Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1776
Gene name
LocationContig_140:17113..19024
Strand+
Gene length (bp)1911
Transcript length (bp)1791
Coding sequence length (bp)1791
Protein length (aa) 597

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 3.1E-71 106 554
PF07690 MFS_1 Major Facilitator Superfamily 7.5E-16 123 411

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 59 564 5.0E-108
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 8 581 1.0E-103
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 66 564 2.0E-103
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 8 564 2.0E-103
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 8 564 3.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 59 564 5.0E-108
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 8 581 1.0E-103
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 66 564 2.0E-103
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 8 564 2.0E-103
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 8 564 3.0E-103
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 8 564 3.0E-103
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 8 564 5.0E-103
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 66 564 2.0E-102
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 174 556 4.0E-24
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 162 571 1.0E-22
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 178 556 8.0E-22
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 194 555 2.0E-21
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 162 590 7.0E-21
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 157 555 8.0E-21
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 162 556 2.0E-20
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 167 552 2.0E-20
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 162 556 2.0E-20
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 178 565 2.0E-20
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 157 556 3.0E-20
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 89 558 1.0E-19
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 174 552 5.0E-19
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 178 552 5.0E-19
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 172 556 6.0E-19
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 172 556 1.0E-18
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 203 556 1.0E-18
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 173 555 2.0E-18
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 197 558 3.0E-18
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 185 555 5.0E-18
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 203 555 7.0E-18
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 173 556 2.0E-17
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 155 583 5.0E-17
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 148 493 5.0E-17
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 109 587 7.0E-17
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 111 556 7.0E-17
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 136 556 9.0E-17
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 107 558 1.0E-16
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 89 587 1.0E-16
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 89 587 1.0E-16
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 203 556 1.0E-16
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 203 555 1.0E-16
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 203 556 1.0E-16
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 180 556 1.0E-16
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 203 555 2.0E-16
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 203 556 2.0E-16
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 89 560 2.0E-16
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 76 556 4.0E-16
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 147 552 4.0E-16
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 138 552 6.0E-16
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 138 552 6.0E-16
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 107 558 8.0E-16
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 107 555 1.0E-15
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 203 556 4.0E-15
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 203 556 4.0E-15
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 89 556 6.0E-15
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 178 552 6.0E-15
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 178 571 1.0E-14
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 89 558 1.0E-14
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 176 552 1.0E-14
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 107 559 2.0E-14
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 173 552 2.0E-14
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 133 555 3.0E-14
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 206 558 8.0E-14
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 91 555 9.0E-14
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 167 556 2.0E-13
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 178 556 2.0E-13
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 174 554 2.0E-13
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 174 552 3.0E-13
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 196 554 3.0E-13
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 199 558 3.0E-13
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 93 555 4.0E-13
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 99 596 5.0E-13
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 196 552 5.0E-13
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 137 563 6.0E-13
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 148 454 7.0E-13
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 201 559 7.0E-13
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 137 563 8.0E-13
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 201 563 1.0E-12
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 141 556 1.0E-12
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 106 551 1.0E-12
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 126 551 2.0E-12
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 196 552 2.0E-12
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 144 561 2.0E-12
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 162 555 2.0E-12
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 135 552 3.0E-12
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 109 563 4.0E-12
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 176 499 5.0E-12
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 191 556 6.0E-12
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 191 556 6.0E-12
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 168 554 6.0E-12
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 173 544 8.0E-12
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 133 555 8.0E-12
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 109 563 8.0E-12
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 162 553 1.0E-11
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 169 544 1.0E-11
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 169 544 1.0E-11
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 196 553 1.0E-11
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 133 556 1.0E-11
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 137 563 1.0E-11
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 169 544 2.0E-11
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 162 552 2.0E-11
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 193 566 2.0E-11
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 125 551 2.0E-11
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 170 551 3.0E-11
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 170 551 3.0E-11
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 173 544 3.0E-11
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 126 551 5.0E-11
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 198 554 6.0E-11
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 139 552 9.0E-11
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 126 551 1.0E-10
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 169 544 1.0E-10
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 178 552 1.0E-10
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 169 544 2.0E-10
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 62 554 2.0E-10
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 169 544 2.0E-10
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 157 552 2.0E-10
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 125 551 2.0E-10
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 126 551 2.0E-10
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 173 544 3.0E-10
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 147 433 3.0E-10
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 157 552 3.0E-10
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 176 572 4.0E-10
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 173 544 4.0E-10
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 202 588 4.0E-10
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 157 552 6.0E-10
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 225 563 7.0E-10
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 179 555 7.0E-10
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 167 563 7.0E-10
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 195 555 8.0E-10
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 188 573 9.0E-10
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 173 544 1.0E-09
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 169 552 1.0E-09
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 167 563 2.0E-09
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 167 544 2.0E-09
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 174 433 2.0E-09
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 150 552 3.0E-09
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 195 555 4.0E-09
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 160 484 4.0E-09
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 149 334 5.0E-09
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 173 432 6.0E-09
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 167 552 7.0E-09
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 124 552 7.0E-09
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 124 552 7.0E-09
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 170 455 1.0E-08
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 189 556 1.0E-08
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 186 423 1.0E-08
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 184 556 1.0E-08
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 201 563 2.0E-08
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 106 582 2.0E-08
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 162 432 2.0E-08
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 178 551 2.0E-08
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 179 560 2.0E-08
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 129 547 2.0E-08
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 189 563 3.0E-08
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 135 552 3.0E-08
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 157 455 5.0E-08
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 152 506 5.0E-08
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 176 553 5.0E-08
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 202 556 7.0E-08
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 162 511 7.0E-08
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 189 563 1.0E-07
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 195 432 1.0E-07
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 162 575 1.0E-07
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 115 390 3.0E-07
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 157 544 3.0E-07
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 178 433 4.0E-07
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 139 559 4.0E-07
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 196 552 5.0E-07
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 178 432 8.0E-07
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 191 576 9.0E-07
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 126 561 9.0E-07
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 195 555 9.0E-07
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 126 561 1.0E-06
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 178 546 1.0E-06
sp|O35956|S22A6_RAT Solute carrier family 22 member 6 OS=Rattus norvegicus GN=Slc22a6 PE=1 SV=1 152 506 3.0E-06
sp|Q6NYN7|S22A6_DANRE Solute carrier family 22 member 6 OS=Danio rerio GN=slc22a6 PE=2 SV=1 160 543 3.0E-06
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 108 478 4.0E-06
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 168 436 5.0E-06
sp|Q8MK48|S22A6_PIG Solute carrier family 22 member 6 OS=Sus scrofa GN=SLC22A6 PE=1 SV=2 152 438 5.0E-06
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 173 544 7.0E-06
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 204 552 8.0E-06
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 53 418 8.0E-06
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 61 408 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 156 178 22
2 193 215 22
3 236 258 22
4 273 295 22
5 357 376 19
6 391 413 22
7 420 442 22
8 452 474 22
9 487 506 19
10 521 538 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1776
MKTVPVLSKVKPGAGDDRAPGQLGASSSLDLPTAMESPAGARLESVSSLKAMKESVWLSQHLASSDETKKRAQSG
MAAEKQMTFFDCLRRYPKAVGWSLLLFMTVIMEAYDKLLITDLFALPAFSEKYGEPVDPLNPATEHEVSPGWQMA
LQNASILSEIAGLLLYGYFTLTIGYRLMMLVSLAWFCGAAIPAVLANNLPVLLLSQVLSGFSWGVIETLAATYAA
DVVPSRLRAFVLSNINTCWLIGQLVGTGVLHGVGYGSTEWSFRLPFALQWAWVVPLIIGIYFAPESPWWFVRHDR
PEEARHALSRLSNQDELDIENAIALMEHTNSVEKALQYGGATYRDLFRGTNLRRTEIACVVWACQALSGATLTSY
APYFFKQAGFDLSTSFTVSIGMYGVAVAGGILSWGLLSCVGRRKLYLVGLSAAAVLLIAGGAVSVAFDAREGANW
ALGALIVATTLSYNLTIGPVCYVLVAEVPSTRLRLKTVAMARATYNVVTIINNILAPRMLNPTSWNWGGKTCFVY
AGTSIICLVWCYFRLPETQKLSYLELDILFELKAPAAKFGKLQKKLANSPYISASEEERLTNPWHGWLSYS*
Coding >Hirsu2|1776
ATGAAAACGGTGCCGGTTCTGTCCAAGGTCAAACCCGGGGCGGGCGACGACCGCGCGCCCGGCCAGCTGGGCGCC
TCGTCCAGCCTGGACCTGCCGACCGCCATGGAGTCGCCGGCGGGCGCGCGGCTCGAGTCCGTCAGCAGCCTCAAG
GCCATGAAGGAGTCGGTCTGGTTGTCGCAGCACCTGGCCAGCTCGGATGAGACCAAGAAGCGGGCCCAGAGCGGC
ATGGCGGCCGAGAAGCAGATGACCTTCTTCGACTGCCTGCGTCGCTACCCCAAGGCCGTCGGCTGGTCGCTGCTG
CTGTTCATGACCGTCATCATGGAGGCCTACGACAAGCTGCTCATCACCGACCTCTTCGCCCTGCCGGCCTTCAGC
GAGAAGTACGGCGAGCCGGTCGACCCGCTCAACCCGGCCACCGAGCACGAGGTCTCGCCCGGCTGGCAGATGGCG
CTGCAGAACGCCTCCATCCTGTCCGAGATCGCCGGCCTGCTGCTCTACGGATACTTCACCCTGACCATCGGCTAC
CGGCTGATGATGCTCGTCAGCCTCGCTTGGTTCTGCGGCGCCGCCATCCCCGCCGTCCTTGCCAACAACCTCCCC
GTTCTTCTACTCTCCCAGGTCCTAAGCGGCTTCTCCTGGGGCGTCATCGAGACTCTGGCAGCAACGTACGCGGCC
GACGTCGTGCCATCTCGTCTCCGCGCCTTCGTCCTGAGCAACATCAACACGTGCTGGCTCATCGGGCAGCTGGTC
GGCACCGGAGTCCTCCACGGCGTCGGCTACGGGAGCACCGAATGGTCGTTCCGCCTGCCCTTCGCCTTGCAGTGG
GCATGGGTCGTCCCGCTGATTATCGGGATCTACTTCGCCCCCGAGAGTCCCTGGTGGTTCGTGCGCCACGACAGA
CCTGAGGAAGCCCGCCATGCCCTCAGCCGTCTCTCCAACCAAGACGAGCTCGACATCGAAAACGCGATAGCCCTG
ATGGAGCACACCAACTCGGTCGAGAAGGCGCTTCAGTATGGAGGAGCGACCTATCGGGACTTGTTCAGAGGCACA
AACCTCCGCAGGACCGAAATCGCCTGCGTCGTCTGGGCCTGTCAGGCTCTCTCGGGCGCCACCTTGACGAGCTAC
GCGCCCTACTTCTTCAAGCAGGCCGGCTTCGACCTCTCGACCTCCTTCACCGTCTCCATCGGCATGTACGGCGTC
GCCGTCGCCGGAGGCATCCTCTCCTGGGGCCTCCTCTCCTGTGTCGGCCGTCGCAAGCTCTATCTGGTCGGTCTA
TCGGCAGCGGCGGTGCTTCTGATCGCCGGCGGCGCCGTCTCGGTCGCCTTTGATGCACGGGAGGGCGCCAACTGG
GCCCTCGGCGCTCTGATTGTGGCGACGACGCTGTCGTACAATCTGACCATCGGCCCGGTATGCTACGTGCTCGTC
GCCGAAGTCCCCTCCACACGGCTGCGGCTGAAGACGGTGGCGATGGCCAGAGCAACATACAACGTGGTGACCATC
ATCAACAATATCCTGGCTCCTAGGATGCTCAACCCGACCTCCTGGAACTGGGGCGGCAAGACATGCTTCGTGTAC
GCCGGCACGTCCATTATCTGCCTCGTCTGGTGCTATTTCCGCTTGCCCGAAACCCAGAAACTCTCCTATCTTGAG
TTGGACATCCTCTTCGAGCTGAAGGCCCCGGCGGCAAAGTTCGGAAAGCTGCAGAAGAAGCTGGCCAACTCACCC
TACATCTCCGCCTCCGAAGAAGAGCGCTTGACGAATCCTTGGCACGGCTGGCTCTCATATTCTTGA
Transcript >Hirsu2|1776
ATGAAAACGGTGCCGGTTCTGTCCAAGGTCAAACCCGGGGCGGGCGACGACCGCGCGCCCGGCCAGCTGGGCGCC
TCGTCCAGCCTGGACCTGCCGACCGCCATGGAGTCGCCGGCGGGCGCGCGGCTCGAGTCCGTCAGCAGCCTCAAG
GCCATGAAGGAGTCGGTCTGGTTGTCGCAGCACCTGGCCAGCTCGGATGAGACCAAGAAGCGGGCCCAGAGCGGC
ATGGCGGCCGAGAAGCAGATGACCTTCTTCGACTGCCTGCGTCGCTACCCCAAGGCCGTCGGCTGGTCGCTGCTG
CTGTTCATGACCGTCATCATGGAGGCCTACGACAAGCTGCTCATCACCGACCTCTTCGCCCTGCCGGCCTTCAGC
GAGAAGTACGGCGAGCCGGTCGACCCGCTCAACCCGGCCACCGAGCACGAGGTCTCGCCCGGCTGGCAGATGGCG
CTGCAGAACGCCTCCATCCTGTCCGAGATCGCCGGCCTGCTGCTCTACGGATACTTCACCCTGACCATCGGCTAC
CGGCTGATGATGCTCGTCAGCCTCGCTTGGTTCTGCGGCGCCGCCATCCCCGCCGTCCTTGCCAACAACCTCCCC
GTTCTTCTACTCTCCCAGGTCCTAAGCGGCTTCTCCTGGGGCGTCATCGAGACTCTGGCAGCAACGTACGCGGCC
GACGTCGTGCCATCTCGTCTCCGCGCCTTCGTCCTGAGCAACATCAACACGTGCTGGCTCATCGGGCAGCTGGTC
GGCACCGGAGTCCTCCACGGCGTCGGCTACGGGAGCACCGAATGGTCGTTCCGCCTGCCCTTCGCCTTGCAGTGG
GCATGGGTCGTCCCGCTGATTATCGGGATCTACTTCGCCCCCGAGAGTCCCTGGTGGTTCGTGCGCCACGACAGA
CCTGAGGAAGCCCGCCATGCCCTCAGCCGTCTCTCCAACCAAGACGAGCTCGACATCGAAAACGCGATAGCCCTG
ATGGAGCACACCAACTCGGTCGAGAAGGCGCTTCAGTATGGAGGAGCGACCTATCGGGACTTGTTCAGAGGCACA
AACCTCCGCAGGACCGAAATCGCCTGCGTCGTCTGGGCCTGTCAGGCTCTCTCGGGCGCCACCTTGACGAGCTAC
GCGCCCTACTTCTTCAAGCAGGCCGGCTTCGACCTCTCGACCTCCTTCACCGTCTCCATCGGCATGTACGGCGTC
GCCGTCGCCGGAGGCATCCTCTCCTGGGGCCTCCTCTCCTGTGTCGGCCGTCGCAAGCTCTATCTGGTCGGTCTA
TCGGCAGCGGCGGTGCTTCTGATCGCCGGCGGCGCCGTCTCGGTCGCCTTTGATGCACGGGAGGGCGCCAACTGG
GCCCTCGGCGCTCTGATTGTGGCGACGACGCTGTCGTACAATCTGACCATCGGCCCGGTATGCTACGTGCTCGTC
GCCGAAGTCCCCTCCACACGGCTGCGGCTGAAGACGGTGGCGATGGCCAGAGCAACATACAACGTGGTGACCATC
ATCAACAATATCCTGGCTCCTAGGATGCTCAACCCGACCTCCTGGAACTGGGGCGGCAAGACATGCTTCGTGTAC
GCCGGCACGTCCATTATCTGCCTCGTCTGGTGCTATTTCCGCTTGCCCGAAACCCAGAAACTCTCCTATCTTGAG
TTGGACATCCTCTTCGAGCTGAAGGCCCCGGCGGCAAAGTTCGGAAAGCTGCAGAAGAAGCTGGCCAACTCACCC
TACATCTCCGCCTCCGAAGAAGAGCGCTTGACGAATCCTTGGCACGGCTGGCTCTCATATTCTTGA
Gene >Hirsu2|1776
ATGAAAACGGTGCCGGTTCTGTCCAAGGTCAAACCCGGGGCGGGCGACGACCGCGCGCCCGGCCAGCTGGGCGCC
TCGTCCAGCCTGGACCTGCCGACCGCCATGGAGTCGCCGGCGGGCGCGCGGCTCGAGTCCGTCAGCAGCCTCAAG
GCCATGAAGGAGTCGGTCTGGTTGTCGCAGCACCTGGCCAGCTCGGATGAGACCAAGAAGCGGGCCCAGAGCGGC
ATGGCGGCCGAGAAGCAGATGACCTTCTTCGACTGCCTGCGTCGCTACCCCAAGGCCGTCGGCTGGTCGCTGCTG
CTGTTCATGACCGTCATCATGGAGGCCTACGACAAGCTGCTCATCACCGACCTCTTCGCCCTGCCGGCCTTCAGC
GAGAAGTACGGCGAGCCGGTCGACCCGCTCAACCCGGCCACCGAGCACGAGGTCTCGCCCGGCTGGCAGATGGCG
CTGCAGAACGCCTCCATCCTGTCCGAGATCGCCGGCCTGCTGCTCTACGGATACTTCACCCTGACCATCGGCTAC
CGGCTGATGATGCTCGTCAGCCTCGCTTGGTTCTGCGGCGCCGCCATCCCCGCCGTCCTTGCCAACAACCTCCCC
GTTCTTCTACTCTCCCAGGTCCTAAGCGGTATGTCCTCTCCGATCCAAGCCTAGCGTTCTTGATCTGACATCTCG
CCCTCGTCTGCAGGCTTCTCCTGGGGCGTCATCGAGACTCTGGCAGCAACGTACGCGGCCGACGTCGTGCCATCT
CGTCTCCGCGCCTTCGTCCTGAGCAACATCAACACGTGCTGGCTCATCGGGCAGCTGGTCGGCACCGGAGTCCTC
CACGGCGTCGGCTACGGGAGCACCGAATGGTCGTTCCGCCTGCCCTTCGCCTTGCAGTGGGCATGGGTCGTCCCG
CTGATTATCGGGATCTACTTCGCCCCCGAGAGTCCCTGTAAGGCCATCCCGAGTCCCGTGCCGGCGAGAGGTCCG
TGTACTGATGCAACCGTTTCAGGGTGGTTCGTGCGCCACGACAGACCTGAGGAAGCCCGCCATGCCCTCAGCCGT
CTCTCCAACCAAGACGAGCTCGACATCGAAAACGCGATAGCCCTGATGGAGCACACCAACTCGGTCGAGAAGGCG
CTTCAGTATGGAGGAGCGACCTATCGGGACTTGTTCAGAGGCACAAACCTCCGCAGGACCGAAATCGCCTGCGTC
GTCTGGGCCTGTCAGGCTCTCTCGGGCGCCACCTTGACGAGCTACGCGCCCTACTTCTTCAAGCAGGCCGGCTTC
GACCTCTCGACCTCCTTCACCGTCTCCATCGGCATGTACGGCGTCGCCGTCGCCGGAGGCATCCTCTCCTGGGGC
CTCCTCTCCTGTGTCGGCCGTCGCAAGCTCTATCTGGTCGGTCTATCGGCAGCGGCGGTGCTTCTGATCGCCGGC
GGCGCCGTCTCGGTCGCCTTTGATGCACGGGAGGGCGCCAACTGGGCCCTCGGCGCTCTGATTGTGGCGACGACG
CTGTCGTACAATCTGACCATCGGCCCGGTATGCTACGTGCTCGTCGCCGAAGTCCCCTCCACACGGCTGCGGCTG
AAGACGGTGGCGATGGCCAGAGCAACATACAACGTGGTGACCATCATCAACAATATCCTGGCTCCTAGGATGCTC
AACCCGACCTCCTGGAACTGGGGCGGCAAGACATGCTTCGTGTACGCCGGCACGTCCATTATCTGCCTCGTCTGG
TGCTATTTCCGCTTGCCCGAAACCCAGAAACTCTCCTATCTTGAGTTGGACATCCTCTTCGAGCTGAAGGCCCCG
GCGGCAAAGTTCGGAAAGCTGCAGAAGAAGCTGGCCAACTCACCCTACATCTCCGCCTCCGAAGAAGAGCGCTTG
ACGAATCCTTGGCACGGCTGGCTCTCATATTCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail