Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1760
Gene name
LocationContig_14:34811..36088
Strand+
Gene length (bp)1277
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04652 Vta1 Vta1 like 2.5E-49 14 157
PF18097 Vta1_C Vta1 C-terminal domain 2.9E-18 339 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13703|VTA1_SCHPO Vacuolar protein sorting-associated protein vts1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vts1 PE=3 SV=2 17 374 9.0E-24
sp|Q32L63|VTA1_BOVIN Vacuolar protein sorting-associated protein VTA1 homolog OS=Bos taurus GN=VTA1 PE=2 SV=1 4 374 1.0E-19
sp|Q9CR26|VTA1_MOUSE Vacuolar protein sorting-associated protein VTA1 homolog OS=Mus musculus GN=Vta1 PE=1 SV=1 29 374 1.0E-17
sp|Q9SZ15|LIP5_ARATH Protein HOMOLOG OF MAMMALIAN LYST-INTERACTING PROTEIN 5 OS=Arabidopsis thaliana GN=LIP5 PE=1 SV=1 17 166 1.0E-16
sp|Q5R5W5|VTA1_PONAB Vacuolar protein sorting-associated protein VTA1 homolog OS=Pongo abelii GN=VTA1 PE=2 SV=1 29 161 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13703|VTA1_SCHPO Vacuolar protein sorting-associated protein vts1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vts1 PE=3 SV=2 17 374 9.0E-24
sp|Q32L63|VTA1_BOVIN Vacuolar protein sorting-associated protein VTA1 homolog OS=Bos taurus GN=VTA1 PE=2 SV=1 4 374 1.0E-19
sp|Q9CR26|VTA1_MOUSE Vacuolar protein sorting-associated protein VTA1 homolog OS=Mus musculus GN=Vta1 PE=1 SV=1 29 374 1.0E-17
sp|Q9SZ15|LIP5_ARATH Protein HOMOLOG OF MAMMALIAN LYST-INTERACTING PROTEIN 5 OS=Arabidopsis thaliana GN=LIP5 PE=1 SV=1 17 166 1.0E-16
sp|Q5R5W5|VTA1_PONAB Vacuolar protein sorting-associated protein VTA1 homolog OS=Pongo abelii GN=VTA1 PE=2 SV=1 29 161 2.0E-13
sp|Q9NP79|VTA1_HUMAN Vacuolar protein sorting-associated protein VTA1 homolog OS=Homo sapiens GN=VTA1 PE=1 SV=1 29 161 2.0E-13
sp|Q55B11|VTA1_DICDI Vacuolar protein sorting-associated protein VTA1 homolog OS=Dictyostelium discoideum GN=vta1 PE=3 SV=1 17 180 9.0E-12
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.668 0.572 0.0413 0.0939 0.0964 0.0014 0.0625 0.2667 0.114 0.0072

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1801
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4580
Ophiocordyceps australis map64 (Brazil) OphauB2|7810
Ophiocordyceps camponoti-floridani Ophcf2|05904
Ophiocordyceps camponoti-rufipedis Ophun1|2165
Ophiocordyceps kimflemingae Ophio5|4847
Ophiocordyceps subramaniannii Hirsu2|1760 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1760
MTEPLPAALKTPEVSRFINRANQLRAIKPAIAYWCEYHAVNQIVGRGLHTTDDDCFNFTRTLIERLEATKAERAD
DDAIVDNDAGQAYVEQFAQETFGRAERTLRANKVTRQTADTFDAAATFFDLTHEWGAPEQEILQKIKFAKWNAAR
ILKAIREGKDPNESNPKLAASEPPEQTLQLDDPSVQQILSPRPLPASVEDVPDAPDAPHQPLVSPPPVQEEYFPP
RPSAPPDPPIFAPADPSQGPESSREPPPMSPAQDFAPSAPPQIPAHLSPQSPAHLPSHFPPPFPPQAPSPGISSP
PAWSPAQAAAPPAAAVPPAFLGGAPTPIVAQAAPTMNSRDINQAQKHAKWAISALNFEDVPTAISELRNALAMLG
AR*
Coding >Hirsu2|1760
ATGACGGAGCCGCTGCCCGCCGCCCTCAAGACGCCCGAGGTGAGCCGGTTCATCAACCGCGCCAACCAGCTGCGC
GCCATCAAGCCGGCCATTGCCTACTGGTGCGAGTACCACGCGGTCAACCAGATCGTCGGCAGGGGCCTGCACACA
ACCGACGACGACTGCTTCAACTTCACCCGCACGCTCATCGAGCGCCTCGAGGCGACCAAGGCCGAGCGCGCCGAC
GACGATGCCATCGTCGACAACGACGCCGGCCAGGCCTATGTCGAGCAGTTTGCCCAGGAGACTTTTGGCCGTGCC
GAACGCACCCTGCGCGCCAACAAGGTGACGAGGCAAACGGCCGACACGTTCGATGCGGCCGCCACCTTCTTCGAC
CTGACCCACGAATGGGGCGCCCCCGAGCAGGAGATACTGCAGAAAATCAAGTTCGCCAAGTGGAATGCGGCGCGC
ATCCTCAAGGCCATCCGCGAGGGCAAGGACCCCAACGAGAGCAACCCCAAACTCGCAGCCTCGGAGCCGCCGGAG
CAAACACTGCAACTCGACGATCCGTCCGTCCAGCAGATCCTCAGCCCGCGCCCACTGCCGGCGTCTGTCGAGGAC
GTGCCCGACGCCCCAGATGCGCCTCACCAACCGCTCGTGTCCCCGCCGCCCGTCCAGGAGGAATATTTCCCCCCG
CGGCCGTCTGCGCCCCCCGACCCTCCAATATTTGCACCCGCAGACCCGAGCCAGGGCCCGGAATCATCGCGCGAA
CCCCCTCCAATGTCCCCTGCGCAAGACTTTGCGCCGTCTGCGCCGCCTCAAATCCCGGCCCATCTGTCTCCTCAG
AGTCCTGCACACCTGCCGTCCCATTTCCCTCCGCCTTTCCCCCCCCAAGCACCCAGCCCCGGCATATCGAGCCCG
CCGGCTTGGAGCCCAGCACAAGCCGCGGCACCCCCGGCCGCCGCAGTCCCCCCTGCTTTCCTCGGAGGCGCCCCG
ACCCCTATTGTCGCCCAAGCAGCCCCAACTATGAATTCCCGAGATATTAACCAGGCGCAAAAGCACGCCAAGTGG
GCCATCTCCGCGTTGAACTTTGAGGATGTGCCGACAGCTATAAGCGAACTGAGGAACGCCCTGGCCATGCTGGGG
GCGCGGTAG
Transcript >Hirsu2|1760
ATGACGGAGCCGCTGCCCGCCGCCCTCAAGACGCCCGAGGTGAGCCGGTTCATCAACCGCGCCAACCAGCTGCGC
GCCATCAAGCCGGCCATTGCCTACTGGTGCGAGTACCACGCGGTCAACCAGATCGTCGGCAGGGGCCTGCACACA
ACCGACGACGACTGCTTCAACTTCACCCGCACGCTCATCGAGCGCCTCGAGGCGACCAAGGCCGAGCGCGCCGAC
GACGATGCCATCGTCGACAACGACGCCGGCCAGGCCTATGTCGAGCAGTTTGCCCAGGAGACTTTTGGCCGTGCC
GAACGCACCCTGCGCGCCAACAAGGTGACGAGGCAAACGGCCGACACGTTCGATGCGGCCGCCACCTTCTTCGAC
CTGACCCACGAATGGGGCGCCCCCGAGCAGGAGATACTGCAGAAAATCAAGTTCGCCAAGTGGAATGCGGCGCGC
ATCCTCAAGGCCATCCGCGAGGGCAAGGACCCCAACGAGAGCAACCCCAAACTCGCAGCCTCGGAGCCGCCGGAG
CAAACACTGCAACTCGACGATCCGTCCGTCCAGCAGATCCTCAGCCCGCGCCCACTGCCGGCGTCTGTCGAGGAC
GTGCCCGACGCCCCAGATGCGCCTCACCAACCGCTCGTGTCCCCGCCGCCCGTCCAGGAGGAATATTTCCCCCCG
CGGCCGTCTGCGCCCCCCGACCCTCCAATATTTGCACCCGCAGACCCGAGCCAGGGCCCGGAATCATCGCGCGAA
CCCCCTCCAATGTCCCCTGCGCAAGACTTTGCGCCGTCTGCGCCGCCTCAAATCCCGGCCCATCTGTCTCCTCAG
AGTCCTGCACACCTGCCGTCCCATTTCCCTCCGCCTTTCCCCCCCCAAGCACCCAGCCCCGGCATATCGAGCCCG
CCGGCTTGGAGCCCAGCACAAGCCGCGGCACCCCCGGCCGCCGCAGTCCCCCCTGCTTTCCTCGGAGGCGCCCCG
ACCCCTATTGTCGCCCAAGCAGCCCCAACTATGAATTCCCGAGATATTAACCAGGCGCAAAAGCACGCCAAGTGG
GCCATCTCCGCGTTGAACTTTGAGGATGTGCCGACAGCTATAAGCGAACTGAGGAACGCCCTGGCCATGCTGGGG
GCGCGGTAG
Gene >Hirsu2|1760
ATGACGGAGCCGCTGCCCGCCGCCCTCAAGACGCCCGAGGTGAGCCGGTTCATCAACCGCGCCAACCAGCTGCGC
GCCATCAAGCCGGCCATTGCCTACTGGTGTCCGTCGCTCCTCTGCCTCGTCCGTGCCGGTCCAAGAGCTCACAGA
ATCCCCCAGGCGAGTACCACGCGGTCAACCAGATCGTCGGCAGGGGCCTGCACACAACCGACGACGACTGCTTCA
ACTTCACCCGCACGCTCATCGAGCGCCTCGAGGCGACCAAGGCCGAGCGCGCCGACGACGATGCCATCGTCGACA
ACGACGCCGGCCAGGCCTATGTCGAGCAGTTTGCCCAGGAGACTTTTGGCCGTGCCGAACGCACCCTGCGCGCCA
ACAAGGTGACGAGGTGAGGCCGTCGTCATGCAAACACCCCCCTCCCTCCCTGCTTCCTTGCTTGCCTTGCTCAAT
ACCCGCTTTCTTGGCCGCCCAACAGGCAAACGGCCGACACGTTCGATGCGGCCGCCACCTTCTTCGACCTGACCC
ACGAATGGGGCGCCCCCGAGCAGGAGATACTGCAGAAAATCAAGTTCGCCAAGTGGAATGCGGCGCGCATCCTCA
AGGCCATCCGCGAGGGCAAGGACCCCAACGAGAGCAACCCCAAACTCGCAGCCTCGGAGCCGCCGGAGCAAACAC
TGCAACTCGACGATCCGTCCGTCCAGCAGATCCTCAGCCCGCGCCCACTGCCGGCGTCTGTCGAGGACGTGCCCG
ACGCCCCAGATGCGCCTCACCAACCGCTCGTGTCCCCGCCGCCCGTCCAGGAGGAATATTTCCCCCCGCGGCCGT
CTGCGCCCCCCGACCCTCCAATATTTGCACCCGCAGACCCGAGCCAGGGCCCGGAATCATCGCGCGAACCCCCTC
CAATGTCCCCTGCGCAAGACTTTGCGCCGTCTGCGCCGCCTCAAATCCCGGCCCATCTGTCTCCTCAGAGTCCTG
CACACCTGCCGTCCCATTTCCCTCCGCCTTTCCCCCCCCAAGCACCCAGCCCCGGCATATCGAGCCCGCCGGCTT
GGAGCCCAGCACAAGCCGCGGCACCCCCGGCCGCCGCAGTCCCCCCTGCTTTCCTCGGAGGCGCCCCGACCCCTA
TTGTCGCCCAAGCAGCCCCAACTATGAATTCCCGAGATATTAACCAGGCGCAAAAGCACGCCAAGTGGGCCATCT
CCGCGTTGAACTTTGAGGATGTGCCGACAGCTATAAGCGAACTGAGGAACGCCCTGGCCATGCTGGGGGCGCGGT
AG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail