Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1774
Gene name
LocationContig_140:8106..8915
Strand+
Gene length (bp)809
Transcript length (bp)717
Coding sequence length (bp)717
Protein length (aa) 239

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.5E-07 12 110
PF13637 Ank_4 Ankyrin repeats (many copies) 5.6E-05 79 126
PF13857 Ank_5 Ankyrin repeats (many copies) 6.0E-08 70 120
PF00023 Ank Ankyrin repeat 1.9E-04 79 110
PF13606 Ank_3 Ankyrin repeat 1.7E-03 79 107

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1774
MEDHTIKQIVLGACENHHDALLRWIFKYANSFPSPVDPDDGFTTLLIAADRGLARSCWHFARNRLGGRRIDFNAR
DRLGRTALHQACLRDHDDVVQALLYFEETDVNIRDFEGRTPLGLAGRLGHETRARLKDKAEQQIREANEPTERRI
DNAVEKVEHQQRETKKWTARERRCDEGFERWLNEYYEAKEAIERQMSIIENTTRRIGQAGNKEKIEELICKAEQL
ARQIRESDEEVDR*
Coding >Hirsu2|1774
ATGGAAGACCATACGATTAAGCAAATCGTACTAGGAGCGTGCGAAAACCACCATGATGCCCTTCTGAGATGGATT
TTCAAATACGCCAATTCCTTTCCTTCGCCAGTAGACCCCGACGATGGCTTTACCACGCTCCTTATTGCCGCGGAC
CGAGGCCTCGCCAGGTCTTGTTGGCACTTCGCTCGGAACAGACTCGGGGGTCGTCGAATTGACTTCAATGCGCGT
GACAGGCTCGGCCGGACGGCGCTTCACCAAGCCTGCCTTCGAGATCACGACGATGTCGTCCAAGCGCTCCTCTAT
TTCGAAGAGACCGACGTCAACATTCGCGACTTCGAAGGAAGGACACCGCTGGGCCTGGCAGGCCGACTCGGTCAC
GAGACGCGGGCACGCCTGAAGGATAAAGCCGAGCAGCAAATACGTGAAGCAAACGAGCCAACGGAGCGGCGGATA
GATAATGCTGTCGAGAAGGTTGAACATCAGCAGCGCGAAACCAAGAAATGGACCGCACGTGAAAGGCGCTGTGAC
GAAGGCTTCGAGCGATGGCTCAACGAGTACTACGAAGCCAAGGAAGCGATCGAACGGCAAATGTCCATCATTGAG
AATACCACGCGGCGGATTGGTCAAGCCGGCAATAAGGAGAAGATTGAGGAGCTCATCTGCAAAGCCGAACAGCTT
GCGCGGCAGATTCGAGAATCCGACGAAGAGGTTGACCGGTAG
Transcript >Hirsu2|1774
ATGGAAGACCATACGATTAAGCAAATCGTACTAGGAGCGTGCGAAAACCACCATGATGCCCTTCTGAGATGGATT
TTCAAATACGCCAATTCCTTTCCTTCGCCAGTAGACCCCGACGATGGCTTTACCACGCTCCTTATTGCCGCGGAC
CGAGGCCTCGCCAGGTCTTGTTGGCACTTCGCTCGGAACAGACTCGGGGGTCGTCGAATTGACTTCAATGCGCGT
GACAGGCTCGGCCGGACGGCGCTTCACCAAGCCTGCCTTCGAGATCACGACGATGTCGTCCAAGCGCTCCTCTAT
TTCGAAGAGACCGACGTCAACATTCGCGACTTCGAAGGAAGGACACCGCTGGGCCTGGCAGGCCGACTCGGTCAC
GAGACGCGGGCACGCCTGAAGGATAAAGCCGAGCAGCAAATACGTGAAGCAAACGAGCCAACGGAGCGGCGGATA
GATAATGCTGTCGAGAAGGTTGAACATCAGCAGCGCGAAACCAAGAAATGGACCGCACGTGAAAGGCGCTGTGAC
GAAGGCTTCGAGCGATGGCTCAACGAGTACTACGAAGCCAAGGAAGCGATCGAACGGCAAATGTCCATCATTGAG
AATACCACGCGGCGGATTGGTCAAGCCGGCAATAAGGAGAAGATTGAGGAGCTCATCTGCAAAGCCGAACAGCTT
GCGCGGCAGATTCGAGAATCCGACGAAGAGGTTGACCGGTAG
Gene >Hirsu2|1774
ATGGAAGACCATACGATTAAGCAAATCGTACTAGGAGCGTGCGAAAACCACCATGATGCCCTTCTGAGATGGATT
TTCAAATACGCCAATTCCTTTCCTTCGCCAGTAGACCCCGACGATGGCTTTACCACGCTCCTTATTGCCGCGGAC
CGAGGCCTCGCCAGGTCTTGTTGGCACTTCGCTCGGAACAGACTCGGGGGTCGTCGAATTGACTTCAATGCGCGT
GACAGGCTCGGCCGGACGGCGCTTCACCAAGCCTGCCTTCGAGATCACGACGATGTCGTCCAAGCGCTCCTCTAT
TTCGAAGAGACCGACGTCAACATTCGCGACTTCGAAGGAAGGACACCGCTGGGCCTGGCAGGCCGACTCGGTCAC
GAGACGCGGGCACGCCTGAAGGATAAAGCCGAGCAGCAAATACGTGAAGCAAACGAGCCAACGGAGCGGCGGATA
GATAATGCTGTCGAGAAGGTTGAACATCAGCAGCGCGAAACCAAGAAATGGACCGCACGTGAAAGGCGCTGTGAC
GAAGGCTTCGAGCGATGGCTCAACGAGTACGTCGATGAGGCTGACAGGCCGAGGATACGCGGGCGCAAGATTAGG
TTACGGATACAGCAACTCGAAGAAAGGGCTAGGTTGCAGGCGTCTAGTACGAAGCCAAGGAAGCGATCGAACGGC
AAATGTCCATCATTGAGAATACCACGCGGCGGATTGGTCAAGCCGGCAATAAGGAGAAGATTGAGGAGCTCATCT
GCAAAGCCGAACAGCTTGCGCGGCAGATTCGAGAATCCGACGAAGAGGTTGACCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail