Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1794
Gene name
LocationContig_1404:3152..4452
Strand-
Gene length (bp)1300
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12400 STIMATE STIMATE family 7.4E-41 178 305

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12042|YP162_YEAST Vacuolar membrane protein YPL162C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL162C PE=1 SV=1 82 338 2.0E-33
sp|Q86TL2|STIMA_HUMAN Store-operated calcium entry regulator STIMATE OS=Homo sapiens GN=TMEM110 PE=1 SV=1 83 367 2.0E-30
sp|Q3UF25|STIMA_MOUSE Store-operated calcium entry regulator STIMATE OS=Mus musculus GN=Tmem110 PE=2 SV=1 83 367 1.0E-28
sp|Q7TSW6|STIMA_RAT Store-operated calcium entry regulator STIMATE OS=Rattus norvegicus GN=Tmem110 PE=2 SV=1 83 367 1.0E-28

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 87 109 22
2 122 144 22
3 180 202 22
4 238 260 22
5 280 299 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1794
MQPPSLAVAAVNDAVASLSSGAASAAASTPASAALETAATAVATALASAAASAAVSATSSSAAAAAAATSASDGS
PTHEEPQGECRLLGSFALLVQAALGALALLSLVYKRWRERPQRPVKIWFFDVSKQVFGSVLVHIANIFMSMLTSG
RFSIGLEPAVTQRLLARGEDDVYVPNPCSFYLLNLAIDTTLGIPILILLLRILTGLAAMTTFGKPFESIQSGHYG
NPPNAWWWLKQSIIYFGGLFGMKLCVLIIFLLMPWISKVGDWALGWTEGNERLQIAFVMMIFPLVMNGLQYYIID
SFIKKKETEHEHLPSEDPDEARRRYDDRGTHLRGHGPDGESDGGDGGDDGQDERRTKPAGPAKPGHRTRRSAEGE
YDPEVDGDAPTIIGSSSSRRIQRAKAGGGADPFPKD*
Coding >Hirsu2|1794
ATGCAGCCTCCGTCGCTCGCCGTCGCCGCCGTCAACGATGCCGTCGCCTCCTTGAGCTCCGGGGCGGCCTCGGCT
GCAGCCTCGACGCCCGCATCCGCCGCCTTGGAGACGGCAGCGACGGCCGTGGCAACCGCTCTCGCCTCCGCCGCC
GCCTCCGCCGCCGTCTCCGCCACCTCCTCCTCCGCCGCCGCCGCCGCCGCCGCCACCTCCGCATCCGACGGGAGC
CCGACACATGAAGAGCCGCAGGGCGAGTGCCGCCTGCTCGGCTCGTTTGCCCTGCTCGTCCAGGCCGCTCTCGGC
GCCCTCGCCCTGCTCTCCCTGGTCTACAAGCGCTGGCGGGAGAGGCCCCAGCGGCCCGTCAAGATCTGGTTCTTC
GACGTCTCCAAGCAGGTCTTCGGCTCCGTCCTCGTCCACATTGCCAACATCTTCATGTCCATGTTGACCAGCGGC
CGCTTCTCCATCGGCTTGGAGCCCGCCGTGACCCAGCGGCTGCTGGCGCGGGGCGAAGACGACGTCTACGTCCCC
AACCCCTGCTCCTTCTATCTCCTCAACCTGGCCATCGATACCACCCTCGGCATCCCCATCCTCATCCTCCTGCTG
CGCATCCTGACCGGGCTGGCGGCCATGACGACGTTCGGGAAGCCCTTCGAGTCCATCCAGTCCGGCCACTACGGC
AACCCCCCCAATGCCTGGTGGTGGCTCAAGCAGTCCATCATCTACTTCGGCGGCCTCTTCGGCATGAAGCTCTGC
GTCCTCATCATCTTCCTCCTCATGCCCTGGATCTCCAAGGTCGGCGACTGGGCCCTCGGGTGGACCGAGGGCAAC
GAGAGGCTGCAGATCGCCTTCGTCATGATGATCTTCCCCCTCGTCATGAACGGCCTGCAGTATTACATCATCGAC
TCCTTCATCAAGAAGAAGGAGACGGAGCACGAGCACCTACCGTCCGAAGACCCGGACGAGGCTCGCCGGCGCTAC
GACGACCGAGGCACGCACCTGCGAGGCCACGGCCCCGACGGCGAAAGCGACGGCGGCGACGGCGGCGACGACGGC
CAGGACGAGCGTCGCACCAAGCCCGCCGGGCCCGCCAAGCCGGGCCACCGGACCCGCCGCAGCGCCGAGGGCGAG
TACGACCCGGAAGTGGACGGCGACGCGCCCACCATCATCGGCAGCAGCTCCAGCCGCCGCATCCAGCGGGCCAAG
GCCGGCGGCGGCGCCGACCCCTTCCCCAAGGACTAG
Transcript >Hirsu2|1794
ATGCAGCCTCCGTCGCTCGCCGTCGCCGCCGTCAACGATGCCGTCGCCTCCTTGAGCTCCGGGGCGGCCTCGGCT
GCAGCCTCGACGCCCGCATCCGCCGCCTTGGAGACGGCAGCGACGGCCGTGGCAACCGCTCTCGCCTCCGCCGCC
GCCTCCGCCGCCGTCTCCGCCACCTCCTCCTCCGCCGCCGCCGCCGCCGCCGCCACCTCCGCATCCGACGGGAGC
CCGACACATGAAGAGCCGCAGGGCGAGTGCCGCCTGCTCGGCTCGTTTGCCCTGCTCGTCCAGGCCGCTCTCGGC
GCCCTCGCCCTGCTCTCCCTGGTCTACAAGCGCTGGCGGGAGAGGCCCCAGCGGCCCGTCAAGATCTGGTTCTTC
GACGTCTCCAAGCAGGTCTTCGGCTCCGTCCTCGTCCACATTGCCAACATCTTCATGTCCATGTTGACCAGCGGC
CGCTTCTCCATCGGCTTGGAGCCCGCCGTGACCCAGCGGCTGCTGGCGCGGGGCGAAGACGACGTCTACGTCCCC
AACCCCTGCTCCTTCTATCTCCTCAACCTGGCCATCGATACCACCCTCGGCATCCCCATCCTCATCCTCCTGCTG
CGCATCCTGACCGGGCTGGCGGCCATGACGACGTTCGGGAAGCCCTTCGAGTCCATCCAGTCCGGCCACTACGGC
AACCCCCCCAATGCCTGGTGGTGGCTCAAGCAGTCCATCATCTACTTCGGCGGCCTCTTCGGCATGAAGCTCTGC
GTCCTCATCATCTTCCTCCTCATGCCCTGGATCTCCAAGGTCGGCGACTGGGCCCTCGGGTGGACCGAGGGCAAC
GAGAGGCTGCAGATCGCCTTCGTCATGATGATCTTCCCCCTCGTCATGAACGGCCTGCAGTATTACATCATCGAC
TCCTTCATCAAGAAGAAGGAGACGGAGCACGAGCACCTACCGTCCGAAGACCCGGACGAGGCTCGCCGGCGCTAC
GACGACCGAGGCACGCACCTGCGAGGCCACGGCCCCGACGGCGAAAGCGACGGCGGCGACGGCGGCGACGACGGC
CAGGACGAGCGTCGCACCAAGCCCGCCGGGCCCGCCAAGCCGGGCCACCGGACCCGCCGCAGCGCCGAGGGCGAG
TACGACCCGGAAGTGGACGGCGACGCGCCCACCATCATCGGCAGCAGCTCCAGCCGCCGCATCCAGCGGGCCAAG
GCCGGCGGCGGCGCCGACCCCTTCCCCAAGGACTAG
Gene >Hirsu2|1794
ATGCAGCCTCCGTCGCTCGCCGTCGCCGCCGTCAACGATGCCGTCGCCTCCTTGAGCTCCGGGGCGGCCTCGGCT
GCAGCCTCGACGCCCGCATCCGCCGCCTTGGAGACGGCAGCGACGGCCGTGGCAACCGCTCTCGCCTCCGCCGCC
GCCTCCGCCGCCGTCTCCGCCACCTCCTCCTCCGCCGCCGCCGCCGCCGCCGCCACCTCCGCATCCGACGGGAGC
CCGACACATGAAGAGCCGCAGGGCGAGTGCCGCCTGCTCGGCTCGTTTGCCCTGCTCGTCCAGGCCGCTCTCGGC
GCCCTCGCCCTGCTCTCCCTGGTCTACAAGCGCTGGCGGGAGAGGCCCCAGCGGCCCGTCAAGATCTGGTTCTTC
GACGTCTCCAAGCAGGTCTTCGGCTCCGTCCTCGTCCACATTGCCAACATCTTCATGTCCATGTTGACCAGCGGC
CGCTTCTCCATCGGCTTGGAGCCCGCCGTGACCCAGCGGCTGCTGGCGCGGGGCGAAGACGACGTCTACGTCCCC
AACCCCTGCTCCTTCTATCTCCTCAACCTGGCCATCGATGTGAGTTGTCGGCCGAAGCCTCCCCGGCCGAGCCGT
CCGTGTCGTCCCTCTAACGCCGCGTCAGACCACCCTCGGCATCCCCATCCTCATCCTCCTGCTGCGCATCCTGAC
CGGGCTGGCGGCCATGACGACGTTCGGGAAGCCCTTCGAGTCCATCCAGTCCGGCCACTACGGCAACCCCCCCAA
TGCCTGGTGGTGGCTCAAGCAGTCCATCATCTACTTCGGCGGCCTCTTCGGCATGAAGCTCTGCGTCCTCATCAT
CTTCCTCCTCATGCCCTGGATCTCCAAGGTCGGCGACTGGGCCCTCGGGTGGACCGAGGGCAACGAGAGGCTGCA
GATCGCCTTCGTCATGATGATCTTCCCCCTCGTCATGAACGGCCTGCAGTATTACATCATCGACTCCTTCATCAA
GAAGAAGGAGACGGAGCACGAGCACCTACCGTCCGAAGACCCGGACGAGGCTCGCCGGCGCTACGACGACCGAGG
CACGCACCTGCGAGGCCACGGCCCCGACGGCGAAAGCGACGGCGGCGACGGCGGCGACGACGGCCAGGACGAGCG
TCGCACCAAGCCCGCCGGGCCCGCCAAGCCGGGCCACCGGACCCGCCGCAGCGCCGAGGGCGAGTACGACCCGGA
AGTGGACGGCGACGCGCCCACCATCATCGGCAGCAGCTCCAGCCGCCGCATCCAGCGGGCCAAGGCCGGCGGCGG
CGCCGACCCCTTCCCCAAGGACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail