Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1745
Gene name
LocationContig_1398:5639..6758
Strand-
Gene length (bp)1119
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 7.9E-18 3 190
PF11954 DUF3471 Domain of unknown function (DUF3471) 5.7E-11 269 368

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1745
MMYTVASYLVEKKSGLRFADFLEQRIFRPLQMRSTSLQPGAARAKGLGDRIATGYVWDDEAKTYEPTPWTDSPEA
QGAGGIVTSVDDYVKWVKAVMNREPPITDAVYRGLVEKRILQDEDADEADDMDDDEADDFPLPDTPELYYAAGWE
IRQYCGHMVVSHDGSEDGFRSNHFFVPDLRLGGVIVGNSNCAATVINMLTHRLIDETVRRQEGDAALQAYKHGSG
SGSCSTCASDDGSGSGSDDGSDDEDEDGPERELMREHCPGLDAPQPLTRPLAAYTGRYWNPGYRAIRIAEADGGL
VVDATDRSMGYKLRFKHLRDQTHFMAYLSERFVKGESPLKVEFVLEGDRAVRVGMCLEESVKDYIWFERKDG*
Coding >Hirsu2|1745
ATGATGTACACGGTGGCCAGCTACCTGGTGGAGAAGAAGAGCGGGCTCCGCTTCGCCGACTTCCTCGAGCAGCGC
ATCTTCCGGCCGCTGCAGATGCGGTCGACCAGCCTGCAGCCGGGCGCGGCGCGGGCCAAGGGGCTCGGCGACCGG
ATCGCGACCGGCTACGTCTGGGACGACGAGGCCAAGACGTACGAGCCGACGCCGTGGACGGACAGCCCCGAGGCG
CAGGGCGCGGGCGGCATCGTGACGAGCGTCGACGACTACGTCAAGTGGGTCAAGGCCGTGATGAACCGCGAGCCG
CCCATCACCGACGCCGTCTACCGCGGCCTGGTCGAGAAGCGCATCCTGCAGGACGAGGACGCCGACGAGGCCGAC
GACATGGACGACGACGAGGCCGACGACTTCCCGCTGCCGGACACGCCCGAGCTCTACTACGCCGCCGGCTGGGAG
ATCCGCCAGTACTGCGGCCACATGGTCGTCTCCCACGACGGCTCCGAGGACGGCTTCCGCTCCAACCACTTCTTC
GTGCCGGACCTGCGCCTCGGCGGCGTCATCGTCGGCAACTCGAACTGCGCCGCCACCGTCATCAACATGCTGACC
CACCGCCTCATCGACGAGACGGTCCGGCGCCAGGAGGGCGACGCGGCCCTGCAGGCCTACAAGCACGGCTCCGGC
TCCGGCTCGTGCTCGACCTGCGCCTCCGACGACGGCTCCGGCTCCGGCTCCGACGACGGCTCCGACGACGAAGAC
GAAGACGGGCCCGAGCGCGAGCTCATGCGCGAGCACTGCCCCGGCCTGGACGCGCCCCAGCCGCTGACGCGGCCG
CTCGCCGCCTACACCGGCCGGTACTGGAACCCGGGCTACCGGGCGATCCGGATCGCCGAGGCCGACGGCGGGCTC
GTCGTCGACGCCACGGACCGCTCCATGGGCTACAAGCTGCGCTTCAAGCACCTGCGCGACCAGACGCACTTCATG
GCCTACCTGAGCGAGCGCTTCGTCAAGGGCGAGTCGCCCCTCAAGGTCGAGTTCGTGCTCGAGGGCGACCGGGCC
GTCCGGGTCGGCATGTGCCTGGAGGAGAGCGTCAAGGATTATATATGGTTCGAGAGGAAGGACGGCTAG
Transcript >Hirsu2|1745
ATGATGTACACGGTGGCCAGCTACCTGGTGGAGAAGAAGAGCGGGCTCCGCTTCGCCGACTTCCTCGAGCAGCGC
ATCTTCCGGCCGCTGCAGATGCGGTCGACCAGCCTGCAGCCGGGCGCGGCGCGGGCCAAGGGGCTCGGCGACCGG
ATCGCGACCGGCTACGTCTGGGACGACGAGGCCAAGACGTACGAGCCGACGCCGTGGACGGACAGCCCCGAGGCG
CAGGGCGCGGGCGGCATCGTGACGAGCGTCGACGACTACGTCAAGTGGGTCAAGGCCGTGATGAACCGCGAGCCG
CCCATCACCGACGCCGTCTACCGCGGCCTGGTCGAGAAGCGCATCCTGCAGGACGAGGACGCCGACGAGGCCGAC
GACATGGACGACGACGAGGCCGACGACTTCCCGCTGCCGGACACGCCCGAGCTCTACTACGCCGCCGGCTGGGAG
ATCCGCCAGTACTGCGGCCACATGGTCGTCTCCCACGACGGCTCCGAGGACGGCTTCCGCTCCAACCACTTCTTC
GTGCCGGACCTGCGCCTCGGCGGCGTCATCGTCGGCAACTCGAACTGCGCCGCCACCGTCATCAACATGCTGACC
CACCGCCTCATCGACGAGACGGTCCGGCGCCAGGAGGGCGACGCGGCCCTGCAGGCCTACAAGCACGGCTCCGGC
TCCGGCTCGTGCTCGACCTGCGCCTCCGACGACGGCTCCGGCTCCGGCTCCGACGACGGCTCCGACGACGAAGAC
GAAGACGGGCCCGAGCGCGAGCTCATGCGCGAGCACTGCCCCGGCCTGGACGCGCCCCAGCCGCTGACGCGGCCG
CTCGCCGCCTACACCGGCCGGTACTGGAACCCGGGCTACCGGGCGATCCGGATCGCCGAGGCCGACGGCGGGCTC
GTCGTCGACGCCACGGACCGCTCCATGGGCTACAAGCTGCGCTTCAAGCACCTGCGCGACCAGACGCACTTCATG
GCCTACCTGAGCGAGCGCTTCGTCAAGGGCGAGTCGCCCCTCAAGGTCGAGTTCGTGCTCGAGGGCGACCGGGCC
GTCCGGGTCGGCATGTGCCTGGAGGAGAGCGTCAAGGATTATATATGGTTCGAGAGGAAGGACGGCTAG
Gene >Hirsu2|1745
ATGATGTACACGGTGGCCAGCTACCTGGTGGAGAAGAAGAGCGGGCTCCGCTTCGCCGACTTCCTCGAGCAGCGC
ATCTTCCGGCCGCTGCAGATGCGGTCGACCAGCCTGCAGCCGGGCGCGGCGCGGGCCAAGGGGCTCGGCGACCGG
ATCGCGACCGGCTACGTCTGGGACGACGAGGCCAAGACGTACGAGCCGACGCCGTGGACGGACAGCCCCGAGGCG
CAGGGCGCGGGCGGCATCGTGACGAGCGTCGACGACTACGTCAAGTGGGTCAAGGCCGTGATGAACCGCGAGCCG
CCCATCACCGACGCCGTCTACCGCGGCCTGGTCGAGAAGCGCATCCTGCAGGACGAGGACGCCGACGAGGCCGAC
GACATGGACGACGACGAGGCCGACGACTTCCCGCTGCCGGACACGCCCGAGCTCTACTACGCCGCCGGCTGGGAG
ATCCGCCAGTACTGCGGCCACATGGTCGTCTCCCACGACGGCTCCGAGGACGGCTTCCGCTCCAACCACTTCTTC
GTGCCGGACCTGCGCCTCGGCGGCGTCATCGTCGGCAACTCGAACTGCGCCGCCACCGTCATCAACATGCTGACC
CACCGCCTCATCGACGAGACGGTCCGGCGCCAGGAGGGCGACGCGGCCCTGCAGGCCTACAAGCACGGCTCCGGC
TCCGGCTCGTGCTCGACCTGCGCCTCCGACGACGGCTCCGGCTCCGGCTCCGACGACGGCTCCGACGACGAAGAC
GAAGACGGGCCCGAGCGCGAGCTCATGCGCGAGCACTGCCCCGGCCTGGACGCGCCCCAGCCGCTGACGCGGCCG
CTCGCCGCCTACACCGGCCGGTACTGGAACCCGGGCTACCGGGCGATCCGGATCGCCGAGGCCGACGGCGGGCTC
GTCGTCGACGCCACGGACCGCTCCATGGGCTACAAGCTGCGCTTCAAGCACCTGCGCGACCAGACGCACTTCATG
GCCTACCTGAGCGAGCGCTTCGTCAAGGGCGAGTCGCCCCTCAAGGTCGAGTTCGTGCTCGAGGGCGACCGGGCC
GTCCGGGTCGGCATGTGCCTGGAGGAGAGCGTCAAGGATTATATATGGTTCGAGAGGAAGGACGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail