R8U9|EFTU_ARTAT Elongation factor Tu OS=Arthrobacter aurescens (strain TC1) GN=tuf PE=3 SV=1 92 473 4.0E-40
sp|B8HD11|EFTU_ARTCA Elongation factor Tu OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=tuf PE=3 SV=1 92 483 4.0E-40
sp|B3PII1|CYSN_CELJU Sulfate adenylyltransferase subunit 1 OS=Cellvibrio japonicus (strain Ueda107) GN=cysN PE=3 SV=1 51 476 4.0E-40
sp|Q2GJ61|EFTU_ANAPZ Elongation factor Tu OS=Anaplasma phagocytophilum (strain HZ) GN=tuf1 PE=3 SV=1 92 471 4.0E-40
sp|A9WSW5|EFTU_RENSM Elongation factor Tu OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=tuf PE=3 SV=1 92 483 5.0E-40
sp|A9VP75|EFTU_BACWK Elongation factor Tu OS=Bacillus weihenstephanensis (strain KBAB4) GN=tuf PE=3 SV=1 92 471 6.0E-40
sp|C1D890|CYSN_LARHH Sulfate adenylyltransferase subunit 1 OS=Laribacter hongkongensis (strain HLHK9) GN=cysN PE=3 SV=1 51 475 6.0E-40
sp|A1SNN5|EFTU_NOCSJ Elongation factor Tu OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tuf PE=3 SV=1 92 473 6.0E-40
sp|Q3BWY6|EFTU_XANC5 Elongation factor Tu OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tuf1 PE=3 SV=1 76 473 7.0E-40
sp|Q8NL22|EFTU_XANAC Elongation factor Tu OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tufA PE=3 SV=1 76 473 7.0E-40
sp|Q877P8|EFTU_XYLFT Elongation factor Tu OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tufA PE=3 SV=2 39 471 7.0E-40
sp|Q87DG7|CYSNC_XYLFT Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysNC PE=3 SV=1 51 466 7.0E-40
sp|P22679|EFTU_MYCHP Elongation factor Tu OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=tuf PE=1 SV=1 92 473 8.0E-40
sp|Q9P9Q9|EFTU_XYLFA Elongation factor Tu OS=Xylella fastidiosa (strain 9a5c) GN=tufA PE=1 SV=3 39 471 8.0E-40
sp|A2CC87|EFTU_PROM3 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1 79 471 8.0E-40
sp|Q20EU5|EFTU_OLTVI Elongation factor Tu, chloroplastic OS=Oltmannsiellopsis viridis GN=tufA PE=3 SV=1 82 471 8.0E-40
sp|Q2NVM8|CYSN_SODGM Sulfate adenylyltransferase subunit 1 OS=Sodalis glossinidius (strain morsitans) GN=cysN PE=3 SV=1 51 466 8.0E-40
sp|Q73SD1|EFTU_MYCPA Elongation factor Tu OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=tuf PE=3 SV=1 92 473 8.0E-40
sp|A0QL35|EFTU_MYCA1 Elongation factor Tu OS=Mycobacterium avium (strain 104) GN=tuf PE=3 SV=1 92 473 8.0E-40
sp|P51287|EFTU_PORPU Elongation factor Tu, chloroplastic OS=Porphyra purpurea GN=tufA PE=3 SV=1 81 473 9.0E-40
sp|Q2W2H3|EFTU_MAGSA Elongation factor Tu OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=tuf1 PE=3 SV=1 79 473 9.0E-40
sp|Q0BUQ2|EFTU_GRABC Elongation factor Tu OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=tuf PE=3 SV=1 76 473 9.0E-40
sp|Q8KT95|EFTU_RICTY Elongation factor Tu OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tuf PE=3 SV=2 92 471 9.0E-40
sp|A5GW14|EFTU_SYNR3 Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 79 471 9.0E-40
sp|Q8EX18|EFTU_MYCPE Elongation factor Tu OS=Mycoplasma penetrans (strain HF-2) GN=tuf PE=3 SV=1 82 473 9.0E-40
sp|A7ZQJ5|CYSN_ECO24 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysN PE=3 SV=1 51 466 9.0E-40
sp|A3CP09|EFTU_STRSV Elongation factor Tu OS=Streptococcus sanguinis (strain SK36) GN=tuf PE=3 SV=1 92 472 1.0E-39
sp|Q7N8L0|CYSN_PHOLL Sulfate adenylyltransferase subunit 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysN PE=3 SV=1 51 355 1.0E-39
sp|Q7U4D1|EFTU_SYNPX Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1 92 471 1.0E-39
sp|A0LIH6|EFTU_SYNFM Elongation factor Tu OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=tuf1 PE=3 SV=1 76 471 1.0E-39
sp|B6I6E1|CYSN_ECOSE Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SE11) GN=cysN PE=3 SV=1 51 466 1.0E-39
sp|Q2GFN6|EFTU_EHRCR Elongation factor Tu OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=tuf1 PE=3 SV=1 37 471 1.0E-39
sp|A8AWA0|EFTU_STRGC Elongation factor Tu OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=tuf PE=3 SV=1 92 472 1.0E-39
sp|Q04B37|EFTU_LACDB Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tuf PE=3 SV=1 92 472 1.0E-39
sp|Q1GAQ0|EFTU_LACDA Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tuf PE=3 SV=1 92 472 1.0E-39
sp|A4VTQ7|EFTU_STRSY Elongation factor Tu OS=Streptococcus suis (strain 05ZYH33) GN=tuf PE=3 SV=2 92 472 1.0E-39
sp|A4VZZ3|EFTU_STRS2 Elongation factor Tu OS=Streptococcus suis (strain 98HAH33) GN=tuf PE=3 SV=2 92 472 1.0E-39
sp|A6QB12|CYSN_SULNB Sulfate adenylyltransferase subunit 1 OS=Sulfurovum sp. (strain NBC37-1) GN=cysN PE=3 SV=1 51 473 1.0E-39
sp|Q6N4Q4|EFTU_RHOPA Elongation factor Tu OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=tuf1 PE=3 SV=1 76 471 2.0E-39
sp|B9IZJ2|EFTU_BACCQ Elongation factor Tu OS=Bacillus cereus (strain Q1) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|B7HQU2|EFTU_BACC7 Elongation factor Tu OS=Bacillus cereus (strain AH187) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|Q73F98|EFTU_BACC1 Elongation factor Tu OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|P69952|EFTU_STRP1 Elongation factor Tu OS=Streptococcus pyogenes serotype M1 GN=tuf PE=3 SV=1 92 472 2.0E-39
sp|Q3AW53|EFTU_SYNS9 Elongation factor Tu OS=Synechococcus sp. (strain CC9902) GN=tuf PE=3 SV=1 79 471 2.0E-39
sp|Q67JU1|EFTU_SYMTH Elongation factor Tu OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tuf PE=3 SV=1 76 473 2.0E-39
sp|P9WNN1|EFTU_MYCTU Elongation factor Tu OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tuf PE=1 SV=1 92 473 2.0E-39
sp|P9WNN0|EFTU_MYCTO Elongation factor Tu OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=tuf PE=3 SV=1 92 473 2.0E-39
sp|A5U071|EFTU_MYCTA Elongation factor Tu OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=tuf PE=3 SV=1 92 473 2.0E-39
sp|C1AL18|EFTU_MYCBT Elongation factor Tu OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=tuf PE=3 SV=1 92 473 2.0E-39
sp|A1KGG5|EFTU_MYCBP Elongation factor Tu OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=tuf PE=3 SV=1 92 473 2.0E-39
sp|P0A559|EFTU_MYCBO Elongation factor Tu OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=tuf PE=3 SV=1 92 473 2.0E-39
sp|P42476|EFTU_TERFE Elongation factor Tu OS=Terrimonas ferruginea GN=tuf PE=3 SV=1 92 473 2.0E-39
sp|Q1BDD3|EFTU_MYCSS Elongation factor Tu OS=Mycobacterium sp. (strain MCS) GN=tuf PE=3 SV=1 92 473 2.0E-39
sp|A1UBL1|EFTU_MYCSK Elongation factor Tu OS=Mycobacterium sp. (strain KMS) GN=tuf PE=3 SV=1 92 473 2.0E-39
sp|A3PV96|EFTU_MYCSJ Elongation factor Tu OS=Mycobacterium sp. (strain JLS) GN=tuf PE=3 SV=1 92 473 2.0E-39
sp|Q6HPR0|EFTU_BACHK Elongation factor Tu OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|Q63H92|EFTU_BACCZ Elongation factor Tu OS=Bacillus cereus (strain ZK / E33L) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|Q814C4|EFTU_BACCR Elongation factor Tu OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|B7HJ46|EFTU_BACC4 Elongation factor Tu OS=Bacillus cereus (strain B4264) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|C1ET37|EFTU_BACC3 Elongation factor Tu OS=Bacillus cereus (strain 03BB102) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|B7JKB7|EFTU_BACC0 Elongation factor Tu OS=Bacillus cereus (strain AH820) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|Q81VT2|EFTU_BACAN Elongation factor Tu OS=Bacillus anthracis GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|A0R8H8|EFTU_BACAH Elongation factor Tu OS=Bacillus thuringiensis (strain Al Hakam) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|C3LJ80|EFTU_BACAC Elongation factor Tu OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|C3P9Q3|EFTU_BACAA Elongation factor Tu OS=Bacillus anthracis (strain A0248) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|P40175|EFTU3_STRCO Elongation factor Tu-3 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tuf3 PE=3 SV=2 76 472 2.0E-39
sp|C0Q9Y7|EFTU_DESAH Elongation factor Tu OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=tuf PE=3 SV=1 76 471 2.0E-39
sp|Q3YRK7|EFTU_EHRCJ Elongation factor Tu OS=Ehrlichia canis (strain Jake) GN=tuf1 PE=3 SV=1 37 471 2.0E-39
sp|Q21RV6|EFTU2_RHOFT Elongation factor Tu 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf2 PE=3 SV=1 78 471 2.0E-39
sp|A2CI56|EFTU_CHLAT Elongation factor Tu, chloroplastic OS=Chlorokybus atmophyticus GN=tufA PE=3 SV=1 78 471 2.0E-39
sp|B7IT17|EFTU_BACC2 Elongation factor Tu OS=Bacillus cereus (strain G9842) GN=tuf PE=3 SV=1 92 471 2.0E-39
sp|A4J0Z5|EFTU_DESRM Elongation factor Tu OS=Desulfotomaculum reducens (strain MI-1) GN=tuf PE=3 SV=1 82 473 2.0E-39
sp|A6X0A2|EFTU_OCHA4 Elongation factor Tu OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=tuf1 PE=3 SV=1 84 471 2.0E-39
sp|Q2IXR2|EFTU_RHOP2 Elongation factor Tu OS=Rhodopseudomonas palustris (strain HaA2) GN=tuf1 PE=3 SV=1 76 471 3.0E-39
sp|B7LXG3|CYSN_ECO8A Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O8 (strain IAI1) GN=cysN PE=3 SV=1 51 466 3.0E-39
sp|B7LEG9|CYSN_ECO55 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain 55989 / EAEC) GN=cysN PE=3 SV=1 51 466 3.0E-39
sp|P0DA83|EFTU_STRPQ Elongation factor Tu OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=tuf PE=3 SV=1 92 472 3.0E-39
sp|Q48UK5|EFTU_STRPM Elongation factor Tu OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=tuf PE=3 SV=2 92 472 3.0E-39
sp|A2RFQ4|EFTU_STRPG Elongation factor Tu OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=tuf PE=3 SV=1 92 472 3.0E-39
sp|Q1J7N4|EFTU_STRPF Elongation factor Tu OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=tuf PE=3 SV=2 92 472 3.0E-39
sp|Q1JHV6|EFTU_STRPD Elongation factor Tu OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=tuf PE=3 SV=2 92 472 3.0E-39
sp|Q1JMR3|EFTU_STRPC Elongation factor Tu OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=tuf PE=3 SV=2 92 472 3.0E-39
sp|Q5XD49|EFTU_STRP6 Elongation factor Tu OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=tuf PE=1 SV=2 92 472 3.0E-39
sp|P0DA82|EFTU_STRP3 Elongation factor Tu OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=tuf PE=3 SV=1 92 472 3.0E-39
sp|Q54HB2|EFTU_DICDI Elongation factor Tu, mitochondrial OS=Dictyostelium discoideum GN=tufm PE=1 SV=2 76 471 3.0E-39
sp|Q2JFH8|EFTU_FRASC Elongation factor Tu OS=Frankia sp. (strain CcI3) GN=tuf PE=3 SV=1 92 473 3.0E-39
sp|Q3MDM5|EFTU_ANAVT Elongation factor Tu OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tuf PE=3 SV=1 79 473 3.0E-39
sp|Q8YP63|EFTU_NOSS1 Elongation factor Tu OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tuf PE=1 SV=1 79 473 3.0E-39
sp|A0PXT1|EFTU_CLONN Elongation factor Tu OS=Clostridium novyi (strain NT) GN=tuf1 PE=3 SV=1 92 471 3.0E-39
sp|A1A0T1|EFTU_BIFAA Elongation factor Tu OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=tuf PE=3 SV=1 92 483 3.0E-39
sp|Q8E0H1|EFTU_STRA5 Elongation factor Tu OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=tuf PE=3 SV=1 92 472 3.0E-39
sp|Q8KT97|EFTU_RICFE Elongation factor Tu OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=tuf PE=3 SV=1 92 471 3.0E-39
sp|A4WVL0|EFTU_RHOS5 Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=tuf1 PE=3 SV=1 84 471 3.0E-39
sp|Q21SF0|EFTU1_RHOFT Elongation factor Tu 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf1 PE=3 SV=1 78 471 3.0E-39
sp|B8DLL9|EFTU_DESVM Elongation factor Tu OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=tuf PE=3 SV=1 76 471 4.0E-39
sp|B4U3U1|EFTU_STREM Elongation factor Tu OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=tuf PE=3 SV=1 92 472 4.0E-39
sp|Q8E645|EFTU_STRA3 Elongation factor Tu OS=Streptococcus agalactiae serotype III (strain NEM316) GN=tuf PE=3 SV=1 92 472 4.0E-39
sp|Q3K1U4|EFTU_STRA1 Elongation factor Tu OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=tuf PE=3 SV=1 92 472 4.0E-39
sp|B0RB36|EFTU_CLAMS Elongation factor Tu OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=tuf PE=3 SV=1 92 473 4.0E-39
sp|Q2II78|EFTU_ANADE Elongation factor Tu OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tuf1 PE=3 SV=1 76 471 4.0E-39
sp|A5FIJ9|EFTU_FLAJ1 Elongation factor Tu OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=tuf PE=3 SV=1 92 471 4.0E-39
sp|P72483|EFTU_STRMU Elongation factor Tu OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=tuf PE=3 SV=2 92 472 4.0E-39
sp|Q5ZYP5|EFTU_LEGPH Elongation factor Tu OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tuf1 PE=3 SV=1 84 471 4.0E-39
sp|A5IHR6|EFTU_LEGPC Elongation factor Tu OS=Legionella pneumophila (strain Corby) GN=tuf1 PE=3 SV=1 84 471 4.0E-39
sp|Q5X873|EFTU_LEGPA Elongation factor Tu OS=Legionella pneumophila (strain Paris) GN=tuf1 PE=3 SV=1 84 471 4.0E-39
sp|B9DRL9|EFTU_STRU0 Elongation factor Tu OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=tuf PE=3 SV=1 92 472 4.0E-39
sp|Q06J54|EFTU_BIGNA Elongation factor Tu, chloroplastic OS=Bigelowiella natans GN=tufA PE=3 SV=1 82 471 4.0E-39
sp|Q4G342|EFTU_EMIHU Elongation factor Tu, chloroplastic OS=Emiliania huxleyi GN=tufA PE=3 SV=1 84 471 4.0E-39
sp|B2UQY9|EFTU_AKKM8 Elongation factor Tu OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=tuf PE=3 SV=1 81 471 4.0E-39
sp|B1KSM7|EFTU_CLOBM Elongation factor Tu OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tuf1 PE=3 SV=1 82 473 5.0E-39
sp|B7N6Y1|CYSN_ECOLU Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysN PE=3 SV=1 51 466 5.0E-39
sp|P29544|EFTU3_STRRA Elongation factor Tu-3 OS=Streptomyces ramocissimus GN=tuf3 PE=3 SV=1 76 471 5.0E-39
sp|P42471|EFTU_BRELN Elongation factor Tu OS=Brevibacterium linens GN=tuf PE=3 SV=1 92 471 5.0E-39
sp|Q1XDK1|EFTU_PYRYE Elongation factor Tu, chloroplastic OS=Pyropia yezoensis GN=tufA PE=3 SV=1 81 473 5.0E-39
sp|Q2K9N2|EFTU1_RHIEC Elongation factor Tu 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tuf1 PE=3 SV=1 84 471 5.0E-39
sp|Q5WZL4|EFTU_LEGPL Elongation factor Tu OS=Legionella pneumophila (strain Lens) GN=tuf1 PE=3 SV=1 84 471 5.0E-39
sp|P42482|EFTU_WOLSU Elongation factor Tu OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tuf PE=3 SV=2 92 473 5.0E-39
sp|Q73IX6|EFTU1_WOLPM Elongation factor Tu 1 OS=Wolbachia pipientis wMel GN=tuf1 PE=3 SV=1 84 471 5.0E-39
sp|B3ETZ7|EFTU_AMOA5 Elongation factor Tu OS=Amoebophilus asiaticus (strain 5a2) GN=tuf PE=3 SV=1 92 471 5.0E-39
sp|B7UHH0|CYSN_ECO27 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysN PE=3 SV=1 51 466 6.0E-39
sp|A7GZK6|EFTU_CAMC5 Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 92 471 6.0E-39
sp|B5RDQ7|CYSN_SALG2 Sulfate adenylyltransferase subunit 1 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysN PE=3 SV=1 51 476 6.0E-39
sp|Q73H85|EFTU2_WOLPM Elongation factor Tu 2 OS=Wolbachia pipientis wMel GN=tuf2 PE=3 SV=1 84 471 6.0E-39
sp|A8A3N0|CYSN_ECOHS Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O9:H4 (strain HS) GN=cysN PE=3 SV=1 51 466 6.0E-39
sp|Q1R7U0|CYSN_ECOUT Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=cysN PE=3 SV=1 51 466 6.0E-39
sp|Q8FEJ1|CYSN_ECOL6 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysN PE=3 SV=1 51 466 6.0E-39
sp|A1AEU5|CYSN_ECOK1 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O1:K1 / APEC GN=cysN PE=3 SV=1 51 466 6.0E-39
sp|B7MKM5|CYSN_ECO45 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysN PE=3 SV=1 51 466 6.0E-39
sp|P64025|EFTU_BRUSU Elongation factor Tu OS=Brucella suis biovar 1 (strain 1330) GN=tufA PE=3 SV=1 84 471 6.0E-39
sp|A5VR08|EFTU_BRUO2 Elongation factor Tu OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=tuf1 PE=3 SV=1 84 471 6.0E-39
sp|P64024|EFTU_BRUME Elongation factor Tu OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=tufA PE=3 SV=1 84 471 6.0E-39
sp|A9M5Q2|EFTU_BRUC2 Elongation factor Tu OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=tuf1 PE=3 SV=1 84 471 6.0E-39
sp|Q2YM08|EFTU_BRUA2 Elongation factor Tu OS=Brucella abortus (strain 2308) GN=tuf1 PE=3 SV=1 84 471 6.0E-39
sp|Q605B0|EFTU_METCA Elongation factor Tu OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tuf1 PE=3 SV=1 42 471 7.0E-39
sp|Q3YYB1|CYSN_SHISS Sulfate adenylyltransferase subunit 1 OS=Shigella sonnei (strain Ss046) GN=cysN PE=3 SV=1 51 466 7.0E-39
sp|B1LQ72|CYSN_ECOSM Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysN PE=3 SV=1 51 466 7.0E-39
sp|P23845|CYSN_ECOLI Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12) GN=cysN PE=1 SV=1 51 466 7.0E-39
sp|Q0TEA7|CYSN_ECOL5 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysN PE=3 SV=1 51 466 7.0E-39
sp|B1XCS7|CYSN_ECODH Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / DH10B) GN=cysN PE=3 SV=1 51 466 7.0E-39
sp|C4ZZQ5|CYSN_ECOBW Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysN PE=3 SV=1 51 466 7.0E-39
sp|B7MZ52|CYSN_ECO81 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O81 (strain ED1a) GN=cysN PE=3 SV=1 51 466 7.0E-39
sp|B7NT95|CYSN_ECO7I Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysN PE=3 SV=1 51 466 7.0E-39
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0001883 purine nucleoside binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032549 ribonucleoside binding No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032561 guanyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0001882 nucleoside binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1799
LLFVSHTRFKHPTCDFLQPWSSNPHDFNFYTSSTAKMGKDDKTHINVVVIGCSTTTGHLIYQCGGIDKRTIEKFE
KEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAA
GTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTTQWSEARFQEIIKETSNFIKKVGYNPKTVPFVPISG
FHGDNMLAASANCPWYKGWEKEVKSGKSTGKTLLEAIDSIEPPKRPVDKPLRLPLQDVYKIGGIGTVPVGRIETG
ILKPGMVVTFAPSNVTTEVKSVEMHHEQLTEGVPGDNVGFNVKNVSVKEIRRGNVAGDSKNDPPLGAASFDAQVI
VLNHPGQVGAGYAPVLDCHTAHIACKFAEIKEKIDRRTGKAVETAPKFIKSGDSAIVKMVPSKPMCVEAFTDYPP
LGRFAVRDMRQTVAVGVIKSVEKAAAGSGKVTKSAAKAAKK*
Coding >Hirsu2|1799
CTGCTCTTCGTCTCGCATACCCGGTTCAAGCATCCGACCTGCGATTTTCTTCAACCTTGGTCAAGCAATCCACAC
GACTTCAACTTCTACACCTCATCCACCGCCAAAATGGGTAAGGACGACAAGACTCACATCAACGTGGTCGTCATC
GGGTGCTCGACCACCACCGGCCACTTGATCTACCAGTGCGGTGGTATCGACAAGCGAACCATCGAGAAGTTCGAG
AAGGAAGCCGCCGAACTCGGCAAGGGTTCCTTCAAGTACGCGTGGGTTCTTGACAAGCTCAAGGCCGAGCGTGAG
CGTGGTATCACCATCGACATTGCCCTCTGGAAGTTCGAGACTCCCAAGTACTATGTCACCGTTATTGACGCTCCC
GGCCACCGTGATTTCATCAAGAACATGATCACTGGTACCTCCCAGGCCGACTGCGCTATCCTCATCATCGCCGCC
GGCACTGGTGAGTTCGAGGCTGGTATCTCCAAGGATGGCCAGACTCGTGAGCACGCTCTGCTCGCCTACACCCTG
GGTGTCAAGCAGCTCATCGTCGCCATCAACAAGATGGACACGACCCAGTGGTCCGAGGCCCGTTTCCAGGAAATC
ATCAAGGAGACGTCCAACTTCATCAAGAAGGTTGGCTACAACCCCAAGACGGTCCCCTTCGTCCCCATCTCCGGC
TTCCACGGCGACAACATGTTGGCCGCCTCTGCCAACTGCCCCTGGTACAAGGGCTGGGAGAAGGAGGTCAAGAGC
GGCAAGTCGACCGGCAAGACGCTCCTGGAGGCCATCGACTCCATCGAGCCCCCCAAGCGCCCCGTCGACAAGCCG
CTCCGCCTTCCCCTCCAGGATGTCTACAAGATCGGCGGTATCGGAACTGTTCCCGTCGGCCGTATCGAGACTGGT
ATCCTGAAGCCCGGCATGGTCGTCACCTTCGCCCCCTCCAACGTCACCACTGAAGTCAAGTCGGTCGAGATGCAC
CACGAGCAGCTGACCGAGGGTGTTCCTGGCGACAACGTCGGCTTCAACGTCAAGAACGTCTCCGTCAAGGAGATC
CGTCGTGGCAACGTCGCCGGTGACTCCAAGAACGACCCCCCTCTGGGCGCCGCCTCCTTCGATGCCCAGGTCATC
GTCCTCAACCACCCCGGCCAGGTCGGTGCCGGTTACGCCCCCGTCCTCGACTGCCACACTGCCCACATCGCCTGC
AAGTTCGCCGAGATCAAGGAGAAGATCGACCGCCGTACCGGCAAGGCTGTCGAGACGGCCCCCAAGTTCATCAAG
TCTGGTGACTCGGCCATCGTCAAGATGGTTCCCTCCAAGCCCATGTGCGTCGAGGCCTTCACCGACTACCCTCCC
CTGGGCCGCTTCGCCGTCCGCGACATGCGCCAGACCGTCGCCGTCGGCGTCATCAAGTCGGTCGAGAAGGCCGCC
GCCGGCTCCGGCAAGGTCACCAAGTCGGCTGCCAAGGCTGCCAAGAAATAG
Transcript >Hirsu2|1799
CTGCTCTTCGTCTCGCATACCCGGTTCAAGCATCCGACCTGCGATTTTCTTCAACCTTGGTCAAGCAATCCACAC
GACTTCAACTTCTACACCTCATCCACCGCCAAAATGGGTAAGGACGACAAGACTCACATCAACGTGGTCGTCATC
GGGTGCTCGACCACCACCGGCCACTTGATCTACCAGTGCGGTGGTATCGACAAGCGAACCATCGAGAAGTTCGAG
AAGGAAGCCGCCGAACTCGGCAAGGGTTCCTTCAAGTACGCGTGGGTTCTTGACAAGCTCAAGGCCGAGCGTGAG
CGTGGTATCACCATCGACATTGCCCTCTGGAAGTTCGAGACTCCCAAGTACTATGTCACCGTTATTGACGCTCCC
GGCCACCGTGATTTCATCAAGAACATGATCACTGGTACCTCCCAGGCCGACTGCGCTATCCTCATCATCGCCGCC
GGCACTGGTGAGTTCGAGGCTGGTATCTCCAAGGATGGCCAGACTCGTGAGCACGCTCTGCTCGCCTACACCCTG
GGTGTCAAGCAGCTCATCGTCGCCATCAACAAGATGGACACGACCCAGTGGTCCGAGGCCCGTTTCCAGGAAATC
ATCAAGGAGACGTCCAACTTCATCAAGAAGGTTGGCTACAACCCCAAGACGGTCCCCTTCGTCCCCATCTCCGGC
TTCCACGGCGACAACATGTTGGCCGCCTCTGCCAACTGCCCCTGGTACAAGGGCTGGGAGAAGGAGGTCAAGAGC
GGCAAGTCGACCGGCAAGACGCTCCTGGAGGCCATCGACTCCATCGAGCCCCCCAAGCGCCCCGTCGACAAGCCG
CTCCGCCTTCCCCTCCAGGATGTCTACAAGATCGGCGGTATCGGAACTGTTCCCGTCGGCCGTATCGAGACTGGT
ATCCTGAAGCCCGGCATGGTCGTCACCTTCGCCCCCTCCAACGTCACCACTGAAGTCAAGTCGGTCGAGATGCAC
CACGAGCAGCTGACCGAGGGTGTTCCTGGCGACAACGTCGGCTTCAACGTCAAGAACGTCTCCGTCAAGGAGATC
CGTCGTGGCAACGTCGCCGGTGACTCCAAGAACGACCCCCCTCTGGGCGCCGCCTCCTTCGATGCCCAGGTCATC
GTCCTCAACCACCCCGGCCAGGTCGGTGCCGGTTACGCCCCCGTCCTCGACTGCCACACTGCCCACATCGCCTGC
AAGTTCGCCGAGATCAAGGAGAAGATCGACCGCCGTACCGGCAAGGCTGTCGAGACGGCCCCCAAGTTCATCAAG
TCTGGTGACTCGGCCATCGTCAAGATGGTTCCCTCCAAGCCCATGTGCGTCGAGGCCTTCACCGACTACCCTCCC
CTGGGCCGCTTCGCCGTCCGCGACATGCGCCAGACCGTCGCCGTCGGCGTCATCAAGTCGGTCGAGAAGGCCGCC
GCCGGCTCCGGCAAGGTCACCAAGTCGGCTGCCAAGGCTGCCAAGAAATAG
Gene >Hirsu2|1799
CTGCTCTTCGTCTCGCATACCCGGTTCAAGCATCCGACCTGCGATTTTCGTAAGTGGCCTCCATCTCGCGACGCC
TTCTTGGCCCTGATCCCTTCAACCATCTCCGTCTTCATCTCCACCCTCATCGCCTTCTTTCTCTGAACCCTCCTC
CTCCCGTCTCACGATCCAAACATCGTCGACTGACCGCCAGCCGTTACAGTTCAACCTTGGTCAAGCAATCCACAC
GACTTCAACTTCTACACCTCATCCACCGCCAAAATGGGGTATGCCGGCCATCGCTCGCCTTCGACTGCTACAGAG
CGTACTGACCGCGTCGCAGTAAGGACGACAAGACTCACATCAACGTGGTCGTCATCGTATGTTGCCCCTCGCCGC
TCGCTACCCCGCCATCCGCTGCCGTCCGCCCACTGACTGAATCTCCCAGGGGTGCGTCAATAAACAAGGCTGCTG
CTGTCCTCGGCCAGGGTTCTCGTGCTGACCCATGATAACAGCCACGTCGACTCTGGCAAGTCGACCACCGTGAGT
ATTTGCCCTGCTACCCCCGCCGCTGCAACTTTCGGTTCGCGGTGCCCCGCAAGGCCTCCTGTACTGACACAAAAG
ACAGACCGGCCACTTGATCTACCAGTGCGGTGGTATCGACAAGCGAACCATCGAGAAGTTCGAGAAGGTAGGTGA
TATTTTCCTCTGCCAGCAACATTTTCGTTTGCATTTTTGCCTGTGCGCGACATTGGTGGCTCGCCTGCGCCTCAC
GGTCCATGGCGCCCGCTGCGCTACCCCTCCTCGCGCCCGAGCAAAAAATTTTCTCGCCCGCCTCCCTGCCTTTTT
TTTCGGGCAGGGCGGGGCTTCTCTACCCCGCCACTCTCTACCCTGACCACTTCACTGCAAACGCTCGACCCCTCC
CGACCCCTTGCCGTCGTGGTCTGAGACACTGTACCCCCTCTCGCACGGGCGAAAAAAATCCCAGACGATGATTGG
TGGAATACGAGCTGACGGGACTGGAATGACAGGAAGCCGCCGAACTCGGCAAGGGTTCCTTCAAGTACGCGTGGG
TTCTTGACAAGCTCAAGGCCGAGCGTGAGCGTGGTATCACCATCGACATTGCCCTCTGGAAGTTCGAGACTCCCA
AGTACTATGTCACCGTTATTGGTACGTCAAGGCCGCGCGCCCCTCTCTTGCCTTGGTCCGCGACGGCCAGGCTGA
CCTCTCGCCCGCAGACGCTCCCGGCCACCGTGATTTCATCAAGAACATGATCACTGGTACCTCCCAGGCCGACTG
CGCTATCCTCATCATCGCCGCCGGCACTGGTGAGTTCGAGGCTGGTATCTCCAAGGATGGCCAGACTCGTGAGCA
CGCTCTGCTCGCCTACACCCTGGGTGTCAAGCAGCTCATCGTCGCCATCAACAAGATGGACACGACCCAGTGGTC
CGAGGCCCGTTTCCAGGAAATCATCAAGGAGACGTCCAACTTCATCAAGAAGGTTGGCTACAACCCCAAGACGGT
CCCCTTCGTCCCCATCTCCGGCTTCCACGGCGACAACATGTTGGCCGCCTCTGCCAACTGCCCCTGGTACAAGGG
CTGGGAGAAGGAGGTCAAGAGCGGCAAGTCGACCGGCAAGACGCTCCTGGAGGCCATCGACTCCATCGAGCCCCC
CAAGCGCCCCGTCGACAAGCCGCTCCGCCTTCCCCTCCAGGATGTCTACAAGATCGGCGGTATCGGAACTGTTCC
CGTCGGCCGTATCGAGACTGGTATCCTGAAGCCCGGCATGGTCGTCACCTTCGCCCCCTCCAACGTCACCACTGA
AGTCAAGTCGGTCGAGATGCACCACGAGCAGCTGACCGAGGGTGTTCCTGGCGACAACGTCGGCTTCAACGTCAA
GAACGTCTCCGTCAAGGAGATCCGTCGTGGCAACGTCGCCGGTGACTCCAAGAACGACCCCCCTCTGGGCGCCGC
CTCCTTCGATGCCCAGGTCATCGTCCTCAACCACCCCGGCCAGGTCGGTGCCGGTTACGCCCCCGTCCTCGACTG
CCACACTGCCCACATCGCCTGCAAGTTCGCCGAGATCAAGGAGAAGATCGACCGCCGTACCGGCAAGGCTGTCGA
GACGGCCCCCAAGTTCATCAAGTCTGGTGACTCGGCCATCGTCAAGATGGTTCCCTCCAAGCCCATGTGCGTCGA
GGCCTTCACCGACTACCCTCCCCTGGGCCGCTTCGCCGTCCGCGACATGCGCCAGACCGTCGCCGTCGGCGTCAT
CAAGTCGGTCGAGAAGGCCGCCGCCGGCTCCGGCAAGGTCACCAAGTCGGCTGCCAAGGCTGCCAAGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail