Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1745
Gene name
LocationContig_1398:5639..6758
Strand-
Gene length (bp)1119
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 8.6E-18 3 190
PF11954 DUF3471 Domain of unknown function (DUF3471) 1.9E-12 268 369

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7932 0.2484 0.2124 0.1282 0.1311 0.0517 0.261 0.1342 0.3587 0.037

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup111
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|115
Ophiocordyceps camponoti-floridani Ophcf2|03858
Ophiocordyceps camponoti-floridani Ophcf2|05282
Ophiocordyceps camponoti-rufipedis Ophun1|4044
Ophiocordyceps camponoti-rufipedis Ophun1|7452
Ophiocordyceps kimflemingae Ophio5|1649
Ophiocordyceps kimflemingae Ophio5|4067
Ophiocordyceps subramaniannii Hirsu2|1745 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1988
Ophiocordyceps subramaniannii Hirsu2|230
Ophiocordyceps subramaniannii Hirsu2|2822
Ophiocordyceps subramaniannii Hirsu2|5585

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1745
MMYTVASYLVEKKSGLRFADFLEQRIFRPLQMRSTSLQPGAARAKGLGDRIATGYVWDDEAKTYEPTPWTDSPEA
QGAGGIVTSVDDYVKWVKAVMNREPPITDAVYRGLVEKRILQDEDADEADDMDDDEADDFPLPDTPELYYAAGWE
IRQYCGHMVVSHDGSEDGFRSNHFFVPDLRLGGVIVGNSNCAATVINMLTHRLIDETVRRQEGDAALQAYKHGSG
SGSCSTCASDDGSGSGSDDGSDDEDEDGPERELMREHCPGLDAPQPLTRPLAAYTGRYWNPGYRAIRIAEADGGL
VVDATDRSMGYKLRFKHLRDQTHFMAYLSERFVKGESPLKVEFVLEGDRAVRVGMCLEESVKDYIWFERKDG*
Coding >Hirsu2|1745
ATGATGTACACGGTGGCCAGCTACCTGGTGGAGAAGAAGAGCGGGCTCCGCTTCGCCGACTTCCTCGAGCAGCGC
ATCTTCCGGCCGCTGCAGATGCGGTCGACCAGCCTGCAGCCGGGCGCGGCGCGGGCCAAGGGGCTCGGCGACCGG
ATCGCGACCGGCTACGTCTGGGACGACGAGGCCAAGACGTACGAGCCGACGCCGTGGACGGACAGCCCCGAGGCG
CAGGGCGCGGGCGGCATCGTGACGAGCGTCGACGACTACGTCAAGTGGGTCAAGGCCGTGATGAACCGCGAGCCG
CCCATCACCGACGCCGTCTACCGCGGCCTGGTCGAGAAGCGCATCCTGCAGGACGAGGACGCCGACGAGGCCGAC
GACATGGACGACGACGAGGCCGACGACTTCCCGCTGCCGGACACGCCCGAGCTCTACTACGCCGCCGGCTGGGAG
ATCCGCCAGTACTGCGGCCACATGGTCGTCTCCCACGACGGCTCCGAGGACGGCTTCCGCTCCAACCACTTCTTC
GTGCCGGACCTGCGCCTCGGCGGCGTCATCGTCGGCAACTCGAACTGCGCCGCCACCGTCATCAACATGCTGACC
CACCGCCTCATCGACGAGACGGTCCGGCGCCAGGAGGGCGACGCGGCCCTGCAGGCCTACAAGCACGGCTCCGGC
TCCGGCTCGTGCTCGACCTGCGCCTCCGACGACGGCTCCGGCTCCGGCTCCGACGACGGCTCCGACGACGAAGAC
GAAGACGGGCCCGAGCGCGAGCTCATGCGCGAGCACTGCCCCGGCCTGGACGCGCCCCAGCCGCTGACGCGGCCG
CTCGCCGCCTACACCGGCCGGTACTGGAACCCGGGCTACCGGGCGATCCGGATCGCCGAGGCCGACGGCGGGCTC
GTCGTCGACGCCACGGACCGCTCCATGGGCTACAAGCTGCGCTTCAAGCACCTGCGCGACCAGACGCACTTCATG
GCCTACCTGAGCGAGCGCTTCGTCAAGGGCGAGTCGCCCCTCAAGGTCGAGTTCGTGCTCGAGGGCGACCGGGCC
GTCCGGGTCGGCATGTGCCTGGAGGAGAGCGTCAAGGATTATATATGGTTCGAGAGGAAGGACGGCTAG
Transcript >Hirsu2|1745
ATGATGTACACGGTGGCCAGCTACCTGGTGGAGAAGAAGAGCGGGCTCCGCTTCGCCGACTTCCTCGAGCAGCGC
ATCTTCCGGCCGCTGCAGATGCGGTCGACCAGCCTGCAGCCGGGCGCGGCGCGGGCCAAGGGGCTCGGCGACCGG
ATCGCGACCGGCTACGTCTGGGACGACGAGGCCAAGACGTACGAGCCGACGCCGTGGACGGACAGCCCCGAGGCG
CAGGGCGCGGGCGGCATCGTGACGAGCGTCGACGACTACGTCAAGTGGGTCAAGGCCGTGATGAACCGCGAGCCG
CCCATCACCGACGCCGTCTACCGCGGCCTGGTCGAGAAGCGCATCCTGCAGGACGAGGACGCCGACGAGGCCGAC
GACATGGACGACGACGAGGCCGACGACTTCCCGCTGCCGGACACGCCCGAGCTCTACTACGCCGCCGGCTGGGAG
ATCCGCCAGTACTGCGGCCACATGGTCGTCTCCCACGACGGCTCCGAGGACGGCTTCCGCTCCAACCACTTCTTC
GTGCCGGACCTGCGCCTCGGCGGCGTCATCGTCGGCAACTCGAACTGCGCCGCCACCGTCATCAACATGCTGACC
CACCGCCTCATCGACGAGACGGTCCGGCGCCAGGAGGGCGACGCGGCCCTGCAGGCCTACAAGCACGGCTCCGGC
TCCGGCTCGTGCTCGACCTGCGCCTCCGACGACGGCTCCGGCTCCGGCTCCGACGACGGCTCCGACGACGAAGAC
GAAGACGGGCCCGAGCGCGAGCTCATGCGCGAGCACTGCCCCGGCCTGGACGCGCCCCAGCCGCTGACGCGGCCG
CTCGCCGCCTACACCGGCCGGTACTGGAACCCGGGCTACCGGGCGATCCGGATCGCCGAGGCCGACGGCGGGCTC
GTCGTCGACGCCACGGACCGCTCCATGGGCTACAAGCTGCGCTTCAAGCACCTGCGCGACCAGACGCACTTCATG
GCCTACCTGAGCGAGCGCTTCGTCAAGGGCGAGTCGCCCCTCAAGGTCGAGTTCGTGCTCGAGGGCGACCGGGCC
GTCCGGGTCGGCATGTGCCTGGAGGAGAGCGTCAAGGATTATATATGGTTCGAGAGGAAGGACGGCTAG
Gene >Hirsu2|1745
ATGATGTACACGGTGGCCAGCTACCTGGTGGAGAAGAAGAGCGGGCTCCGCTTCGCCGACTTCCTCGAGCAGCGC
ATCTTCCGGCCGCTGCAGATGCGGTCGACCAGCCTGCAGCCGGGCGCGGCGCGGGCCAAGGGGCTCGGCGACCGG
ATCGCGACCGGCTACGTCTGGGACGACGAGGCCAAGACGTACGAGCCGACGCCGTGGACGGACAGCCCCGAGGCG
CAGGGCGCGGGCGGCATCGTGACGAGCGTCGACGACTACGTCAAGTGGGTCAAGGCCGTGATGAACCGCGAGCCG
CCCATCACCGACGCCGTCTACCGCGGCCTGGTCGAGAAGCGCATCCTGCAGGACGAGGACGCCGACGAGGCCGAC
GACATGGACGACGACGAGGCCGACGACTTCCCGCTGCCGGACACGCCCGAGCTCTACTACGCCGCCGGCTGGGAG
ATCCGCCAGTACTGCGGCCACATGGTCGTCTCCCACGACGGCTCCGAGGACGGCTTCCGCTCCAACCACTTCTTC
GTGCCGGACCTGCGCCTCGGCGGCGTCATCGTCGGCAACTCGAACTGCGCCGCCACCGTCATCAACATGCTGACC
CACCGCCTCATCGACGAGACGGTCCGGCGCCAGGAGGGCGACGCGGCCCTGCAGGCCTACAAGCACGGCTCCGGC
TCCGGCTCGTGCTCGACCTGCGCCTCCGACGACGGCTCCGGCTCCGGCTCCGACGACGGCTCCGACGACGAAGAC
GAAGACGGGCCCGAGCGCGAGCTCATGCGCGAGCACTGCCCCGGCCTGGACGCGCCCCAGCCGCTGACGCGGCCG
CTCGCCGCCTACACCGGCCGGTACTGGAACCCGGGCTACCGGGCGATCCGGATCGCCGAGGCCGACGGCGGGCTC
GTCGTCGACGCCACGGACCGCTCCATGGGCTACAAGCTGCGCTTCAAGCACCTGCGCGACCAGACGCACTTCATG
GCCTACCTGAGCGAGCGCTTCGTCAAGGGCGAGTCGCCCCTCAAGGTCGAGTTCGTGCTCGAGGGCGACCGGGCC
GTCCGGGTCGGCATGTGCCTGGAGGAGAGCGTCAAGGATTATATATGGTTCGAGAGGAAGGACGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail