Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1756
Gene name
LocationContig_14:25104..28721
Strand+
Gene length (bp)3617
Transcript length (bp)3171
Coding sequence length (bp)3171
Protein length (aa) 1057

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 8.9E-77 510 782
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 2.2E-43 52 200
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 4.3E-24 223 498
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 3.6E-24 957 1048

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 402 1053 4.0E-101
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 407 1040 4.0E-87
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 403 820 2.0E-76
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 66 281 3.0E-40
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 413 834 8.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 402 1053 4.0E-101
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 407 1040 4.0E-87
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 403 820 2.0E-76
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 66 281 3.0E-40
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 413 834 8.0E-34
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 69 315 2.0E-33
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 46 308 2.0E-32
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 416 865 2.0E-29
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 410 844 3.0E-27
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 413 898 8.0E-26
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 388 842 1.0E-25
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 411 842 2.0E-25
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 408 783 2.0E-24
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 416 898 1.0E-23
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 416 783 3.0E-23
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 416 842 6.0E-23
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 416 817 1.0E-22
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 416 842 5.0E-20
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 416 784 5.0E-20
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 416 849 5.0E-18
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 417 800 3.0E-16
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 415 820 7.0E-15
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 456 892 2.0E-12
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 457 787 3.0E-12
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 64 232 3.0E-08
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 79 232 5.0E-07
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 97 276 7.0E-07
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 65 232 8.0E-07
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 79 232 1.0E-06
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 70 276 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 52 74 22
2 135 157 22
3 179 198 19
4 512 534 22
5 562 584 22
6 605 627 22
7 653 675 22
8 715 737 22
9 762 784 22
10 791 813 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1756
MANERHWLRGRGFLDIFKDNSDPRVGAGREDSSGGGTLSTASNNKSSSLSKLAATFIPVLIYLVVCFVIFVVLRR
RCKRVYAPRTFAGLRAPEIPSPALPGGWLNWIIPFFKIPDSFVLNHGSLDGFFFLRFLKVLRNICLGGCLILWPV
LFPIHATGGGELTELDLLTIGNVKNPKKLYAHAVMAWVFFGFVLYMIVRECIYYVNLRQAYLSSPYYAQRISSRT
ILLTCIPKAYLDERRLRKLYGDSVKRVHIPRTSKALVNLIKEREQTATRLEKAEVELILKTNKAMRKQLKKTAKS
NRKNPPQPGATDSLASRQDLVSARSDSGTDQIPRGGHLVVELPGSYIEFDPSNEKPADDEVILEDIVKTDVQGEV
TKEDDDEYVHPYGLDPGLPDVRGSVAATWIPVEARPYHRPLGNFGRRVDTIRWTRNRLRELNVQIFKMRRQVRRG
DGVTLPAAFIEFDTQESAQAAHQVLAHHRPLQMSSRILGIHPEEVLWKSLRMSWWERIIRSFAILSLVSAAVVFW
SIPSAAIGLISQIDFLAKNVVFLAWIKKLPKLVLGFLQGFIPSIALSLWMAAVPIMLRICGAQAGIPSSTMVELF
VQKAYFAFQVVQVFLVTTLTSAASAAFTSILENPIKAKDILAKNLPMASNFYLSYILVQCLLSSGTNLLQVFSLI
RHYALARFTTLPRAQYKAWRQLPPARWGGIFPVFANMGVIALSYACIAPLILIFAAGGMAVMHVVWRYNLIFVFD
SGMDSKGLFYPHALLHLTIGLYLAEICLIGLFALHLSFGPLALMVMFFIFTGLVHHSLSHAIAPLLQNLPQTLPL
EEEIQQEEKAAAERAREQATARTDEDQGAGAGAASSYYDPEQAFGDEDQRLDDDRDEEEEETEDDEATVTNDRAL
EGASGVKAAFTEWVKSSTKSKLQSQIEKLGLPDMLDKLRFWDSDKYGEGPPSFLARWLHPEEYEDFIALRRMIPP
DSLPNIDYPEDHKYCDYLPPEIWVSKPTLWIPRDDARVSRQEVAHTRKYTPISDHGAVLDEKGRMFVHFDQAPFD
RSKIII*
Coding >Hirsu2|1756
ATGGCCAACGAGCGGCATTGGCTCCGGGGACGAGGCTTCCTGGATATCTTTAAAGATAATAGCGATCCGCGGGTC
GGTGCTGGCCGCGAAGACTCGTCCGGCGGGGGCACGCTAAGCACGGCGTCCAACAACAAGTCGTCGTCGCTCAGC
AAGCTCGCCGCCACCTTCATCCCCGTCCTCATCTACCTCGTCGTCTGCTTCGTCATATTCGTCGTACTGCGCCGC
CGATGCAAGCGCGTCTATGCGCCGAGAACCTTTGCCGGCCTTCGGGCCCCCGAGATTCCGAGCCCGGCCTTACCC
GGAGGCTGGTTGAACTGGATCATCCCTTTCTTCAAGATACCCGACTCTTTCGTTCTCAACCATGGCTCGCTTGAC
GGCTTCTTCTTCCTCCGCTTCCTCAAAGTGCTACGAAACATATGCCTCGGCGGTTGTCTCATCCTCTGGCCGGTC
CTCTTCCCGATCCACGCCACCGGCGGCGGCGAGCTCACCGAGCTCGACCTGTTGACCATCGGCAATGTCAAGAAC
CCAAAGAAGTTGTACGCCCACGCGGTCATGGCCTGGGTGTTTTTTGGATTCGTCTTGTACATGATTGTGCGCGAG
TGTATCTACTACGTCAACCTCCGCCAGGCATACCTCTCTTCGCCCTACTACGCACAGCGCATCTCCTCTCGCACC
ATTCTCTTGACCTGCATTCCCAAGGCCTACCTCGACGAGCGTCGTCTCCGCAAGCTCTACGGCGACTCCGTCAAG
CGCGTTCACATCCCGCGCACATCCAAGGCGCTGGTCAACCTGATCAAGGAGCGGGAGCAGACGGCGACGAGGCTG
GAGAAGGCCGAGGTCGAGCTGATCCTCAAGACGAACAAGGCGATGCGGAAGCAGCTCAAGAAGACGGCCAAGTCG
AACCGGAAGAACCCCCCGCAGCCCGGCGCCACCGACTCGCTCGCATCGAGACAAGATCTCGTCTCCGCCCGGAGC
GACAGCGGCACGGACCAGATCCCGCGTGGCGGCCACCTCGTCGTCGAGCTGCCCGGCTCCTATATCGAATTCGAC
CCGTCCAACGAGAAGCCCGCCGACGACGAGGTCATCCTCGAAGACATCGTCAAGACCGATGTCCAGGGTGAGGTG
ACCAAGGAGGACGACGACGAATACGTGCATCCCTACGGCCTCGATCCCGGCCTCCCGGACGTCCGGGGCTCGGTC
GCCGCCACATGGATCCCGGTCGAGGCTCGGCCCTACCACCGGCCGCTGGGCAACTTCGGCCGCCGCGTCGACACG
ATCCGCTGGACGCGCAATCGGCTGCGGGAACTCAACGTCCAGATCTTCAAGATGCGCCGGCAGGTCCGCCGCGGC
GACGGGGTCACGCTGCCAGCCGCCTTCATCGAGTTCGACACGCAGGAGAGCGCCCAGGCGGCGCACCAAGTCCTC
GCCCACCACCGGCCGTTGCAGATGTCGTCCAGGATCCTCGGCATCCACCCCGAGGAAGTGCTGTGGAAGTCGCTG
AGGATGTCGTGGTGGGAGCGCATCATTCGCAGCTTTGCCATCCTCTCTCTCGTCTCCGCCGCTGTCGTCTTCTGG
TCCATCCCTTCGGCCGCCATAGGACTCATCTCTCAGATCGACTTCTTGGCCAAGAACGTCGTCTTCCTTGCCTGG
ATCAAGAAGCTTCCCAAATTAGTCCTCGGCTTTCTACAGGGATTCATCCCTTCGATAGCCCTGTCCTTGTGGATG
GCGGCGGTACCCATCATGCTCCGAATTTGCGGCGCGCAAGCAGGCATCCCATCGTCCACTATGGTCGAGCTTTTC
GTCCAGAAAGCATATTTTGCCTTCCAAGTCGTCCAAGTTTTCCTCGTCACAACTCTCACTTCGGCCGCCTCGGCC
GCCTTTACCAGCATCCTTGAAAACCCCATCAAAGCGAAGGACATTCTCGCGAAGAACCTGCCCATGGCATCCAAC
TTTTATCTTTCCTATATCCTGGTCCAATGCCTCCTTAGCAGCGGGACAAATCTGTTGCAGGTGTTTTCGTTGATC
CGCCACTATGCCCTCGCCCGGTTCACGACTCTGCCTCGCGCGCAGTACAAGGCCTGGCGCCAGCTTCCGCCCGCT
CGGTGGGGCGGGATATTTCCTGTTTTTGCAAACATGGGAGTCATCGCTCTGAGTTACGCATGCATAGCCCCTTTA
ATCCTCATCTTCGCCGCCGGCGGCATGGCTGTCATGCACGTTGTGTGGCGGTACAACCTGATATTTGTCTTCGAC
TCCGGCATGGATAGCAAGGGCCTGTTCTATCCACATGCCCTATTACACTTGACCATCGGCCTGTACCTGGCCGAG
ATATGTCTCATAGGCCTCTTTGCTCTTCACCTGTCCTTCGGGCCCCTCGCGCTGATGGTCATGTTTTTCATATTT
ACCGGTCTGGTGCACCATTCGCTCAGCCACGCGATCGCGCCACTCCTCCAGAACTTGCCGCAGACACTGCCCCTT
GAGGAAGAGATACAACAGGAGGAGAAGGCGGCGGCGGAGAGAGCGCGTGAGCAAGCTACGGCCCGGACTGACGAG
GACCAGGGCGCAGGCGCCGGTGCCGCCAGCAGCTACTACGACCCGGAACAGGCCTTTGGCGACGAGGACCAGCGG
CTAGACGACGACAGGGACGAGGAAGAGGAGGAGACGGAGGACGACGAAGCGACGGTGACCAATGACCGAGCTCTC
GAAGGCGCGAGTGGCGTCAAAGCTGCCTTCACCGAGTGGGTCAAGTCGAGCACCAAGTCCAAGCTGCAGTCGCAG
ATCGAAAAGCTGGGCTTGCCAGACATGCTCGACAAGCTGCGCTTCTGGGACAGCGATAAGTACGGCGAGGGCCCG
CCGAGCTTCCTCGCCCGGTGGCTGCACCCCGAGGAGTACGAGGACTTCATCGCCCTGCGTCGGATGATCCCGCCC
GACAGCCTGCCCAACATTGACTATCCCGAGGACCACAAGTACTGCGACTACCTGCCGCCCGAGATATGGGTGTCG
AAGCCGACGTTGTGGATTCCCCGGGATGACGCTCGGGTCAGCCGGCAGGAGGTCGCGCACACGAGGAAATACACG
CCCATATCGGACCACGGAGCCGTCCTGGATGAAAAGGGCCGCATGTTCGTTCACTTCGACCAGGCACCATTTGAC
CGGTCCAAGATCATAATATAG
Transcript >Hirsu2|1756
ATGGCCAACGAGCGGCATTGGCTCCGGGGACGAGGCTTCCTGGATATCTTTAAAGATAATAGCGATCCGCGGGTC
GGTGCTGGCCGCGAAGACTCGTCCGGCGGGGGCACGCTAAGCACGGCGTCCAACAACAAGTCGTCGTCGCTCAGC
AAGCTCGCCGCCACCTTCATCCCCGTCCTCATCTACCTCGTCGTCTGCTTCGTCATATTCGTCGTACTGCGCCGC
CGATGCAAGCGCGTCTATGCGCCGAGAACCTTTGCCGGCCTTCGGGCCCCCGAGATTCCGAGCCCGGCCTTACCC
GGAGGCTGGTTGAACTGGATCATCCCTTTCTTCAAGATACCCGACTCTTTCGTTCTCAACCATGGCTCGCTTGAC
GGCTTCTTCTTCCTCCGCTTCCTCAAAGTGCTACGAAACATATGCCTCGGCGGTTGTCTCATCCTCTGGCCGGTC
CTCTTCCCGATCCACGCCACCGGCGGCGGCGAGCTCACCGAGCTCGACCTGTTGACCATCGGCAATGTCAAGAAC
CCAAAGAAGTTGTACGCCCACGCGGTCATGGCCTGGGTGTTTTTTGGATTCGTCTTGTACATGATTGTGCGCGAG
TGTATCTACTACGTCAACCTCCGCCAGGCATACCTCTCTTCGCCCTACTACGCACAGCGCATCTCCTCTCGCACC
ATTCTCTTGACCTGCATTCCCAAGGCCTACCTCGACGAGCGTCGTCTCCGCAAGCTCTACGGCGACTCCGTCAAG
CGCGTTCACATCCCGCGCACATCCAAGGCGCTGGTCAACCTGATCAAGGAGCGGGAGCAGACGGCGACGAGGCTG
GAGAAGGCCGAGGTCGAGCTGATCCTCAAGACGAACAAGGCGATGCGGAAGCAGCTCAAGAAGACGGCCAAGTCG
AACCGGAAGAACCCCCCGCAGCCCGGCGCCACCGACTCGCTCGCATCGAGACAAGATCTCGTCTCCGCCCGGAGC
GACAGCGGCACGGACCAGATCCCGCGTGGCGGCCACCTCGTCGTCGAGCTGCCCGGCTCCTATATCGAATTCGAC
CCGTCCAACGAGAAGCCCGCCGACGACGAGGTCATCCTCGAAGACATCGTCAAGACCGATGTCCAGGGTGAGGTG
ACCAAGGAGGACGACGACGAATACGTGCATCCCTACGGCCTCGATCCCGGCCTCCCGGACGTCCGGGGCTCGGTC
GCCGCCACATGGATCCCGGTCGAGGCTCGGCCCTACCACCGGCCGCTGGGCAACTTCGGCCGCCGCGTCGACACG
ATCCGCTGGACGCGCAATCGGCTGCGGGAACTCAACGTCCAGATCTTCAAGATGCGCCGGCAGGTCCGCCGCGGC
GACGGGGTCACGCTGCCAGCCGCCTTCATCGAGTTCGACACGCAGGAGAGCGCCCAGGCGGCGCACCAAGTCCTC
GCCCACCACCGGCCGTTGCAGATGTCGTCCAGGATCCTCGGCATCCACCCCGAGGAAGTGCTGTGGAAGTCGCTG
AGGATGTCGTGGTGGGAGCGCATCATTCGCAGCTTTGCCATCCTCTCTCTCGTCTCCGCCGCTGTCGTCTTCTGG
TCCATCCCTTCGGCCGCCATAGGACTCATCTCTCAGATCGACTTCTTGGCCAAGAACGTCGTCTTCCTTGCCTGG
ATCAAGAAGCTTCCCAAATTAGTCCTCGGCTTTCTACAGGGATTCATCCCTTCGATAGCCCTGTCCTTGTGGATG
GCGGCGGTACCCATCATGCTCCGAATTTGCGGCGCGCAAGCAGGCATCCCATCGTCCACTATGGTCGAGCTTTTC
GTCCAGAAAGCATATTTTGCCTTCCAAGTCGTCCAAGTTTTCCTCGTCACAACTCTCACTTCGGCCGCCTCGGCC
GCCTTTACCAGCATCCTTGAAAACCCCATCAAAGCGAAGGACATTCTCGCGAAGAACCTGCCCATGGCATCCAAC
TTTTATCTTTCCTATATCCTGGTCCAATGCCTCCTTAGCAGCGGGACAAATCTGTTGCAGGTGTTTTCGTTGATC
CGCCACTATGCCCTCGCCCGGTTCACGACTCTGCCTCGCGCGCAGTACAAGGCCTGGCGCCAGCTTCCGCCCGCT
CGGTGGGGCGGGATATTTCCTGTTTTTGCAAACATGGGAGTCATCGCTCTGAGTTACGCATGCATAGCCCCTTTA
ATCCTCATCTTCGCCGCCGGCGGCATGGCTGTCATGCACGTTGTGTGGCGGTACAACCTGATATTTGTCTTCGAC
TCCGGCATGGATAGCAAGGGCCTGTTCTATCCACATGCCCTATTACACTTGACCATCGGCCTGTACCTGGCCGAG
ATATGTCTCATAGGCCTCTTTGCTCTTCACCTGTCCTTCGGGCCCCTCGCGCTGATGGTCATGTTTTTCATATTT
ACCGGTCTGGTGCACCATTCGCTCAGCCACGCGATCGCGCCACTCCTCCAGAACTTGCCGCAGACACTGCCCCTT
GAGGAAGAGATACAACAGGAGGAGAAGGCGGCGGCGGAGAGAGCGCGTGAGCAAGCTACGGCCCGGACTGACGAG
GACCAGGGCGCAGGCGCCGGTGCCGCCAGCAGCTACTACGACCCGGAACAGGCCTTTGGCGACGAGGACCAGCGG
CTAGACGACGACAGGGACGAGGAAGAGGAGGAGACGGAGGACGACGAAGCGACGGTGACCAATGACCGAGCTCTC
GAAGGCGCGAGTGGCGTCAAAGCTGCCTTCACCGAGTGGGTCAAGTCGAGCACCAAGTCCAAGCTGCAGTCGCAG
ATCGAAAAGCTGGGCTTGCCAGACATGCTCGACAAGCTGCGCTTCTGGGACAGCGATAAGTACGGCGAGGGCCCG
CCGAGCTTCCTCGCCCGGTGGCTGCACCCCGAGGAGTACGAGGACTTCATCGCCCTGCGTCGGATGATCCCGCCC
GACAGCCTGCCCAACATTGACTATCCCGAGGACCACAAGTACTGCGACTACCTGCCGCCCGAGATATGGGTGTCG
AAGCCGACGTTGTGGATTCCCCGGGATGACGCTCGGGTCAGCCGGCAGGAGGTCGCGCACACGAGGAAATACACG
CCCATATCGGACCACGGAGCCGTCCTGGATGAAAAGGGCCGCATGTTCGTTCACTTCGACCAGGCACCATTTGAC
CGGTCCAAGATCATAATATAG
Gene >Hirsu2|1756
ATGGCCAACGAGCGGCATTGGCTCCGGGGACGAGGCTTCCTGGATATCTTTGTACGTCGCCCTCTCCCGCTGTCG
CTCACTCGATCAAGTCGCTCTCGGTCACCGATCACGGCGGCGTCATTCTGTCCCTAACCGTCCTCGCCACTCCCA
CCCGTGTAGAAAGATAATAGCGATCCGCGGGTCGGTGCTGGCCGCGAAGACTCGTCCGGCGGGGGCACGCTAAGC
ACGGCGTCCAACAACAAGTCGTCGTCGCTCAGCAAGCTCGCCGCCACCTTCATCCCCGTCCTCATCTACCTCGTC
GTCTGCTTCGTCATATTCGTCGTACTGCGCCGCCGATGCAAGCGCGTCTATGCGCCGAGAACCTTTGCCGGCCTT
CGGGCCCCCGAGTAAGCCTTGTGCACCGCGCCGCGACTGACCAGGCCCGGGCGGCTGACAGACGGGTGTCGCGAC
AGGATTCCGAGCCCGGCCTTACCCGGAGGCTGGTTGAACTGGATCATCCCTTTCTTCAAGATACCCGACTCTTTC
GTTCTCAACCATGGCTCGCTTGACGGCTTCTTCTTCCTCCGCTTCCTCAAAGTGCTACGAAACATATGCCTCGGC
GGTTGTCTCATCCTCTGGCCGGTCCTCTTCCCGATCCACGCCACCGGCGGCGGCGAGCTCACCGAGCTCGACCTG
TTGACCATCGGCAATGTCAAGAACCCAAAGAAGTTGTACGCCCACGCGGTCATGGCCTGGGTGTTTTTTGGTACG
GGCGCACGCCCTCCTCCCCCCCCCCCCCCCCCCCCCCCTCCCCCCCCAGAAGCACACGGCGCAAGACGAGAACAA
ACCCGGTACGACTAAGACGTCTAACCTCGCCATCTCAGGATTCGTCTTGTACATGATTGTGCGCGAGTGTATCTA
CTACGTCAACCTCCGCCAGGCATACCTCTCTTCGCCCTACTACGCACAGCGCATCTCCTCTCGCACCATTCTCTT
GACCTGCATTCCCAAGGCCTACCTCGACGAGCGTCGTCTCCGCAAGCTCTACGGCGACTCCGTCAAGCGCGTTCA
CATCCCGCGCACATCCAAGGCGCTGGTCAACCTGATCAAGGAGCGGGAGCAGACGGCGACGAGGCTGGAGAAGGC
CGAGGTCGAGCTGATCCTCAAGACGAACAAGGCGATGCGGAAGCAGCTCAAGAAGACGGCCAAGTCGAACCGGAA
GAACCCCCCGCAGCCCGGCGCCACCGACTCGCTCGCATCGAGACAAGATCTCGTCTCCGCCCGGAGCGACAGCGG
CACGGACCAGATCCCGCGTGGCGGCCACCTCGTCGTCGAGCTGCCCGGCTCCTATATCGAATTCGACCCGTCCAA
CGAGAAGCCCGCCGACGACGAGGTCATCCTCGAAGACATCGTCAAGACCGATGTCCAGGGTGAGGTGACCAAGGA
GGACGACGACGAATACGTGCATCCCTACGGCCTCGATCCCGGCCTCCCGGACGTCCGGGGCTCGGTCGCCGCCAC
ATGGATCCCGGTCGAGGCTCGGCCCTACCACCGGCCGCTGGGCAACTTCGGCCGCCGCGTCGACACGATCCGCTG
GACGCGCAATCGGCTGCGGGAACTCAACGTCCAGATCTTCAAGATGCGCCGGCAGGTCCGCCGCGGCGACGGGGT
CACGCTGCCAGCCGCCTTCATCGAGTTCGACACGCAGGAGAGCGCCCAGGCGGCGCACCAAGTCCTCGCCCACCA
CCGGCCGTTGCAGATGTCGTCCAGGATCCTCGGCATCCACCCCGAGGAAGTGCTGTGGAAGTCGCTGAGGATGTC
GTGGTGGGAGCGCATCATTCGCAGCTTTGCCATCCTCTCTCTCGTCTCCGCCGCTGTCGTCTTCTGGTCCATCCC
TTCGGCCGCCATAGGACTCATCTCTCAGATCGACTTCTTGGCCAAGAACGTCGTCTTCCTTGCCTGGATCAAGAA
GCTTCCCAAATTAGTCCTCGGCTTTCTACAGGGATTCATCCCTTCGATAGCCCTGTCCTTGTGGATGGCGGCGGT
ACCCATCATGCTCCGAAGTATGTCTTTTCTCTCTTCCCCGACGAGACAAAGTGCGTCCTTGGCGCCGTGATCATA
CTGACAAAACCCAAAGTTTGCGGCGCGCAAGCAGGCATCCCATCGTCCACTATGGTCGAGCTTTTCGTCCAGAAA
GCATATTTTGCCTTCCAAGTCGTCCAAGTTTTCCTCGTCACAACTCTCACTTCGGCCGCCTCGGCCGCCTTTACC
AGCATCCTTGAAAACCCCATCAAAGCGAAGGACATTCTCGCGAAGAACCTGCCCATGGCATCCAACTTTTATCTT
TCCTATATCCTGGTCCAATGCCTCCTTAGCAGCGGGACAAATCTGTTGCAGGTGTTTTCGTTGATCCGCCACTAT
GCCCTCGCCCGGTTCACGACTCTGCCTCGCGCGCAGTACAAGGCCTGGCGCCAGCTTCCGCCCGCTCGGTGGGGC
GGGATATTTCCTGTTTTTGCAAACATGGGAGTCATCGGTATGTGGAGTTGAACCTGAGACTTCTGAGGCGCTCCG
CTCCGCCTTGGTCCCCGGGAAAAGCTGACGCCGTCCGCGCAGCTCTGAGTTACGCATGCATAGCCCCTTTAATCC
TCATCTTCGCCGCCGGCGGCATGGCTGTCATGCACGTTGTGTGGCGGTACAACCTGATATTTGTCTTCGACTCCG
GCATGGATAGCAAGGGCCTGTTCTATCCACATGCCCTATTACACTTGACCATCGGCCTGTACCTGGCCGAGATAT
GTCTCATAGGCCTCTTTGCTCTTCACCTGTCCTTCGGGCCCCTCGCGCTGATGGTCATGTTTTTCATATTTACCG
GTCTGGTGCACCATTCGCTCAGCCACGCGATCGCGCCACTCCTCCAGAACTTGCCGCAGACACTGCCCCTTGAGG
AAGAGATACAACAGGAGGAGAAGGCGGCGGCGGAGAGAGCGCGTGAGCAAGCTACGGCCCGGACTGACGAGGACC
AGGGCGCAGGCGCCGGTGCCGCCAGCAGCTACTACGACCCGGAACAGGCCTTTGGCGACGAGGACCAGCGGCTAG
ACGACGACAGGGACGAGGAAGAGGAGGAGACGGAGGACGACGAAGCGACGGTGACCAATGACCGAGCTCTCGAAG
GCGCGAGTGGCGTCAAAGCTGCCTTCACCGAGTGGGTCAAGTCGAGCACCAAGTCCAAGCTGCAGTCGCAGATCG
AAAAGCTGGGCTTGCCAGACATGCTCGACAAGCTGCGCTTCTGGGACAGCGATAAGTACGGCGAGGGCCCGCCGA
GCTTCCTCGCCCGGTGGCTGCACCCCGAGGAGTACGAGGACTTCATCGCCCTGCGTCGGATGATCCCGCCCGACA
GCCTGCCCAACATTGACTATCCCGAGGACCACAAGTACTGCGACTACCTGCCGCCCGAGATATGGGTGTCGAAGC
CGACGTTGTGGATTCCCCGGGATGACGCTCGGGTCAGCCGGCAGGAGGTCGCGCACACGAGGAAATACACGCCCA
TATCGGACCACGGAGCCGTCCTGGATGAAAAGGGCCGCATGTTCGTTCACTTCGACCAGGCACCATTTGACCGGT
CCAAGATCATAATATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail