Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1760
Gene name
LocationContig_14:34811..36088
Strand+
Gene length (bp)1277
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04652 Vta1 Vta1 like 1.6E-49 14 157
PF18097 Vta1_C Vta1 C-terminal domain 1.8E-18 339 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13703|VTA1_SCHPO Vacuolar protein sorting-associated protein vts1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vts1 PE=3 SV=2 17 374 9.0E-24
sp|Q32L63|VTA1_BOVIN Vacuolar protein sorting-associated protein VTA1 homolog OS=Bos taurus GN=VTA1 PE=2 SV=1 4 374 1.0E-19
sp|Q9CR26|VTA1_MOUSE Vacuolar protein sorting-associated protein VTA1 homolog OS=Mus musculus GN=Vta1 PE=1 SV=1 29 374 1.0E-17
sp|Q9SZ15|LIP5_ARATH Protein HOMOLOG OF MAMMALIAN LYST-INTERACTING PROTEIN 5 OS=Arabidopsis thaliana GN=LIP5 PE=1 SV=1 17 166 1.0E-16
sp|Q5R5W5|VTA1_PONAB Vacuolar protein sorting-associated protein VTA1 homolog OS=Pongo abelii GN=VTA1 PE=2 SV=1 29 161 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13703|VTA1_SCHPO Vacuolar protein sorting-associated protein vts1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vts1 PE=3 SV=2 17 374 9.0E-24
sp|Q32L63|VTA1_BOVIN Vacuolar protein sorting-associated protein VTA1 homolog OS=Bos taurus GN=VTA1 PE=2 SV=1 4 374 1.0E-19
sp|Q9CR26|VTA1_MOUSE Vacuolar protein sorting-associated protein VTA1 homolog OS=Mus musculus GN=Vta1 PE=1 SV=1 29 374 1.0E-17
sp|Q9SZ15|LIP5_ARATH Protein HOMOLOG OF MAMMALIAN LYST-INTERACTING PROTEIN 5 OS=Arabidopsis thaliana GN=LIP5 PE=1 SV=1 17 166 1.0E-16
sp|Q5R5W5|VTA1_PONAB Vacuolar protein sorting-associated protein VTA1 homolog OS=Pongo abelii GN=VTA1 PE=2 SV=1 29 161 2.0E-13
sp|Q9NP79|VTA1_HUMAN Vacuolar protein sorting-associated protein VTA1 homolog OS=Homo sapiens GN=VTA1 PE=1 SV=1 29 161 2.0E-13
sp|Q55B11|VTA1_DICDI Vacuolar protein sorting-associated protein VTA1 homolog OS=Dictyostelium discoideum GN=vta1 PE=3 SV=1 17 180 9.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1760
MTEPLPAALKTPEVSRFINRANQLRAIKPAIAYWCEYHAVNQIVGRGLHTTDDDCFNFTRTLIERLEATKAERAD
DDAIVDNDAGQAYVEQFAQETFGRAERTLRANKVTRQTADTFDAAATFFDLTHEWGAPEQEILQKIKFAKWNAAR
ILKAIREGKDPNESNPKLAASEPPEQTLQLDDPSVQQILSPRPLPASVEDVPDAPDAPHQPLVSPPPVQEEYFPP
RPSAPPDPPIFAPADPSQGPESSREPPPMSPAQDFAPSAPPQIPAHLSPQSPAHLPSHFPPPFPPQAPSPGISSP
PAWSPAQAAAPPAAAVPPAFLGGAPTPIVAQAAPTMNSRDINQAQKHAKWAISALNFEDVPTAISELRNALAMLG
AR*
Coding >Hirsu2|1760
ATGACGGAGCCGCTGCCCGCCGCCCTCAAGACGCCCGAGGTGAGCCGGTTCATCAACCGCGCCAACCAGCTGCGC
GCCATCAAGCCGGCCATTGCCTACTGGTGCGAGTACCACGCGGTCAACCAGATCGTCGGCAGGGGCCTGCACACA
ACCGACGACGACTGCTTCAACTTCACCCGCACGCTCATCGAGCGCCTCGAGGCGACCAAGGCCGAGCGCGCCGAC
GACGATGCCATCGTCGACAACGACGCCGGCCAGGCCTATGTCGAGCAGTTTGCCCAGGAGACTTTTGGCCGTGCC
GAACGCACCCTGCGCGCCAACAAGGTGACGAGGCAAACGGCCGACACGTTCGATGCGGCCGCCACCTTCTTCGAC
CTGACCCACGAATGGGGCGCCCCCGAGCAGGAGATACTGCAGAAAATCAAGTTCGCCAAGTGGAATGCGGCGCGC
ATCCTCAAGGCCATCCGCGAGGGCAAGGACCCCAACGAGAGCAACCCCAAACTCGCAGCCTCGGAGCCGCCGGAG
CAAACACTGCAACTCGACGATCCGTCCGTCCAGCAGATCCTCAGCCCGCGCCCACTGCCGGCGTCTGTCGAGGAC
GTGCCCGACGCCCCAGATGCGCCTCACCAACCGCTCGTGTCCCCGCCGCCCGTCCAGGAGGAATATTTCCCCCCG
CGGCCGTCTGCGCCCCCCGACCCTCCAATATTTGCACCCGCAGACCCGAGCCAGGGCCCGGAATCATCGCGCGAA
CCCCCTCCAATGTCCCCTGCGCAAGACTTTGCGCCGTCTGCGCCGCCTCAAATCCCGGCCCATCTGTCTCCTCAG
AGTCCTGCACACCTGCCGTCCCATTTCCCTCCGCCTTTCCCCCCCCAAGCACCCAGCCCCGGCATATCGAGCCCG
CCGGCTTGGAGCCCAGCACAAGCCGCGGCACCCCCGGCCGCCGCAGTCCCCCCTGCTTTCCTCGGAGGCGCCCCG
ACCCCTATTGTCGCCCAAGCAGCCCCAACTATGAATTCCCGAGATATTAACCAGGCGCAAAAGCACGCCAAGTGG
GCCATCTCCGCGTTGAACTTTGAGGATGTGCCGACAGCTATAAGCGAACTGAGGAACGCCCTGGCCATGCTGGGG
GCGCGGTAG
Transcript >Hirsu2|1760
ATGACGGAGCCGCTGCCCGCCGCCCTCAAGACGCCCGAGGTGAGCCGGTTCATCAACCGCGCCAACCAGCTGCGC
GCCATCAAGCCGGCCATTGCCTACTGGTGCGAGTACCACGCGGTCAACCAGATCGTCGGCAGGGGCCTGCACACA
ACCGACGACGACTGCTTCAACTTCACCCGCACGCTCATCGAGCGCCTCGAGGCGACCAAGGCCGAGCGCGCCGAC
GACGATGCCATCGTCGACAACGACGCCGGCCAGGCCTATGTCGAGCAGTTTGCCCAGGAGACTTTTGGCCGTGCC
GAACGCACCCTGCGCGCCAACAAGGTGACGAGGCAAACGGCCGACACGTTCGATGCGGCCGCCACCTTCTTCGAC
CTGACCCACGAATGGGGCGCCCCCGAGCAGGAGATACTGCAGAAAATCAAGTTCGCCAAGTGGAATGCGGCGCGC
ATCCTCAAGGCCATCCGCGAGGGCAAGGACCCCAACGAGAGCAACCCCAAACTCGCAGCCTCGGAGCCGCCGGAG
CAAACACTGCAACTCGACGATCCGTCCGTCCAGCAGATCCTCAGCCCGCGCCCACTGCCGGCGTCTGTCGAGGAC
GTGCCCGACGCCCCAGATGCGCCTCACCAACCGCTCGTGTCCCCGCCGCCCGTCCAGGAGGAATATTTCCCCCCG
CGGCCGTCTGCGCCCCCCGACCCTCCAATATTTGCACCCGCAGACCCGAGCCAGGGCCCGGAATCATCGCGCGAA
CCCCCTCCAATGTCCCCTGCGCAAGACTTTGCGCCGTCTGCGCCGCCTCAAATCCCGGCCCATCTGTCTCCTCAG
AGTCCTGCACACCTGCCGTCCCATTTCCCTCCGCCTTTCCCCCCCCAAGCACCCAGCCCCGGCATATCGAGCCCG
CCGGCTTGGAGCCCAGCACAAGCCGCGGCACCCCCGGCCGCCGCAGTCCCCCCTGCTTTCCTCGGAGGCGCCCCG
ACCCCTATTGTCGCCCAAGCAGCCCCAACTATGAATTCCCGAGATATTAACCAGGCGCAAAAGCACGCCAAGTGG
GCCATCTCCGCGTTGAACTTTGAGGATGTGCCGACAGCTATAAGCGAACTGAGGAACGCCCTGGCCATGCTGGGG
GCGCGGTAG
Gene >Hirsu2|1760
ATGACGGAGCCGCTGCCCGCCGCCCTCAAGACGCCCGAGGTGAGCCGGTTCATCAACCGCGCCAACCAGCTGCGC
GCCATCAAGCCGGCCATTGCCTACTGGTGTCCGTCGCTCCTCTGCCTCGTCCGTGCCGGTCCAAGAGCTCACAGA
ATCCCCCAGGCGAGTACCACGCGGTCAACCAGATCGTCGGCAGGGGCCTGCACACAACCGACGACGACTGCTTCA
ACTTCACCCGCACGCTCATCGAGCGCCTCGAGGCGACCAAGGCCGAGCGCGCCGACGACGATGCCATCGTCGACA
ACGACGCCGGCCAGGCCTATGTCGAGCAGTTTGCCCAGGAGACTTTTGGCCGTGCCGAACGCACCCTGCGCGCCA
ACAAGGTGACGAGGTGAGGCCGTCGTCATGCAAACACCCCCCTCCCTCCCTGCTTCCTTGCTTGCCTTGCTCAAT
ACCCGCTTTCTTGGCCGCCCAACAGGCAAACGGCCGACACGTTCGATGCGGCCGCCACCTTCTTCGACCTGACCC
ACGAATGGGGCGCCCCCGAGCAGGAGATACTGCAGAAAATCAAGTTCGCCAAGTGGAATGCGGCGCGCATCCTCA
AGGCCATCCGCGAGGGCAAGGACCCCAACGAGAGCAACCCCAAACTCGCAGCCTCGGAGCCGCCGGAGCAAACAC
TGCAACTCGACGATCCGTCCGTCCAGCAGATCCTCAGCCCGCGCCCACTGCCGGCGTCTGTCGAGGACGTGCCCG
ACGCCCCAGATGCGCCTCACCAACCGCTCGTGTCCCCGCCGCCCGTCCAGGAGGAATATTTCCCCCCGCGGCCGT
CTGCGCCCCCCGACCCTCCAATATTTGCACCCGCAGACCCGAGCCAGGGCCCGGAATCATCGCGCGAACCCCCTC
CAATGTCCCCTGCGCAAGACTTTGCGCCGTCTGCGCCGCCTCAAATCCCGGCCCATCTGTCTCCTCAGAGTCCTG
CACACCTGCCGTCCCATTTCCCTCCGCCTTTCCCCCCCCAAGCACCCAGCCCCGGCATATCGAGCCCGCCGGCTT
GGAGCCCAGCACAAGCCGCGGCACCCCCGGCCGCCGCAGTCCCCCCTGCTTTCCTCGGAGGCGCCCCGACCCCTA
TTGTCGCCCAAGCAGCCCCAACTATGAATTCCCGAGATATTAACCAGGCGCAAAAGCACGCCAAGTGGGCCATCT
CCGCGTTGAACTTTGAGGATGTGCCGACAGCTATAAGCGAACTGAGGAACGCCCTGGCCATGCTGGGGGCGCGGT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail