Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1790
Gene name
LocationContig_1403:1748..2894
Strand+
Gene length (bp)1146
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 5.1E-25 109 257

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 23 260 7.0E-50
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 36 287 1.0E-48
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 34 269 2.0E-40
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 34 269 2.0E-39
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 66 279 3.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 23 260 7.0E-50
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 36 287 1.0E-48
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 34 269 2.0E-40
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 34 269 2.0E-39
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 66 279 3.0E-39
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 34 269 1.0E-38
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 34 269 1.0E-38
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 26 269 3.0E-35
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 27 269 3.0E-34
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 47 303 8.0E-34
sp|Q54PR7|Y4367_DICDI PA-phosphatase related-family protein DDB_G0284367 OS=Dictyostelium discoideum GN=DDB_G0284367 PE=3 SV=1 37 271 1.0E-26
sp|Q0WNG6|LPP4_ARATH Probable lipid phosphate phosphatase 4 OS=Arabidopsis thaliana GN=LPP4 PE=2 SV=1 24 258 8.0E-26
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 35 266 5.0E-21
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 35 266 5.0E-18
sp|Q3SZE3|PLPP3_BOVIN Phospholipid phosphatase 3 OS=Bos taurus GN=PLPP3 PE=2 SV=1 43 249 9.0E-14
sp|O14495|PLPP3_HUMAN Phospholipid phosphatase 3 OS=Homo sapiens GN=PLPP3 PE=1 SV=1 33 249 2.0E-13
sp|Q04396|LPP1_YEAST Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPP1 PE=1 SV=1 104 264 4.0E-13
sp|Q99JY8|PLPP3_MOUSE Phospholipid phosphatase 3 OS=Mus musculus GN=Plpp3 PE=1 SV=1 43 249 7.0E-13
sp|P97544|PLPP3_RAT Phospholipid phosphatase 3 OS=Rattus norvegicus GN=Plpp3 PE=1 SV=1 43 249 1.0E-12
sp|O88956|PLPP1_CAVPO Phospholipid phosphatase 1 OS=Cavia porcellus GN=PLPP1 PE=2 SV=1 50 249 3.0E-12
sp|Q9V576|WUN_DROME Putative phosphatidate phosphatase OS=Drosophila melanogaster GN=wun PE=1 SV=2 111 245 1.0E-11
sp|O08564|PLPP1_RAT Phospholipid phosphatase 1 OS=Rattus norvegicus GN=Plpp1 PE=1 SV=1 31 249 4.0E-11
sp|Q7TMB7|LPPR4_RAT Lipid phosphate phosphatase-related protein type 4 OS=Rattus norvegicus GN=Lppr4 PE=1 SV=1 42 251 8.0E-11
sp|Q61469|PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus GN=Plpp1 PE=1 SV=1 29 249 9.0E-11
sp|Q7Z2D5|LPPR4_HUMAN Lipid phosphate phosphatase-related protein type 4 OS=Homo sapiens GN=LPPR4 PE=1 SV=1 42 251 2.0E-10
sp|Q7TME0|LPPR4_MOUSE Lipid phosphate phosphatase-related protein type 4 OS=Mus musculus GN=Lppr4 PE=1 SV=2 42 251 3.0E-10
sp|O14494|PLPP1_HUMAN Phospholipid phosphatase 1 OS=Homo sapiens GN=PLPP1 PE=1 SV=1 29 249 5.0E-10
sp|Q2HJ61|PLPP2_BOVIN Phospholipid phosphatase 2 OS=Bos taurus GN=PLPP2 PE=2 SV=1 50 249 2.0E-09
sp|Q9DAX2|PLPP2_MOUSE Phospholipid phosphatase 2 OS=Mus musculus GN=Plpp2 PE=1 SV=1 40 249 5.0E-09
sp|O43688|PLPP2_HUMAN Phospholipid phosphatase 2 OS=Homo sapiens GN=PLPP2 PE=1 SV=1 51 249 1.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 75 97 22
3 104 121 17
4 178 200 22
5 207 226 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1790
MASSRRGRSVSASRRIPSSLARFWKTTHAPDYAGLLLLLIAWILVAKLVTPFHRMFSINDLKISFPHAVHERVPV
PMVLVYAFLVPLGVFIGYGLLYRPSVAKLEVTFLSFVVAAVLTGFLTDVVKNAVGRPRPDLLDRCRPAPNTQPNV
LVTIDVCTTPGDNSLHDGWRSFPSGHSSFSFAGLGFLSLFLAGQLRLFCYAAGGRDLTRALLCMLPLVGALLIAI
SRCEDYRHDVYDVCVGSALGMTVAYWSYRRHWPSLSSPECHEPYPRPGSEAKTRWSRVRDEEEAGAHAVSGYELT
HVRATDRAVN*
Coding >Hirsu2|1790
ATGGCCTCAAGCCGGAGAGGCCGGTCCGTCTCGGCCAGCAGACGCATCCCGTCTTCGCTGGCCAGGTTCTGGAAG
ACGACTCACGCGCCCGACTACGCCGGCCTGCTGCTCCTGCTGATCGCTTGGATCCTCGTGGCGAAGCTTGTCACG
CCCTTTCACCGCATGTTCTCCATCAACGACCTCAAAATCTCCTTTCCCCATGCGGTCCATGAGCGCGTCCCTGTT
CCCATGGTCCTGGTCTACGCGTTCCTGGTCCCGCTGGGCGTCTTCATCGGCTACGGCCTCCTGTACCGTCCCTCG
GTAGCCAAGCTCGAGGTCACCTTCCTCTCCTTCGTCGTCGCCGCCGTGCTCACCGGCTTCCTGACCGACGTGGTC
AAGAACGCGGTCGGGAGACCTCGCCCGGACCTGCTGGACCGCTGCCGGCCGGCGCCCAACACCCAGCCCAATGTG
CTGGTGACCATCGATGTGTGCACCACGCCCGGCGACAACTCGCTGCACGACGGCTGGCGCTCGTTCCCCTCCGGC
CACTCGTCCTTCTCCTTTGCCGGCCTCGGCTTCCTGAGCCTGTTCCTCGCCGGGCAGCTTCGCCTGTTTTGCTAC
GCGGCCGGCGGACGAGACCTGACCCGGGCCCTGCTTTGCATGCTGCCACTTGTCGGCGCCCTGCTAATCGCCATC
TCGCGATGCGAGGACTACCGCCACGACGTGTACGATGTTTGCGTCGGGTCGGCCCTGGGCATGACCGTCGCCTAC
TGGAGCTACAGGAGACACTGGCCGAGCTTGTCCAGTCCCGAGTGCCACGAGCCGTATCCGCGGCCAGGCTCCGAG
GCCAAGACGAGATGGTCTCGGGTCAGGGACGAGGAGGAGGCCGGGGCTCACGCAGTATCGGGGTACGAGCTGACT
CATGTACGAGCCACCGACCGGGCAGTGAATTGA
Transcript >Hirsu2|1790
ATGGCCTCAAGCCGGAGAGGCCGGTCCGTCTCGGCCAGCAGACGCATCCCGTCTTCGCTGGCCAGGTTCTGGAAG
ACGACTCACGCGCCCGACTACGCCGGCCTGCTGCTCCTGCTGATCGCTTGGATCCTCGTGGCGAAGCTTGTCACG
CCCTTTCACCGCATGTTCTCCATCAACGACCTCAAAATCTCCTTTCCCCATGCGGTCCATGAGCGCGTCCCTGTT
CCCATGGTCCTGGTCTACGCGTTCCTGGTCCCGCTGGGCGTCTTCATCGGCTACGGCCTCCTGTACCGTCCCTCG
GTAGCCAAGCTCGAGGTCACCTTCCTCTCCTTCGTCGTCGCCGCCGTGCTCACCGGCTTCCTGACCGACGTGGTC
AAGAACGCGGTCGGGAGACCTCGCCCGGACCTGCTGGACCGCTGCCGGCCGGCGCCCAACACCCAGCCCAATGTG
CTGGTGACCATCGATGTGTGCACCACGCCCGGCGACAACTCGCTGCACGACGGCTGGCGCTCGTTCCCCTCCGGC
CACTCGTCCTTCTCCTTTGCCGGCCTCGGCTTCCTGAGCCTGTTCCTCGCCGGGCAGCTTCGCCTGTTTTGCTAC
GCGGCCGGCGGACGAGACCTGACCCGGGCCCTGCTTTGCATGCTGCCACTTGTCGGCGCCCTGCTAATCGCCATC
TCGCGATGCGAGGACTACCGCCACGACGTGTACGATGTTTGCGTCGGGTCGGCCCTGGGCATGACCGTCGCCTAC
TGGAGCTACAGGAGACACTGGCCGAGCTTGTCCAGTCCCGAGTGCCACGAGCCGTATCCGCGGCCAGGCTCCGAG
GCCAAGACGAGATGGTCTCGGGTCAGGGACGAGGAGGAGGCCGGGGCTCACGCAGTATCGGGGTACGAGCTGACT
CATGTACGAGCCACCGACCGGGCAGTGAATTGA
Gene >Hirsu2|1790
ATGGCCTCAAGCCGGAGAGGCCGGTCCGTCTCGGCCAGCAGACGCATCCCGTCTTCGCTGGCCAGGTTCTGGAAG
GTCGGCCCCCTTTGCCTCCCGCCGTTGCGGCCGGCACTCACTCACGGCTCGGCCAGACGACTCACGCGCCCGACT
ACGCCGGCCTGCTGCTCCTGCTGATCGCTTGGATCCTCGTGAGCCTTGCCCTCCCCCCTTTTGCGCCCTCAGTCG
GCGGCCTGTGGCTGAAGCCTGTGTCACGCCCAGGTGGCGAAGCTTGTCACGCCCTTTCACCGCATGTTCTCCATC
AACGACCTCAAAATCTCCTTTCCCCATGCGGTCCATGAGCGCGTCCCTGTTCGTACGTTGTCTCCCTTCTCCCCC
GCCCTCCCTCGGATCCGATGTGACGAATGACGAGCGCGAGAAAGCTGACTGCCTTCCCTCGTAGCCATGGTCCTG
GTCTACGCGTTCCTGGTCCCGCTGGGCGTCTTCATCGGCTACGGCCTCCTGTACCGTCCCTCGGTAGCCAAGCTC
GAGGTCACCTTCCTCTCCTTCGTCGTCGCCGCCGTGCTCACCGGCTTCCTGACCGACGTGGTCAAGAACGCGGTC
GGGAGACCTCGCCCGGACCTGCTGGACCGCTGCCGGCCGGCGCCCAACACCCAGCCCAATGTGCTGGTGACCATC
GATGTGTGCACCACGCCCGGCGACAACTCGCTGCACGACGGCTGGCGCTCGTTCCCCTCCGGCCACTCGTCCTTC
TCCTTTGCCGGCCTCGGCTTCCTGAGCCTGTTCCTCGCCGGGCAGCTTCGCCTGTTTTGCTACGCGGCCGGCGGA
CGAGACCTGACCCGGGCCCTGCTTTGCATGCTGCCACTTGTCGGCGCCCTGCTAATCGCCATCTCGCGATGCGAG
GACTACCGCCACGACGTGTACGATGTTTGCGTCGGGTCGGCCCTGGGCATGACCGTCGCCTACTGGAGCTACAGG
AGACACTGGCCGAGCTTGTCCAGTCCCGAGTGCCACGAGCCGTATCCGCGGCCAGGCTCCGAGGCCAAGACGAGA
TGGTCTCGGGTCAGGGACGAGGAGGAGGCCGGGGCTCACGCAGTATCGGGGTACGAGCTGACTCATGTACGAGCC
ACCGACCGGGCAGTGAATTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail