Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1767
Gene name
LocationContig_14:64578..66306
Strand-
Gene length (bp)1728
Transcript length (bp)1728
Coding sequence length (bp)1728
Protein length (aa) 576

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40533|TED1_YEAST Protein TED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TED1 PE=1 SV=1 144 527 2.0E-53
sp|O42841|YFH2_SCHPO Uncharacterized protein C23A1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.02c PE=4 SV=2 141 486 2.0E-19
sp|Q566Y9|MPPE1_DANRE Metallophosphoesterase 1 OS=Danio rerio GN=mppe1 PE=2 SV=1 129 428 7.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 511 533 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1767
MLVAAYLRQGLGLLAPLAIACTVYLYLYPFFNRCAFPVESRDAEEAFAKTKSLHWPFADSKTDHVLDELAPFRLL
ALGDPQLEGDTSVPIAYLGVLPHLKSLAQRLTFQIEHPFFRDRVRMILHDIIDLFLEDIPNIFESLRKRFDLFGN
DFYLAHIYRTLHWWSRPTHVSVLGDLLGSQWIEDPEFEQRGRRFWERTFRGGERVPDDVAVFPAQEYNISGILDG
SIKEEVWTRRIMNVAGNHDIGYAGDLTPERMERFERVFGKANYELRFALPVRNAEANATIRNSETNPESMRLPPQ
IRVLVLNDMNLDTPAKDQALQDATYQFINAAIGSSAAVEHHGQFTLVLTHIPMHKPDGVCVDGPMFEFHTPEDGG
GVREQYLLSSDASKGLLEGVFGLSGNPGAPGNGLGRSGLVLNGHDHEGCDTYHFINQTNGTEVADRSWEAVRWAD
AQARALPKQYMVPGRREITVRSMMGDFGGNAGLLSMWFNESTWEWEYEYTDCPLGRQHFWWLTHFLVMGVVLCAL
LYPAVLALEATGVDVDNRFFQGVHWVRCRLEEVRRESIKRYSGTRSNGAA*
Coding >Hirsu2|1767
ATGTTGGTCGCGGCTTATCTCCGCCAAGGCTTGGGCCTGCTCGCGCCCTTGGCGATAGCCTGCACCGTCTACCTC
TATCTGTATCCCTTCTTCAACCGATGTGCCTTTCCCGTCGAATCCAGAGACGCCGAGGAAGCCTTCGCCAAGACG
AAAAGCCTGCATTGGCCGTTTGCTGACTCCAAGACGGATCATGTGCTGGACGAGCTCGCGCCCTTCCGCCTGCTC
GCCCTGGGCGACCCCCAACTCGAGGGGGACACGTCCGTCCCGATAGCCTACCTGGGCGTGCTTCCTCACTTGAAG
AGCCTCGCGCAGCGCCTGACCTTCCAAATCGAGCATCCGTTCTTCCGAGACCGCGTCCGCATGATCCTTCACGAT
ATCATCGACCTGTTCCTTGAAGACATTCCCAATATTTTCGAGTCGCTCCGCAAGCGTTTCGATCTCTTCGGGAAC
GATTTCTACCTGGCGCACATCTACCGTACGCTTCACTGGTGGTCGCGCCCGACTCACGTCTCCGTTCTCGGTGAC
TTGCTGGGCAGTCAGTGGATCGAGGACCCGGAGTTTGAGCAGAGGGGACGACGGTTCTGGGAAAGAACTTTCAGA
GGGGGAGAGAGGGTTCCAGACGATGTGGCCGTGTTTCCAGCGCAGGAATACAACATATCAGGCATCCTGGACGGG
TCGATCAAAGAAGAAGTCTGGACCAGGAGGATAATGAACGTTGCGGGCAATCACGACATTGGCTATGCTGGGGAC
TTGACGCCGGAACGCATGGAGCGGTTCGAGCGGGTCTTTGGCAAGGCCAACTACGAGCTTCGCTTCGCGCTCCCC
GTCCGAAATGCCGAGGCCAATGCCACAATTCGCAACAGCGAGACGAACCCGGAGTCTATGCGTCTGCCTCCGCAA
ATCAGGGTTCTCGTACTCAACGACATGAATCTCGACACGCCAGCCAAAGACCAGGCGCTACAAGACGCAACGTAC
CAGTTCATCAATGCCGCCATCGGCTCCTCCGCCGCTGTCGAACACCACGGTCAATTCACGCTCGTGCTCACTCAC
ATTCCCATGCACAAGCCCGATGGCGTCTGCGTCGACGGCCCCATGTTCGAATTCCACACACCGGAGGACGGCGGA
GGAGTGAGGGAGCAGTACTTGCTCAGCTCCGATGCGAGCAAGGGTCTCCTTGAGGGCGTGTTTGGTCTCAGCGGA
AACCCAGGTGCGCCCGGCAATGGTCTGGGCCGCAGCGGCCTCGTGCTGAACGGACACGACCATGAAGGGTGTGAC
ACGTATCATTTCATCAATCAAACTAACGGCACCGAGGTGGCAGACCGCTCGTGGGAGGCAGTGAGATGGGCCGAC
GCTCAAGCTCGGGCCCTACCCAAACAGTACATGGTGCCCGGCCGGCGTGAGATTACCGTTCGAAGCATGATGGGC
GACTTCGGCGGCAACGCGGGCCTGCTCAGTATGTGGTTCAACGAGAGCACCTGGGAGTGGGAGTACGAATACACG
GACTGTCCTCTTGGCAGACAGCATTTCTGGTGGTTGACCCACTTTCTCGTCATGGGCGTCGTTTTGTGTGCCCTG
CTTTATCCCGCAGTCCTGGCTCTCGAGGCGACTGGCGTCGATGTGGACAACCGGTTCTTTCAAGGCGTTCATTGG
GTTCGGTGCAGGCTGGAGGAGGTTAGAAGGGAGAGCATTAAGCGGTATTCCGGCACGAGGTCCAATGGAGCGGCA
TGA
Transcript >Hirsu2|1767
ATGTTGGTCGCGGCTTATCTCCGCCAAGGCTTGGGCCTGCTCGCGCCCTTGGCGATAGCCTGCACCGTCTACCTC
TATCTGTATCCCTTCTTCAACCGATGTGCCTTTCCCGTCGAATCCAGAGACGCCGAGGAAGCCTTCGCCAAGACG
AAAAGCCTGCATTGGCCGTTTGCTGACTCCAAGACGGATCATGTGCTGGACGAGCTCGCGCCCTTCCGCCTGCTC
GCCCTGGGCGACCCCCAACTCGAGGGGGACACGTCCGTCCCGATAGCCTACCTGGGCGTGCTTCCTCACTTGAAG
AGCCTCGCGCAGCGCCTGACCTTCCAAATCGAGCATCCGTTCTTCCGAGACCGCGTCCGCATGATCCTTCACGAT
ATCATCGACCTGTTCCTTGAAGACATTCCCAATATTTTCGAGTCGCTCCGCAAGCGTTTCGATCTCTTCGGGAAC
GATTTCTACCTGGCGCACATCTACCGTACGCTTCACTGGTGGTCGCGCCCGACTCACGTCTCCGTTCTCGGTGAC
TTGCTGGGCAGTCAGTGGATCGAGGACCCGGAGTTTGAGCAGAGGGGACGACGGTTCTGGGAAAGAACTTTCAGA
GGGGGAGAGAGGGTTCCAGACGATGTGGCCGTGTTTCCAGCGCAGGAATACAACATATCAGGCATCCTGGACGGG
TCGATCAAAGAAGAAGTCTGGACCAGGAGGATAATGAACGTTGCGGGCAATCACGACATTGGCTATGCTGGGGAC
TTGACGCCGGAACGCATGGAGCGGTTCGAGCGGGTCTTTGGCAAGGCCAACTACGAGCTTCGCTTCGCGCTCCCC
GTCCGAAATGCCGAGGCCAATGCCACAATTCGCAACAGCGAGACGAACCCGGAGTCTATGCGTCTGCCTCCGCAA
ATCAGGGTTCTCGTACTCAACGACATGAATCTCGACACGCCAGCCAAAGACCAGGCGCTACAAGACGCAACGTAC
CAGTTCATCAATGCCGCCATCGGCTCCTCCGCCGCTGTCGAACACCACGGTCAATTCACGCTCGTGCTCACTCAC
ATTCCCATGCACAAGCCCGATGGCGTCTGCGTCGACGGCCCCATGTTCGAATTCCACACACCGGAGGACGGCGGA
GGAGTGAGGGAGCAGTACTTGCTCAGCTCCGATGCGAGCAAGGGTCTCCTTGAGGGCGTGTTTGGTCTCAGCGGA
AACCCAGGTGCGCCCGGCAATGGTCTGGGCCGCAGCGGCCTCGTGCTGAACGGACACGACCATGAAGGGTGTGAC
ACGTATCATTTCATCAATCAAACTAACGGCACCGAGGTGGCAGACCGCTCGTGGGAGGCAGTGAGATGGGCCGAC
GCTCAAGCTCGGGCCCTACCCAAACAGTACATGGTGCCCGGCCGGCGTGAGATTACCGTTCGAAGCATGATGGGC
GACTTCGGCGGCAACGCGGGCCTGCTCAGTATGTGGTTCAACGAGAGCACCTGGGAGTGGGAGTACGAATACACG
GACTGTCCTCTTGGCAGACAGCATTTCTGGTGGTTGACCCACTTTCTCGTCATGGGCGTCGTTTTGTGTGCCCTG
CTTTATCCCGCAGTCCTGGCTCTCGAGGCGACTGGCGTCGATGTGGACAACCGGTTCTTTCAAGGCGTTCATTGG
GTTCGGTGCAGGCTGGAGGAGGTTAGAAGGGAGAGCATTAAGCGGTATTCCGGCACGAGGTCCAATGGAGCGGCA
TGA
Gene >Hirsu2|1767
ATGTTGGTCGCGGCTTATCTCCGCCAAGGCTTGGGCCTGCTCGCGCCCTTGGCGATAGCCTGCACCGTCTACCTC
TATCTGTATCCCTTCTTCAACCGATGTGCCTTTCCCGTCGAATCCAGAGACGCCGAGGAAGCCTTCGCCAAGACG
AAAAGCCTGCATTGGCCGTTTGCTGACTCCAAGACGGATCATGTGCTGGACGAGCTCGCGCCCTTCCGCCTGCTC
GCCCTGGGCGACCCCCAACTCGAGGGGGACACGTCCGTCCCGATAGCCTACCTGGGCGTGCTTCCTCACTTGAAG
AGCCTCGCGCAGCGCCTGACCTTCCAAATCGAGCATCCGTTCTTCCGAGACCGCGTCCGCATGATCCTTCACGAT
ATCATCGACCTGTTCCTTGAAGACATTCCCAATATTTTCGAGTCGCTCCGCAAGCGTTTCGATCTCTTCGGGAAC
GATTTCTACCTGGCGCACATCTACCGTACGCTTCACTGGTGGTCGCGCCCGACTCACGTCTCCGTTCTCGGTGAC
TTGCTGGGCAGTCAGTGGATCGAGGACCCGGAGTTTGAGCAGAGGGGACGACGGTTCTGGGAAAGAACTTTCAGA
GGGGGAGAGAGGGTTCCAGACGATGTGGCCGTGTTTCCAGCGCAGGAATACAACATATCAGGCATCCTGGACGGG
TCGATCAAAGAAGAAGTCTGGACCAGGAGGATAATGAACGTTGCGGGCAATCACGACATTGGCTATGCTGGGGAC
TTGACGCCGGAACGCATGGAGCGGTTCGAGCGGGTCTTTGGCAAGGCCAACTACGAGCTTCGCTTCGCGCTCCCC
GTCCGAAATGCCGAGGCCAATGCCACAATTCGCAACAGCGAGACGAACCCGGAGTCTATGCGTCTGCCTCCGCAA
ATCAGGGTTCTCGTACTCAACGACATGAATCTCGACACGCCAGCCAAAGACCAGGCGCTACAAGACGCAACGTAC
CAGTTCATCAATGCCGCCATCGGCTCCTCCGCCGCTGTCGAACACCACGGTCAATTCACGCTCGTGCTCACTCAC
ATTCCCATGCACAAGCCCGATGGCGTCTGCGTCGACGGCCCCATGTTCGAATTCCACACACCGGAGGACGGCGGA
GGAGTGAGGGAGCAGTACTTGCTCAGCTCCGATGCGAGCAAGGGTCTCCTTGAGGGCGTGTTTGGTCTCAGCGGA
AACCCAGGTGCGCCCGGCAATGGTCTGGGCCGCAGCGGCCTCGTGCTGAACGGACACGACCATGAAGGGTGTGAC
ACGTATCATTTCATCAATCAAACTAACGGCACCGAGGTGGCAGACCGCTCGTGGGAGGCAGTGAGATGGGCCGAC
GCTCAAGCTCGGGCCCTACCCAAACAGTACATGGTGCCCGGCCGGCGTGAGATTACCGTTCGAAGCATGATGGGC
GACTTCGGCGGCAACGCGGGCCTGCTCAGTATGTGGTTCAACGAGAGCACCTGGGAGTGGGAGTACGAATACACG
GACTGTCCTCTTGGCAGACAGCATTTCTGGTGGTTGACCCACTTTCTCGTCATGGGCGTCGTTTTGTGTGCCCTG
CTTTATCCCGCAGTCCTGGCTCTCGAGGCGACTGGCGTCGATGTGGACAACCGGTTCTTTCAAGGCGTTCATTGG
GTTCGGTGCAGGCTGGAGGAGGTTAGAAGGGAGAGCATTAAGCGGTATTCCGGCACGAGGTCCAATGGAGCGGCA
TGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail