Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1741
Gene name
LocationContig_1396:5733..6798
Strand-
Gene length (bp)1065
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03798 TRAM_LAG1_CLN8 TLC domain 4.0E-38 96 301
PF08390 TRAM1 TRAM1-like protein 1.9E-24 31 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59735|LAC1_SCHPO Sphingosine N-acyltransferase lac1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lac1 PE=1 SV=2 3 310 9.0E-95
sp|A6ZSP9|LAG1_YEAS7 Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAG1 PE=3 SV=1 3 327 5.0E-93
sp|P38703|LAG1_YEAST Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAG1 PE=1 SV=1 3 327 1.0E-92
sp|P28496|LAC1_YEAST Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAC1 PE=1 SV=2 3 313 5.0E-84
sp|A6ZZV7|LAC1_YEAS7 Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAC1 PE=3 SV=1 3 313 5.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59735|LAC1_SCHPO Sphingosine N-acyltransferase lac1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lac1 PE=1 SV=2 3 310 9.0E-95
sp|A6ZSP9|LAG1_YEAS7 Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAG1 PE=3 SV=1 3 327 5.0E-93
sp|P38703|LAG1_YEAST Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAG1 PE=1 SV=1 3 327 1.0E-92
sp|P28496|LAC1_YEAST Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAC1 PE=1 SV=2 3 313 5.0E-84
sp|A6ZZV7|LAC1_YEAS7 Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAC1 PE=3 SV=1 3 313 5.0E-84
sp|P78970|LAG1_SCHPO Sphingosine N-acyltransferase lag1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lag1 PE=1 SV=2 22 324 3.0E-39
sp|Q9D6J1|CERS4_MOUSE Ceramide synthase 4 OS=Mus musculus GN=Cers4 PE=1 SV=1 66 354 4.0E-23
sp|Q96G23|CERS2_HUMAN Ceramide synthase 2 OS=Homo sapiens GN=CERS2 PE=1 SV=1 77 318 1.0E-21
sp|Q924Z4|CERS2_MOUSE Ceramide synthase 2 OS=Mus musculus GN=Cers2 PE=1 SV=1 77 318 2.0E-21
sp|Q3ZBF8|CERS2_BOVIN Ceramide synthase 2 OS=Bos taurus GN=CERS2 PE=2 SV=1 77 318 2.0E-21
sp|Q9LJK3|LAG12_ARATH LAG1 longevity assurance homolog 2 OS=Arabidopsis thaliana GN=LAG2 PE=1 SV=1 82 324 3.0E-20
sp|Q6YWS8|ASCL2_ORYSJ ASC1-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0728300 PE=3 SV=2 57 329 5.0E-19
sp|G5ED45|HYL1_CAEEL Ceramide synthase hyl-1 OS=Caenorhabditis elegans GN=hyl-1 PE=1 SV=1 92 327 1.0E-18
sp|Q5E9R6|CERS4_BOVIN Ceramide synthase 4 OS=Bos taurus GN=CERS4 PE=2 SV=1 85 346 5.0E-18
sp|Q6EUN0|ASCL1_ORYSJ ASC1-like protein 1 OS=Oryza sativa subsp. japonica GN=Os02g0581300 PE=2 SV=1 91 327 5.0E-18
sp|Q84QC0|ASCL3_ORYSJ ASC1-like protein 3 OS=Oryza sativa subsp. japonica GN=Os03g0264000 PE=2 SV=1 91 323 6.0E-18
sp|Q6NQI8|LAG13_ARATH LAG1 longevity assurance homolog 3 OS=Arabidopsis thaliana GN=At1g13580 PE=2 SV=2 60 324 7.0E-18
sp|Q6ZMG9|CERS6_HUMAN Ceramide synthase 6 OS=Homo sapiens GN=CERS6 PE=1 SV=1 85 316 2.0E-17
sp|Q8W4Y5|ASCL_SOLLC ASC1-like protein OS=Solanum lycopersicum PE=2 SV=1 60 323 8.0E-16
sp|Q9LDF2|LAG11_ARATH LAG1 longevity assurance homolog 1 OS=Arabidopsis thaliana GN=LAG1 PE=2 SV=1 93 324 2.0E-15
sp|Q8C172|CERS6_MOUSE Ceramide synthase 6 OS=Mus musculus GN=Cers6 PE=1 SV=1 85 307 2.0E-15
sp|Q9HA82|CERS4_HUMAN Ceramide synthase 4 OS=Homo sapiens GN=CERS4 PE=1 SV=2 75 337 3.0E-15
sp|Q8N5B7|CERS5_HUMAN Ceramide synthase 5 OS=Homo sapiens GN=CERS5 PE=2 SV=1 95 316 1.0E-13
sp|Q9D6K9|CERS5_MOUSE Ceramide synthase 5 OS=Mus musculus GN=Cers5 PE=1 SV=1 95 316 7.0E-13
sp|Q7Z139|HYL2_CAEEL Ceramide synthase hyl-2 OS=Caenorhabditis elegans GN=hyl-2 PE=1 SV=1 82 321 8.0E-12
sp|Q9M6A3|ASC1_SOLLC Protein ASC1 OS=Solanum lycopersicum GN=Asc-1 PE=2 SV=2 91 324 1.0E-10
sp|Q8IU89|CERS3_HUMAN Ceramide synthase 3 OS=Homo sapiens GN=CERS3 PE=1 SV=2 84 221 6.0E-10
sp|P27544|CERS1_HUMAN Ceramide synthase 1 OS=Homo sapiens GN=CERS1 PE=1 SV=1 72 223 2.0E-07
sp|Q1A3B0|CERS3_MOUSE Ceramide synthase 3 OS=Mus musculus GN=Cers3 PE=1 SV=1 96 221 4.0E-07
sp|P27545|CERS1_MOUSE Ceramide synthase 1 OS=Mus musculus GN=Cers1 PE=1 SV=1 79 328 8.0E-07
sp|Q924Z5|TRAM2_MOUSE Translocating chain-associated membrane protein 2 OS=Mus musculus GN=Tram2 PE=1 SV=1 11 155 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 54 76 22
3 104 126 22
4 146 165 19
5 230 252 22
6 275 297 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1741
MVKHTFVLPACILLVFLTGYALNPSEANPLHRWIFLSYRLPHEDPTRPVQYGKGPWDLAFVAFYTVVLSFTREFV
MQELLRPLARRTGLGRSKQARFMEQMYTALYFVVLGPAGIYVMSRTPVWYFNTRGMYEGFPHRTHEACVKFYYLF
QAAYWAQQAIVLLLGMEKPRKDFKELVGHHVVSLALIGLSYRFHFVHLGIAVYTTHDISDFFLATSKVLNYMEHP
LVGPYFFLFMCVWIYLRHVVNLGIIWSLFTEFRTVGPFELNWETEQYKCTLSQYITAALLSSLQALNLFWLFHIV
RIAYRFVVHNIAEDDRSDDEHDDDPDQPPLALVKEAVPTLELNGRAVVAHGRAR*
Coding >Hirsu2|1741
ATGGTCAAGCACACGTTCGTGCTGCCGGCCTGCATCCTGCTCGTCTTCCTGACCGGGTACGCGCTCAACCCGAGC
GAGGCCAACCCGCTCCACCGGTGGATCTTCCTGTCGTACCGGCTGCCGCACGAGGATCCGACGCGCCCCGTGCAG
TACGGCAAGGGCCCGTGGGACCTGGCCTTTGTCGCCTTCTACACCGTCGTCCTCTCCTTCACGCGCGAGTTCGTG
ATGCAGGAGCTGCTGCGGCCGCTGGCGCGGCGGACCGGGCTCGGGCGGTCGAAGCAGGCGCGCTTCATGGAGCAG
ATGTACACGGCGCTGTACTTTGTGGTGCTCGGCCCCGCCGGCATCTACGTCATGAGCCGGACGCCGGTCTGGTAC
TTCAACACGCGCGGCATGTACGAGGGCTTCCCGCACCGGACGCACGAGGCGTGCGTCAAGTTCTACTACCTCTTC
CAGGCGGCCTACTGGGCGCAGCAGGCCATCGTGCTGCTGCTGGGGATGGAGAAGCCGCGCAAGGACTTCAAGGAG
CTGGTCGGGCACCACGTCGTCAGCCTGGCGCTCATCGGGCTCAGCTACCGCTTCCACTTCGTGCACCTGGGCATC
GCCGTCTACACGACGCACGACATCAGCGACTTCTTCCTGGCCACGTCCAAGGTGCTCAACTACATGGAGCACCCG
CTCGTCGGGCCCTACTTCTTCCTCTTCATGTGCGTCTGGATCTACCTGCGGCACGTGGTCAACCTCGGCATCATC
TGGTCCCTCTTCACCGAGTTCCGCACCGTCGGCCCCTTCGAGCTCAACTGGGAGACGGAGCAGTACAAGTGCACG
CTGAGCCAGTACATCACGGCCGCCCTGCTGTCGTCGCTGCAGGCCCTCAACCTCTTCTGGCTCTTCCACATCGTC
CGCATCGCCTACCGCTTCGTCGTCCACAACATCGCCGAGGACGACCGGTCCGACGACGAGCACGACGACGACCCG
GACCAGCCGCCCCTCGCCCTCGTCAAGGAAGCCGTCCCGACGCTCGAGCTCAACGGCCGCGCCGTCGTCGCCCAC
GGCCGCGCCCGATGA
Transcript >Hirsu2|1741
ATGGTCAAGCACACGTTCGTGCTGCCGGCCTGCATCCTGCTCGTCTTCCTGACCGGGTACGCGCTCAACCCGAGC
GAGGCCAACCCGCTCCACCGGTGGATCTTCCTGTCGTACCGGCTGCCGCACGAGGATCCGACGCGCCCCGTGCAG
TACGGCAAGGGCCCGTGGGACCTGGCCTTTGTCGCCTTCTACACCGTCGTCCTCTCCTTCACGCGCGAGTTCGTG
ATGCAGGAGCTGCTGCGGCCGCTGGCGCGGCGGACCGGGCTCGGGCGGTCGAAGCAGGCGCGCTTCATGGAGCAG
ATGTACACGGCGCTGTACTTTGTGGTGCTCGGCCCCGCCGGCATCTACGTCATGAGCCGGACGCCGGTCTGGTAC
TTCAACACGCGCGGCATGTACGAGGGCTTCCCGCACCGGACGCACGAGGCGTGCGTCAAGTTCTACTACCTCTTC
CAGGCGGCCTACTGGGCGCAGCAGGCCATCGTGCTGCTGCTGGGGATGGAGAAGCCGCGCAAGGACTTCAAGGAG
CTGGTCGGGCACCACGTCGTCAGCCTGGCGCTCATCGGGCTCAGCTACCGCTTCCACTTCGTGCACCTGGGCATC
GCCGTCTACACGACGCACGACATCAGCGACTTCTTCCTGGCCACGTCCAAGGTGCTCAACTACATGGAGCACCCG
CTCGTCGGGCCCTACTTCTTCCTCTTCATGTGCGTCTGGATCTACCTGCGGCACGTGGTCAACCTCGGCATCATC
TGGTCCCTCTTCACCGAGTTCCGCACCGTCGGCCCCTTCGAGCTCAACTGGGAGACGGAGCAGTACAAGTGCACG
CTGAGCCAGTACATCACGGCCGCCCTGCTGTCGTCGCTGCAGGCCCTCAACCTCTTCTGGCTCTTCCACATCGTC
CGCATCGCCTACCGCTTCGTCGTCCACAACATCGCCGAGGACGACCGGTCCGACGACGAGCACGACGACGACCCG
GACCAGCCGCCCCTCGCCCTCGTCAAGGAAGCCGTCCCGACGCTCGAGCTCAACGGCCGCGCCGTCGTCGCCCAC
GGCCGCGCCCGATGA
Gene >Hirsu2|1741
ATGGTCAAGCACACGTTCGTGCTGCCGGCCTGCATCCTGCTCGTCTTCCTGACCGGGTACGCGCTCAACCCGAGC
GAGGCCAACCCGCTCCACCGGTGGATCTTCCTGTCGTACCGGCTGCCGCACGAGGATCCGACGCGCCCCGTGCAG
TACGGCAAGGGCCCGTGGGACCTGGCCTTTGTCGCCTTCTACACCGTCGTCCTCTCCTTCACGCGCGAGTTCGTG
ATGCAGGAGCTGCTGCGGCCGCTGGCGCGGCGGACCGGGCTCGGGCGGTCGAAGCAGGCGCGCTTCATGGAGCAG
ATGTACACGGCGCTGTACTTTGTGGTGCTCGGCCCCGCCGGCATCTACGTCATGAGCCGGACGCCGGTCTGGTAC
TTCAACACGCGCGGCATGTACGAGGGCTTCCCGCACCGGACGCACGAGGCGTGCGTCAAGTTCTACTACCTCTTC
CAGGCGGCCTACTGGGCGCAGCAGGCCATCGTGCTGCTGCTGGGGATGGAGAAGCCGCGCAAGGACTTCAAGGAG
CTGGTCGGGCACCACGTCGTCAGCCTGGCGCTCATCGGGCTCAGCTACCGCTTCCACTTCGTGCACCTGGGCATC
GCCGTCTACACGACGCACGACATCAGCGACTTCTTCCTGGCCACGTCCAAGGTGCTCAACTACATGGAGCACCCG
CTCGTCGGGCCCTACTTCTTCCTCTTCATGTGCGTCTGGATCTACCTGCGGCACGTGGTCAACCTCGGCATCATC
TGGTCCCTCTTCACCGAGTTCCGCACCGTCGGCCCCTTCGAGCTCAACTGGGAGACGGAGCAGTACAAGTGCACG
CTGAGCCAGTACATCACGGCCGCCCTGCTGTCGTCGCTGCAGGCCCTCAACCTCTTCTGGCTCTTCCACATCGTC
CGCATCGCCTACCGCTTCGTCGTCCACAACATCGCCGAGGACGACCGGTCCGACGACGAGCACGACGACGACCCG
GACCAGCCGCCCCTCGCCCTCGTCAAGGAAGCCGTCCCGACGCTCGAGCTCAACGGCCGCGCCGTCGTCGCCCAC
GGCCGCGCCCGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail