Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1780
Gene name
LocationContig_140:29757..31339
Strand+
Gene length (bp)1582
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-38 87 420
PF06779 MFS_4 Uncharacterised MFS-type transporter YbfB 6.5E-07 145 451

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 12 464 1.0E-82
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 5 464 5.0E-75
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 71 455 1.0E-27
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 71 455 2.0E-26
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 21 457 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 12 464 1.0E-82
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 5 464 5.0E-75
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 71 455 1.0E-27
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 71 455 2.0E-26
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 21 457 2.0E-25
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 65 465 2.0E-25
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 66 455 6.0E-25
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 68 455 5.0E-24
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 54 443 7.0E-24
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 13 402 3.0E-23
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 71 457 4.0E-23
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 71 444 5.0E-21
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 71 460 6.0E-21
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 71 457 1.0E-20
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 46 460 4.0E-20
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 71 444 2.0E-19
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 56 451 2.0E-19
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 71 460 4.0E-19
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 71 443 2.0E-18
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 68 457 1.0E-17
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 71 464 2.0E-17
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 78 460 1.0E-16
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 78 458 2.0E-16
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 71 460 2.0E-15
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 13 454 2.0E-15
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 78 460 2.0E-15
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 78 443 4.0E-15
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 12 454 1.0E-14
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 47 272 2.0E-14
sp|P53986|MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus GN=Slc16a1 PE=1 SV=1 69 383 3.0E-13
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 80 430 3.0E-13
sp|Q3MHW6|MOT1_BOVIN Monocarboxylate transporter 1 OS=Bos taurus GN=SLC16A1 PE=2 SV=2 69 427 4.0E-13
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 47 279 5.0E-13
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 71 249 5.0E-13
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 54 255 9.0E-13
sp|P53987|MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus GN=Slc16a1 PE=1 SV=1 69 383 2.0E-12
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 71 451 4.0E-12
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 69 383 6.0E-12
sp|O70461|MOT3_RAT Monocarboxylate transporter 3 OS=Rattus norvegicus GN=Slc16a8 PE=2 SV=1 80 430 8.0E-12
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 69 383 3.0E-11
sp|O95907|MOT3_HUMAN Monocarboxylate transporter 3 OS=Homo sapiens GN=SLC16A8 PE=2 SV=1 68 429 2.0E-10
sp|G5E8K6|MOT6_MOUSE Monocarboxylate transporter 6 OS=Mus musculus GN=Slc16a5 PE=3 SV=1 77 334 3.0E-09
sp|O15375|MOT6_HUMAN Monocarboxylate transporter 6 OS=Homo sapiens GN=SLC16A5 PE=2 SV=1 77 420 2.0E-08
sp|Q8R0M8|MOT5_MOUSE Monocarboxylate transporter 5 OS=Mus musculus GN=Slc16a4 PE=2 SV=1 69 233 1.0E-07
sp|Q5ZJU0|MOT9_CHICK Monocarboxylate transporter 9 OS=Gallus gallus GN=SLC16A9 PE=2 SV=1 71 271 1.0E-07
sp|O15374|MOT5_HUMAN Monocarboxylate transporter 5 OS=Homo sapiens GN=SLC16A4 PE=2 SV=1 78 233 3.0E-07
sp|Q7TM99|MOT9_MOUSE Monocarboxylate transporter 9 OS=Mus musculus GN=Slc16a9 PE=2 SV=1 68 271 4.0E-07
sp|Q5R5M4|MOT9_PONAB Monocarboxylate transporter 9 OS=Pongo abelii GN=SLC16A9 PE=2 SV=1 71 261 2.0E-06
sp|Q7RTY1|MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens GN=SLC16A9 PE=1 SV=1 71 261 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 79 101 22
2 116 138 22
3 143 165 22
4 175 197 22
5 204 226 22
6 236 258 22
7 278 300 22
8 313 332 19
9 339 361 22
10 371 393 22
11 406 428 22
12 438 460 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1780
MDVHQVTSRAVHDEPNAFDDDEIRPTDEPRLRGQDGAGGGGGGGGDDDKGDALEKRVTTVSTAASHDETYPEGGL
RAWLVVLGGWFAMISSMGLMNTVGIFQAYIISHQLEGQSEGTVGWIFSIYTFLAFFCGVYIGPVFDKYGPRWLVV
AGCICTVVGVLAMSFCKELWQFVLSFGVLAGFGTSLLFTPCIAAVGHWFRRRRGFATGMASTAGGIGGIIFPLML
TSLFDRVGYGWATRALALVCLVCGMVGILLVRSRLPPAANATAHPDFRILRQVPFALTTVAIFLLEFSLFIPLTF
ISTYALQRGFDQAFAFHLLPIMNAGSVVGRALPGYYADVVGPFNTCLFSVLLSLAACLCVWLPLGHTAAGIIVFS
VLFGFGSGTSIAIAPVCIGRMCKTQNYGRYYATTYTVVSIACLLGVPVGGSIVQASGGSYTPLIILTGAVYVGSA
VCMVMAKAWHLGWKNWLAAY*
Coding >Hirsu2|1780
ATGGACGTCCACCAGGTCACGTCGCGAGCGGTCCACGATGAGCCCAACGCCTTCGACGACGACGAGATTCGCCCG
ACGGACGAGCCGCGGCTGCGCGGGCAAGACGGGGCCGGCGGCGGCGGCGGCGGCGGCGGCGACGACGACAAGGGC
GACGCGCTGGAGAAGCGGGTGACGACGGTGTCGACGGCGGCGTCGCACGACGAGACGTACCCCGAGGGCGGGCTG
CGGGCCTGGCTGGTGGTGCTGGGCGGCTGGTTCGCCATGATCTCGTCGATGGGGCTGATGAACACGGTCGGCATC
TTCCAGGCCTACATCATCAGCCACCAGCTCGAGGGCCAAAGCGAGGGCACCGTCGGCTGGATCTTCTCCATCTAC
ACCTTCCTCGCCTTCTTCTGCGGCGTCTACATCGGGCCCGTCTTTGACAAGTACGGGCCGAGGTGGCTCGTGGTC
GCGGGATGCATCTGCACCGTCGTCGGCGTCTTGGCCATGAGCTTCTGCAAAGAACTGTGGCAGTTTGTCCTCTCG
TTCGGCGTGCTGGCCGGCTTCGGCACGTCGCTGCTCTTCACGCCGTGCATCGCGGCTGTCGGGCACTGGTTCCGG
CGGCGGCGCGGGTTCGCGACGGGCATGGCGTCGACGGCCGGCGGCATCGGCGGCATCATCTTCCCGCTGATGCTG
ACGTCGCTCTTCGACCGGGTCGGCTACGGCTGGGCGACGCGGGCCCTGGCGCTCGTGTGCCTCGTGTGCGGGATG
GTGGGCATCCTGCTGGTGCGGTCGCGTCTGCCGCCGGCGGCGAACGCGACGGCGCACCCGGACTTCCGGATCCTG
CGCCAGGTGCCGTTCGCGCTGACGACGGTGGCCATCTTCCTGCTCGAGTTCTCGCTCTTCATCCCGCTCACCTTC
ATCTCGACGTACGCGCTGCAGCGCGGCTTCGACCAGGCCTTCGCCTTCCACCTGCTGCCCATCATGAACGCCGGC
TCGGTCGTGGGCCGGGCCCTGCCGGGCTACTACGCCGACGTGGTCGGGCCCTTCAACACCTGCCTCTTCTCCGTC
CTGCTCTCGCTGGCGGCTTGCCTGTGCGTGTGGCTGCCGCTCGGCCACACGGCCGCCGGCATCATCGTCTTCTCC
GTCCTCTTCGGCTTCGGCAGCGGCACGAGCATCGCCATCGCGCCCGTCTGCATCGGCCGCATGTGCAAGACGCAG
AACTACGGCCGGTACTACGCCACCACCTACACCGTCGTCTCCATCGCCTGCCTGCTCGGCGTCCCCGTCGGCGGC
TCCATCGTCCAGGCCAGCGGCGGCTCCTACACGCCCCTCATCATCCTCACCGGCGCCGTCTACGTCGGCTCCGCC
GTCTGCATGGTCATGGCCAAGGCCTGGCACCTCGGCTGGAAGAATTGGCTCGCCGCCTACTGA
Transcript >Hirsu2|1780
ATGGACGTCCACCAGGTCACGTCGCGAGCGGTCCACGATGAGCCCAACGCCTTCGACGACGACGAGATTCGCCCG
ACGGACGAGCCGCGGCTGCGCGGGCAAGACGGGGCCGGCGGCGGCGGCGGCGGCGGCGGCGACGACGACAAGGGC
GACGCGCTGGAGAAGCGGGTGACGACGGTGTCGACGGCGGCGTCGCACGACGAGACGTACCCCGAGGGCGGGCTG
CGGGCCTGGCTGGTGGTGCTGGGCGGCTGGTTCGCCATGATCTCGTCGATGGGGCTGATGAACACGGTCGGCATC
TTCCAGGCCTACATCATCAGCCACCAGCTCGAGGGCCAAAGCGAGGGCACCGTCGGCTGGATCTTCTCCATCTAC
ACCTTCCTCGCCTTCTTCTGCGGCGTCTACATCGGGCCCGTCTTTGACAAGTACGGGCCGAGGTGGCTCGTGGTC
GCGGGATGCATCTGCACCGTCGTCGGCGTCTTGGCCATGAGCTTCTGCAAAGAACTGTGGCAGTTTGTCCTCTCG
TTCGGCGTGCTGGCCGGCTTCGGCACGTCGCTGCTCTTCACGCCGTGCATCGCGGCTGTCGGGCACTGGTTCCGG
CGGCGGCGCGGGTTCGCGACGGGCATGGCGTCGACGGCCGGCGGCATCGGCGGCATCATCTTCCCGCTGATGCTG
ACGTCGCTCTTCGACCGGGTCGGCTACGGCTGGGCGACGCGGGCCCTGGCGCTCGTGTGCCTCGTGTGCGGGATG
GTGGGCATCCTGCTGGTGCGGTCGCGTCTGCCGCCGGCGGCGAACGCGACGGCGCACCCGGACTTCCGGATCCTG
CGCCAGGTGCCGTTCGCGCTGACGACGGTGGCCATCTTCCTGCTCGAGTTCTCGCTCTTCATCCCGCTCACCTTC
ATCTCGACGTACGCGCTGCAGCGCGGCTTCGACCAGGCCTTCGCCTTCCACCTGCTGCCCATCATGAACGCCGGC
TCGGTCGTGGGCCGGGCCCTGCCGGGCTACTACGCCGACGTGGTCGGGCCCTTCAACACCTGCCTCTTCTCCGTC
CTGCTCTCGCTGGCGGCTTGCCTGTGCGTGTGGCTGCCGCTCGGCCACACGGCCGCCGGCATCATCGTCTTCTCC
GTCCTCTTCGGCTTCGGCAGCGGCACGAGCATCGCCATCGCGCCCGTCTGCATCGGCCGCATGTGCAAGACGCAG
AACTACGGCCGGTACTACGCCACCACCTACACCGTCGTCTCCATCGCCTGCCTGCTCGGCGTCCCCGTCGGCGGC
TCCATCGTCCAGGCCAGCGGCGGCTCCTACACGCCCCTCATCATCCTCACCGGCGCCGTCTACGTCGGCTCCGCC
GTCTGCATGGTCATGGCCAAGGCCTGGCACCTCGGCTGGAAGAATTGGCTCGCCGCCTACTGA
Gene >Hirsu2|1780
ATGGACGTCCACCAGGTCACGTCGCGAGCGGTCCACGATGAGCCCAACGCCTTCGACGACGACGAGATTCGCCCG
ACGGACGAGCCGCGGCTGCGCGGGCAAGACGGGGCCGGCGGCGGCGGCGGCGGCGGCGGCGACGACGACAAGGGC
GACGCGCTGGAGAAGCGGGTGACGACGGTGTCGACGGCGGCGTCGCACGACGAGACGTACCCCGAGGGCGGGCTG
CGGGCCTGGCTGGTGGTGCTGGGCGGCTGGTTCGCCATGATCTCGTCGATGGGGCTGATGAACACGGTCGGCATC
TTCCAGGCCTACATCATCAGCCACCAGCTCGAGGGCCAAAGCGAGGGCACCGTCGGCTGGATCTTCTCCATCTAC
ACCTTCCTCGCCTTCTTCTGCGGCGTCTACATCGGGCCCGTCTTTGACAAGTACGGGCCGAGGTGGCTCGTGGTC
GCGGGATGCATCTGCACCGTCGTCGGCGTCTTGGCCATGAGCTTCTGCAAAGGTATTTTTTCCCTCTCCCCCCCC
CCTTCCATCCGCTCTCATTCCACGCACACGAGATAAGATTCGACCTGCTGCAGCGGGCGAGCTGGTGAAACGAAC
GGGGCAGCGAACGGATACAAGGGAGAAAAGCGAAAGCAACGGCTGACAGACTGGAACAAAACAAACGACAGAACT
GTGGCAGTTTGTCCTCTCGTTCGGCGTGCTGGCCGGCTTCGGCACGTCGCTGCTCTTCACGCCGTGCATCGCGGC
TGTCGGGCACTGGTTCCGGCGGCGGCGCGGGTTCGCGACGGGCATGGCGTCGACGGCCGGCGGCATCGGCGGCAT
CATCTTCCCGCTGATGCTGACGTCGCTCTTCGACCGGGTCGGCTACGGCTGGGCGACGCGGGCCCTGGCGCTCGT
GTGCCTCGTGTGCGGGATGGTGGGCATCCTGCTGGTGCGGTCGCGTCTGCCGCCGGCGGCGAACGCGACGGCGCA
CCCGGACTTCCGGATCCTGCGCCAGGTGCCGTTCGCGCTGACGACGGTGGCCATCTTCCTGCTCGAGTTCTCGCT
CTTCATCCCGCTCACCTTCATCTCGACGTACGCGCTGCAGCGCGGCTTCGACCAGGCCTTCGCCTTCCACCTGCT
GCCCATCATGAACGCCGGCTCGGTCGTGGGCCGGGCCCTGCCGGGCTACTACGCCGACGTGGTCGGGCCCTTCAA
CACCTGCCTCTTCTCCGTCCTGCTCTCGCTGGCGGCTTGCCTGTGCGTGTGGCTGCCGCTCGGCCACACGGCCGC
CGGCATCATCGTCTTCTCCGTCCTCTTCGGCTTCGGCAGCGGCACGAGCATCGCCATCGCGCCCGTCTGCATCGG
CCGCATGTGCAAGACGCAGAACTACGGCCGGTACTACGCCACCACCTACACCGTCGTCTCCATCGCCTGCCTGCT
CGGCGTCCCCGTCGGCGGCTCCATCGTCCAGGCCAGCGGCGGCTCCTACACGCCCCTCATCATCCTCACCGGCGC
CGTCTACGTCGGCTCCGCCGTCTGCATGGTCATGGCCAAGGCCTGGCACCTCGGCTGGAAGAATTGGCTCGCCGC
CTACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail