Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1755
Gene name
LocationContig_14:16862..18503
Strand+
Gene length (bp)1641
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 7.9E-22 126 273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 28 358 3.0E-53
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 29 495 1.0E-46
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 121 341 8.0E-15
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 97 312 2.0E-11
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 129 352 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 28 358 3.0E-53
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 29 495 1.0E-46
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 121 341 8.0E-15
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 97 312 2.0E-11
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 129 352 1.0E-10
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 129 338 3.0E-10
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 235 308 2.0E-09
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 233 315 3.0E-09
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 111 307 7.0E-09
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 233 315 9.0E-09
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 229 315 1.0E-08
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 129 312 2.0E-08
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 235 315 2.0E-08
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 111 308 2.0E-08
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 111 307 3.0E-08
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 94 309 4.0E-08
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 235 315 4.0E-08
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 129 374 7.0E-08
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 233 315 7.0E-08
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 102 312 1.0E-07
sp|Q8HXW0|GGLO_PIG L-gulonolactone oxidase OS=Sus scrofa GN=GULO PE=2 SV=3 203 305 1.0E-07
sp|P10867|GGLO_RAT L-gulonolactone oxidase OS=Rattus norvegicus GN=Gulo PE=1 SV=3 203 305 2.0E-07
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 245 304 2.0E-07
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 205 312 4.0E-07
sp|Q9T0N8|CKX1_MAIZE Cytokinin dehydrogenase 1 OS=Zea mays GN=CKX1 PE=1 SV=2 235 315 6.0E-07
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 235 341 9.0E-07
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 235 341 9.0E-07
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 235 341 2.0E-06
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 235 314 2.0E-06
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 235 330 2.0E-06
sp|Q5Z620|CKX10_ORYSJ Cytokinin dehydrogenase 10 OS=Oryza sativa subsp. japonica GN=CKX10 PE=3 SV=1 233 315 5.0E-06
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 235 315 6.0E-06
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 125 314 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1755
MQGLLLALCCLSSLASPAVAVATERYEYPARDECKAFPGSRAWPSRSVWQGLNEKLGGRLLAPPPPGAVCHPGQA
TYNPDQCPNVQRLWPTFEFHAQNPVSIVWNQWNNFSCLPDPKAPCDGRRYPPYVVDASSAKHVKLGVDFARKHNV
RLVVKGTGYDFLGRSTGAGALSIWTHHMSWVQYHPAGQFKLSGSRRPFKGTAVTVGAGTQMADIYSTLDKHKQMF
IGAMGPSVGIAGFLSSGGHSNLSGRYGLGADNIVEMEVVTPKGDIVTVNEDHNADLFWALRGGGGSTFGIVTKFT
LRTYPTPKVLAIRWVAGVDPKEPRKLDFAAELLSKFPDMIDSGLLGWSAVVDNMPNPVPAPGDQAPPRNISGLFG
INAILGTNEGGRAEEVLKPVADAIQTHWNGKAKLTLQTTQYPSYWAYVTGVYNPRPAGVGWWEASRLLDKKVLTS
NPKALAHALKAFDGNLFAMILAGKGVQKPPGGRNSVNPPWRSAYMLSSK*
Coding >Hirsu2|1755
ATGCAGGGGCTGTTGCTGGCGCTTTGCTGCCTGTCAAGCCTGGCAAGCCCTGCTGTCGCTGTAGCCACCGAAAGA
TACGAATATCCGGCGCGCGATGAGTGCAAGGCCTTTCCCGGGAGTCGAGCGTGGCCTTCGAGGAGCGTCTGGCAA
GGCCTTAACGAGAAGCTTGGCGGGCGGCTTCTTGCTCCGCCGCCCCCTGGCGCCGTCTGCCATCCCGGTCAGGCG
ACTTATAATCCTGATCAGTGCCCCAACGTGCAGAGACTATGGCCCACGTTTGAATTCCATGCTCAGAATCCCGTT
TCCATCGTATGGAACCAGTGGAATAACTTCAGCTGCCTTCCTGATCCCAAGGCGCCGTGTGACGGCCGCCGCTAC
CCTCCCTATGTCGTCGACGCGTCCAGCGCCAAGCACGTCAAGCTCGGCGTCGATTTCGCTCGCAAGCACAACGTC
AGACTCGTTGTCAAGGGCACTGGCTACGACTTCCTCGGTCGTTCTACTGGCGCTGGCGCGCTGTCCATCTGGACC
CATCACATGAGCTGGGTTCAATATCATCCCGCCGGTCAATTCAAGCTCAGCGGCTCCCGCAGGCCCTTTAAGGGA
ACTGCCGTGACCGTTGGCGCAGGAACCCAGATGGCGGACATTTACAGCACCCTTGACAAGCATAAGCAAATGTTT
ATAGGCGCCATGGGCCCATCGGTCGGCATTGCCGGATTTCTCTCCAGCGGTGGCCACTCTAATCTGTCTGGCCGC
TATGGTTTGGGGGCGGACAACATTGTCGAGATGGAGGTGGTCACTCCGAAGGGCGATATCGTCACTGTCAATGAG
GACCATAATGCTGACCTCTTCTGGGCGCTGCGTGGTGGCGGTGGCTCGACTTTTGGTATCGTGACCAAGTTCACA
CTACGTACTTATCCTACACCAAAAGTTCTAGCCATCCGTTGGGTAGCCGGCGTCGACCCTAAAGAGCCCAGGAAA
CTTGATTTTGCCGCCGAGCTCCTCTCTAAATTCCCCGACATGATTGACTCCGGGCTTCTGGGATGGAGCGCCGTT
GTCGACAACATGCCCAACCCGGTTCCCGCTCCCGGCGACCAGGCGCCGCCTCGGAACATCAGCGGCCTCTTTGGT
ATTAACGCGATCCTGGGCACGAACGAGGGTGGCAGGGCCGAGGAGGTCTTAAAGCCTGTTGCCGATGCCATCCAG
ACCCACTGGAACGGGAAGGCCAAGCTCACGCTGCAGACGACGCAGTACCCGTCCTATTGGGCCTACGTGACCGGT
GTCTACAACCCTCGACCCGCCGGCGTCGGCTGGTGGGAGGCATCTCGGCTCCTAGACAAGAAGGTTCTCACCAGT
AACCCTAAGGCGCTCGCACACGCATTGAAGGCGTTCGATGGGAACCTCTTCGCCATGATTCTCGCCGGCAAAGGT
GTCCAGAAGCCTCCAGGCGGCAGAAATTCCGTCAACCCTCCCTGGCGATCCGCCTATATGCTCTCGAGTAAGTAG
Transcript >Hirsu2|1755
ATGCAGGGGCTGTTGCTGGCGCTTTGCTGCCTGTCAAGCCTGGCAAGCCCTGCTGTCGCTGTAGCCACCGAAAGA
TACGAATATCCGGCGCGCGATGAGTGCAAGGCCTTTCCCGGGAGTCGAGCGTGGCCTTCGAGGAGCGTCTGGCAA
GGCCTTAACGAGAAGCTTGGCGGGCGGCTTCTTGCTCCGCCGCCCCCTGGCGCCGTCTGCCATCCCGGTCAGGCG
ACTTATAATCCTGATCAGTGCCCCAACGTGCAGAGACTATGGCCCACGTTTGAATTCCATGCTCAGAATCCCGTT
TCCATCGTATGGAACCAGTGGAATAACTTCAGCTGCCTTCCTGATCCCAAGGCGCCGTGTGACGGCCGCCGCTAC
CCTCCCTATGTCGTCGACGCGTCCAGCGCCAAGCACGTCAAGCTCGGCGTCGATTTCGCTCGCAAGCACAACGTC
AGACTCGTTGTCAAGGGCACTGGCTACGACTTCCTCGGTCGTTCTACTGGCGCTGGCGCGCTGTCCATCTGGACC
CATCACATGAGCTGGGTTCAATATCATCCCGCCGGTCAATTCAAGCTCAGCGGCTCCCGCAGGCCCTTTAAGGGA
ACTGCCGTGACCGTTGGCGCAGGAACCCAGATGGCGGACATTTACAGCACCCTTGACAAGCATAAGCAAATGTTT
ATAGGCGCCATGGGCCCATCGGTCGGCATTGCCGGATTTCTCTCCAGCGGTGGCCACTCTAATCTGTCTGGCCGC
TATGGTTTGGGGGCGGACAACATTGTCGAGATGGAGGTGGTCACTCCGAAGGGCGATATCGTCACTGTCAATGAG
GACCATAATGCTGACCTCTTCTGGGCGCTGCGTGGTGGCGGTGGCTCGACTTTTGGTATCGTGACCAAGTTCACA
CTACGTACTTATCCTACACCAAAAGTTCTAGCCATCCGTTGGGTAGCCGGCGTCGACCCTAAAGAGCCCAGGAAA
CTTGATTTTGCCGCCGAGCTCCTCTCTAAATTCCCCGACATGATTGACTCCGGGCTTCTGGGATGGAGCGCCGTT
GTCGACAACATGCCCAACCCGGTTCCCGCTCCCGGCGACCAGGCGCCGCCTCGGAACATCAGCGGCCTCTTTGGT
ATTAACGCGATCCTGGGCACGAACGAGGGTGGCAGGGCCGAGGAGGTCTTAAAGCCTGTTGCCGATGCCATCCAG
ACCCACTGGAACGGGAAGGCCAAGCTCACGCTGCAGACGACGCAGTACCCGTCCTATTGGGCCTACGTGACCGGT
GTCTACAACCCTCGACCCGCCGGCGTCGGCTGGTGGGAGGCATCTCGGCTCCTAGACAAGAAGGTTCTCACCAGT
AACCCTAAGGCGCTCGCACACGCATTGAAGGCGTTCGATGGGAACCTCTTCGCCATGATTCTCGCCGGCAAAGGT
GTCCAGAAGCCTCCAGGCGGCAGAAATTCCGTCAACCCTCCCTGGCGATCCGCCTATATGCTCTCGAGTAAGTAG
Gene >Hirsu2|1755
ATGCAGGGGCTGTTGCTGGCGCTTTGCTGCCTGTCAAGCCTGGCAAGCCCTGCTGTCGCTGTAGCCACCGAAAGA
TACGAATATCCGGCGCGCGATGAGTGCAAGGCCTTTCCCGGGAGTCGAGCGTGGCCTTCGAGGAGCGTCTGGCAA
GGCCTTAACGAGAAGCTTGGCGGGCGGCTTCTTGCTCCGCCGCCCCCTGGCGCCGTCTGCCATCCCGGTCAGGCG
ACTTATAATCCTGATCAGTGCCCCAACGTGCAGAGACTATGGCCCACGTTTGAATTCCATGCTCAGAATCCCGTT
TCCATCGTATGGAACCAGTGGAATAACTTCAGCTGCCTTCCTGATCCCAAGGCGCCGTGTGACGGCCGCCGCTAC
CCTCCCTATGTCGTCGACGCGTCCAGCGCCAAGCACGTCAAGCTCGGCGTCGATTTCGGTGCGTAGATTCCGTTC
ATTCATATTCTCGATGAGTGAGTGCTTGATCGTTTTACTCATGGCCGCACAGCTCGCAAGCACAACGTCAGACTC
GTTGTCAAGGGCACTGGCTACGACTTCCTCGGTCGTTCTACTGGCGCTGGCGCGCTGTCCATCTGGACCCATCAC
ATGAGCTGGGTTCAATATCATCCCGCCGGTCAATTCAAGCTCAGCGGCTCCCGCAGGCCCTTTAAGGGAACTGCC
GTGACCGTTGGCGCAGGAACCCAGATGGCGGACATTTACAGCACCCTTGACAAGCATAAGCAAATGTTTATAGGC
GCCATGGGCCCATCGGTCGGCATTGCCGGATTTCTCTCCAGCGGTGGCCACTCTAATCTGTCTGGCCGCTATGGT
TTGGGGGCGGACAACATTGTCGAGATGGAGGTGGTCACTCCGAAGGGCGATATCGTCACTGTCAATGAGGACCAT
AATGCTGACCTCTTCTGGGCGCTGCGTGGTGTGGGTACCCTGATCGCGACATATGCATTCACCACTAATGATATG
ACAACTGACTCTACACCATATCTCTAGGGCGGTGGCTCGACTTTTGGTATCGTGACCAAGTTCACACTACGTACT
TATCCTACACCAAAAGTTCTAGCCATCCGTTGGGTAGCCGGCGTCGACCCTAAAGAGCCCAGGAAACTTGATTTT
GCCGCCGAGCTCCTCTCTAAATTCCCCGACATGATTGACTCCGGGCTTCTGGGATGGAGCGCCGTTGTCGACAAC
ATGCCCAACCCGGTTCCCGCTCCCGGCGACCAGGCGCCGCCTCGGAACATCAGCGGCCTCTTTGGTATTAACGCG
ATCCTGGGCACGAACGAGGGTGGCAGGGCCGAGGAGGTCTTAAAGCCTGTTGCCGATGCCATCCAGACCCACTGG
AACGGGAAGGCCAAGCTCACGCTGCAGACGACGCAGTACCCGTCCTATTGGGCCTACGTGACCGGTGTCTACAAC
CCTCGACCCGCCGGCGTCGGCTGGTGGGAGGCATCTCGGCTCCTAGACAAGAAGGTTCTCACCAGTAACCCTAAG
GCGCTCGCACACGCATTGAAGGCGTTCGATGGGAACCTCTTCGCCATGATTCTCGCCGGCAAAGGTGTCCAGAAG
CCTCCAGGCGGCAGAAATTCCGTCAACCCTCCCTGGCGATCCGCCTATATGCTCTCGAGTAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail