Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1740
Gene name
LocationContig_1396:581..3942
Strand+
Gene length (bp)3361
Transcript length (bp)3135
Coding sequence length (bp)3135
Protein length (aa) 1045

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 2.4E-32 719 868
PF00664 ABC_membrane ABC transporter transmembrane region 8.7E-26 374 657

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 77 938 0.0E+00
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 343 938 1.0E-150
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 346 938 3.0E-150
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 346 938 2.0E-147
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 346 954 3.0E-147
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 77 938 0.0E+00
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 343 938 1.0E-150
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 346 938 3.0E-150
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 346 938 2.0E-147
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 346 954 3.0E-147
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 360 948 1.0E-134
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 360 938 6.0E-134
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 358 938 2.0E-130
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 302 938 1.0E-129
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 360 938 4.0E-129
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 360 938 1.0E-126
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 339 938 1.0E-126
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 360 938 5.0E-126
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 348 938 4.0E-125
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 361 939 2.0E-124
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 361 939 2.0E-124
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 360 938 3.0E-124
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 357 938 4.0E-124
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 321 938 4.0E-124
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 357 938 6.0E-124
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 357 938 1.0E-123
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 357 938 2.0E-122
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 360 938 1.0E-120
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 333 938 6.0E-119
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 357 942 8.0E-116
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 351 938 2.0E-114
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 357 938 2.0E-112
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 361 938 3.0E-112
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 357 963 1.0E-110
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 299 938 8.0E-109
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 357 938 1.0E-105
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 370 938 4.0E-80
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 568 944 2.0E-78
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 381 938 4.0E-78
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 373 938 7.0E-78
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 464 938 7.0E-78
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 464 938 7.0E-78
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 464 938 7.0E-78
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 464 938 7.0E-78
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 464 938 7.0E-78
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 464 938 7.0E-78
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 464 938 7.0E-78
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 464 938 7.0E-78
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 464 938 1.0E-76
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 354 938 4.0E-75
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 330 968 3.0E-73
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 462 938 3.0E-72
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 456 951 2.0E-70
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 389 942 3.0E-70
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 340 938 9.0E-70
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 451 944 2.0E-69
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 438 938 3.0E-69
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 377 931 4.0E-69
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 338 938 4.0E-69
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 387 951 5.0E-69
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 387 951 1.0E-68
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 347 938 2.0E-68
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 423 938 6.0E-68
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 423 938 6.0E-67
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 464 939 6.0E-67
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 429 938 1.0E-66
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 389 938 4.0E-66
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 686 938 1.0E-65
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 403 938 2.0E-65
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 427 938 3.0E-65
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 446 934 4.0E-65
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 446 934 4.0E-65
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 446 934 4.0E-65
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 700 938 4.0E-65
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 565 938 5.0E-65
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 438 938 9.0E-65
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 438 938 1.0E-64
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 636 942 1.0E-64
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 373 943 2.0E-64
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 462 938 2.0E-64
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 464 938 3.0E-64
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 567 944 1.0E-63
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 567 944 1.0E-63
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 464 938 3.0E-63
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 567 944 5.0E-63
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 567 944 5.0E-63
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 415 940 3.0E-62
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 636 942 3.0E-62
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 636 942 3.0E-62
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 383 939 4.0E-62
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 568 938 7.0E-62
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 464 936 8.0E-62
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 457 951 9.0E-62
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 567 940 1.0E-61
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 550 937 1.0E-61
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 464 938 2.0E-61
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 464 938 2.0E-61
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 464 938 2.0E-61
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 548 938 2.0E-61
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 373 942 2.0E-61
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 565 937 2.0E-61
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 567 940 2.0E-61
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 565 944 3.0E-61
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 565 937 4.0E-61
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 505 931 4.0E-61
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 464 938 4.0E-61
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 553 940 5.0E-61
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 564 938 2.0E-60
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 464 938 2.0E-60
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 464 938 2.0E-60
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 464 938 2.0E-60
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 464 938 2.0E-60
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 464 938 2.0E-60
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 567 944 2.0E-60
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 464 938 2.0E-60
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 464 938 2.0E-60
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 464 938 2.0E-60
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 464 938 2.0E-60
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 551 934 3.0E-60
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 567 944 4.0E-60
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 542 938 4.0E-60
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 464 938 4.0E-60
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 687 964 4.0E-60
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 457 939 5.0E-60
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 669 944 7.0E-60
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 553 946 1.0E-59
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 343 938 1.0E-59
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 493 942 1.0E-59
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 493 942 1.0E-59
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 493 942 1.0E-59
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 551 934 1.0E-59
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 542 938 1.0E-59
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 565 961 2.0E-59
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 673 938 2.0E-59
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 486 938 2.0E-59
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 551 934 2.0E-59
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 551 934 2.0E-59
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 682 938 3.0E-59
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 459 939 3.0E-59
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 636 942 3.0E-59
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 669 931 4.0E-59
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 378 938 4.0E-59
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 570 938 4.0E-59
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 493 942 5.0E-59
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 493 944 6.0E-59
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 553 942 6.0E-59
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 493 944 8.0E-59
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 568 938 1.0E-58
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 570 938 1.0E-58
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 490 931 1.0E-58
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 332 931 1.0E-58
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 699 934 1.0E-58
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 511 944 2.0E-58
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 669 939 2.0E-58
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 343 938 2.0E-58
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 343 938 2.0E-58
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 669 946 2.0E-58
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 525 938 3.0E-58
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 358 938 3.0E-58
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 641 938 4.0E-58
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 699 944 6.0E-58
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 551 949 6.0E-58
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 551 934 6.0E-58
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 464 938 6.0E-58
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 542 943 7.0E-58
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 563 939 9.0E-58
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 641 938 1.0E-57
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 699 934 1.0E-57
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 641 938 1.0E-57
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 464 938 1.0E-57
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 464 938 1.0E-57
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 439 939 1.0E-57
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 669 938 1.0E-57
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 447 938 1.0E-57
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 641 938 2.0E-57
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 464 938 2.0E-57
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 644 931 2.0E-57
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 560 934 3.0E-57
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 430 938 3.0E-57
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 375 949 3.0E-57
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 430 938 3.0E-57
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 430 938 3.0E-57
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 430 938 3.0E-57
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 430 938 3.0E-57
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 463 938 3.0E-57
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 564 938 4.0E-57
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 442 945 4.0E-57
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 381 934 4.0E-57
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 551 934 5.0E-57
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 382 938 7.0E-57
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 459 946 7.0E-57
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 535 937 8.0E-57
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 464 938 9.0E-57
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 682 938 1.0E-56
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 567 936 1.0E-56
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 429 938 1.0E-56
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 699 934 2.0E-56
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 565 924 2.0E-56
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 553 938 2.0E-56
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 381 934 2.0E-56
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 459 946 2.0E-56
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 574 938 3.0E-56
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 565 950 3.0E-56
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 467 942 3.0E-56
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 381 938 4.0E-56
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 493 938 4.0E-56
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 351 936 4.0E-56
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 565 924 4.0E-56
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 669 943 4.0E-56
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 381 934 4.0E-56
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 381 934 4.0E-56
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 375 938 4.0E-56
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 680 958 7.0E-56
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 430 938 8.0E-56
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 568 937 1.0E-55
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 641 938 1.0E-55
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 539 941 1.0E-55
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 430 938 1.0E-55
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 464 939 2.0E-55
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 464 939 2.0E-55
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 568 936 2.0E-55
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 641 938 2.0E-55
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 676 1005 2.0E-55
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 696 939 2.0E-55
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 429 939 3.0E-55
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 542 942 3.0E-55
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 542 942 3.0E-55
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 689 938 3.0E-55
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 542 942 3.0E-55
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 670 938 3.0E-55
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 676 938 4.0E-55
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 641 938 4.0E-55
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 464 939 4.0E-55
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 565 945 4.0E-55
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 464 939 4.0E-55
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 568 942 4.0E-55
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 464 939 4.0E-55
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 567 952 4.0E-55
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 464 939 5.0E-55
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 544 938 5.0E-55
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 560 934 6.0E-55
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 463 940 6.0E-55
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 464 925 6.0E-55
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 550 948 6.0E-55
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 493 938 7.0E-55
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 464 939 8.0E-55
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 464 939 1.0E-54
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 464 939 1.0E-54
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 459 934 1.0E-54
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 464 926 1.0E-54
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 464 939 1.0E-54
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 623 938 1.0E-54
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 561 941 2.0E-54
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 701 938 2.0E-54
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 473 958 2.0E-54
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 689 926 2.0E-54
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 525 941 2.0E-54
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 696 964 2.0E-54
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 464 925 2.0E-54
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 464 938 2.0E-54
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 699 958 2.0E-54
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 698 958 2.0E-54
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 700 938 2.0E-54
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 677 925 2.0E-54
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 676 925 3.0E-54
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 699 958 3.0E-54
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 567 934 4.0E-54
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 564 972 5.0E-54
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 553 938 7.0E-54
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 674 938 7.0E-54
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 634 950 9.0E-54
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 634 950 9.0E-54
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 634 950 9.0E-54
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 703 952 9.0E-54
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 703 952 9.0E-54
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 703 952 9.0E-54
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 641 938 1.0E-53
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 701 943 1.0E-53
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 474 959 2.0E-53
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 683 926 2.0E-53
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 464 939 3.0E-53
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 439 934 4.0E-53
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 698 949 4.0E-53
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 560 941 5.0E-53
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 551 934 5.0E-53
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 599 938 5.0E-53
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 667 938 5.0E-53
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 459 938 9.0E-53
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 696 938 1.0E-52
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 525 941 1.0E-52
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 561 941 2.0E-52
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 564 938 2.0E-52
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 463 940 3.0E-52
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 692 938 4.0E-52
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 696 925 4.0E-52
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 696 938 4.0E-52
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 547 950 4.0E-52
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 699 934 6.0E-52
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 701 938 7.0E-52
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 573 934 1.0E-51
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 573 934 1.0E-51
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 459 934 1.0E-51
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 459 934 1.0E-51
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 701 940 1.0E-51
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 696 938 2.0E-51
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 573 934 2.0E-51
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 457 938 2.0E-51
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 464 926 2.0E-51
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 555 940 2.0E-51
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 699 938 2.0E-51
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 564 938 2.0E-51
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 564 940 3.0E-51
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 411 936 9.0E-51
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 411 936 9.0E-51
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 379 924 1.0E-50
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 701 940 1.0E-50
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 683 938 1.0E-50
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 411 936 2.0E-50
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 411 936 2.0E-50
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 683 925 2.0E-50
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 459 934 3.0E-50
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 440 934 4.0E-50
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 553 926 5.0E-50
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 669 947 6.0E-50
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 683 938 8.0E-50
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 696 938 1.0E-49
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 669 938 5.0E-49
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 689 934 5.0E-49
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 682 938 9.0E-49
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 439 935 2.0E-48
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 565 938 8.0E-48
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 565 938 8.0E-48
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 565 938 8.0E-48
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 568 938 1.0E-47
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 553 940 1.0E-47
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 632 940 2.0E-47
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 632 940 2.0E-47
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 427 934 3.0E-47
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 480 931 3.0E-47
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 386 927 1.0E-46
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 609 938 1.0E-46
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 703 939 2.0E-46
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 684 935 2.0E-46
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 635 938 4.0E-46
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 701 926 5.0E-46
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 565 947 6.0E-46
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 555 957 8.0E-46
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 701 938 1.0E-45
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 564 944 2.0E-45
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 464 934 3.0E-45
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 531 924 3.0E-45
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 703 939 4.0E-45
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 564 931 4.0E-45
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 466 935 6.0E-45
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 616 941 8.0E-45
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 702 938 1.0E-44
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 702 938 1.0E-44
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 702 938 1.0E-44
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 703 936 2.0E-44
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 703 939 3.0E-44
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 567 917 3.0E-44
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 466 935 5.0E-44
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 555 954 6.0E-44
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 634 939 6.0E-44
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 513 936 8.0E-44
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 438 938 9.0E-44
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 655 915 9.0E-44
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 568 925 9.0E-44
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 699 938 2.0E-43
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 703 939 2.0E-43
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 543 915 4.0E-43
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 565 934 7.0E-43
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 464 941 1.0E-42
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 464 941 3.0E-42
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 699 918 4.0E-42
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 565 934 5.0E-42
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 565 936 1.0E-41
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 677 945 4.0E-41
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 694 947 6.0E-41
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 664 931 7.0E-41
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 703 937 8.0E-41
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 677 936 1.0E-40
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 669 938 9.0E-40
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 700 928 1.0E-39
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 685 937 9.0E-39
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 696 935 1.0E-38
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 656 950 2.0E-38
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 636 935 2.0E-38
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 564 934 6.0E-38
sp|Q8SQI5|ABC1_ENCCU Probable ABC transporter ECU01_0200/ECU01_1410 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0200 PE=3 SV=1 493 934 2.0E-37
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 692 953 1.0E-35
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 647 934 2.0E-35
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 700 942 3.0E-35
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 647 934 6.0E-35
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 535 933 7.0E-35
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 700 938 1.0E-34
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 647 934 1.0E-34
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 636 925 1.0E-34
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 647 924 2.0E-34
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 700 950 2.0E-34
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 536 925 3.0E-34
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 668 938 3.0E-34
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 636 925 1.0E-33
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 647 934 2.0E-33
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 647 934 4.0E-33
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 647 934 4.0E-33
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 645 926 4.0E-33
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 668 938 5.0E-33
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 700 942 6.0E-33
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 663 960 7.0E-33
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 645 926 9.0E-33
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 700 949 1.0E-32
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 645 926 1.0E-32
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 645 951 1.0E-32
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 414 925 1.0E-32
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 636 917 2.0E-32
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 738 944 3.0E-32
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 639 934 3.0E-32
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 645 917 3.0E-32
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 639 934 4.0E-32
sp|Q52402|AARD_PROST Transport ATP-binding protein AarD OS=Providencia stuartii GN=aarD PE=3 SV=1 568 934 4.0E-32
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 620 926 5.0E-32
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 644 947 8.0E-32
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 701 960 8.0E-32
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 639 950 9.0E-32
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 647 934 1.0E-31
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 626 934 1.0E-31
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 647 924 1.0E-31
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 647 924 3.0E-31
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 699 942 5.0E-31
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 646 934 5.0E-31
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 700 925 6.0E-31
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 707 938 7.0E-31
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 636 937 1.0E-30
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 647 934 1.0E-30
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 547 983 2.0E-30
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 685 917 2.0E-30
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 490 925 2.0E-30
sp|P23596|PRTD_DICCH Proteases secretion ATP-binding protein PrtD OS=Dickeya chrysanthemi GN=prtD PE=3 SV=1 656 933 2.0E-30
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 572 938 6.0E-30
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 660 937 6.0E-30
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 646 934 6.0E-30
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 639 934 9.0E-30
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 458 932 1.0E-29
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 666 936 1.0E-29
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 701 917 1.0E-29
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 667 925 1.0E-29
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 701 917 2.0E-29
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 667 925 2.0E-29
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 547 1028 4.0E-29
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 701 929 5.0E-29
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 567 925 5.0E-29
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 567 925 5.0E-29
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 425 925 5.0E-29
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 701 926 5.0E-29
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 567 925 6.0E-29
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 701 925 7.0E-29
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 701 925 8.0E-29
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 667 925 1.0E-28
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 548 936 1.0E-28
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 701 931 1.0E-28
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 701 925 2.0E-28
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 447 937 2.0E-28
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 451 953 4.0E-28
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 700 929 4.0E-28
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 548 936 5.0E-28
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 701 926 7.0E-28
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 721 925 7.0E-28
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 701 926 9.0E-28
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 700 926 9.0E-28
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 644 932 1.0E-27
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 451 973 2.0E-27
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 701 924 2.0E-27
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 706 908 2.0E-27
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 547 946 2.0E-27
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 644 943 2.0E-27
sp|Q5SLN1|PSTB_THET8 Phosphate import ATP-binding protein PstB OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pstB PE=3 SV=1 678 922 3.0E-27
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 703 917 3.0E-27
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 547 932 3.0E-27
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 589 946 3.0E-27
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 624 917 8.0E-27
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 647 931 1.0E-26
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 538 1000 1.0E-26
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 627 934 2.0E-26
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 699 934 2.0E-26
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 647 931 2.0E-26
sp|Q7NZI7|PSTB_CHRVO Phosphate import ATP-binding protein PstB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pstB PE=3 SV=1 707 933 2.0E-26
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 633 950 3.0E-26
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 509 960 3.0E-26
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 706 908 3.0E-26
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 700 943 4.0E-26
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 623 1027 6.0E-26
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 514 926 8.0E-26
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 644 948 8.0E-26
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 576 1019 8.0E-26
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 509 951 9.0E-26
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 703 924 1.0E-25
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 701 917 2.0E-25
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 645 920 2.0E-25
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 696 942 3.0E-25
sp|Q72GX5|PSTB_THET2 Phosphate import ATP-binding protein PstB OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pstB PE=3 SV=1 671 922 3.0E-25
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 700 943 3.0E-25
sp|Q04EY4|ECFA3_OENOB Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA3 PE=3 SV=1 703 950 4.0E-25
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 700 943 4.0E-25
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 713 934 4.0E-25
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 700 917 5.0E-25
sp|Q1Q8K4|PSTB_PSYCK Phosphate import ATP-binding protein PstB OS=Psychrobacter cryohalolentis (strain K5) GN=pstB PE=3 SV=2 707 933 5.0E-25
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 709 926 5.0E-25
sp|Q1BXC3|PSTB_BURCA Phosphate import ATP-binding protein PstB OS=Burkholderia cenocepacia (strain AU 1054) GN=pstB PE=3 SV=1 689 925 5.0E-25
sp|O27764|PSTB_METTH Phosphate import ATP-binding protein PstB OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pstB PE=3 SV=1 703 925 5.0E-25
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 701 936 6.0E-25
sp|P47260|Y014_MYCGE Putative ABC transporter ATP-binding protein MG014 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG014 PE=3 SV=1 719 938 6.0E-25
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 659 934 7.0E-25
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 540 934 7.0E-25
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 629 917 8.0E-25
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 667 942 8.0E-25
sp|Q4FQD1|PSTB_PSYA2 Phosphate import ATP-binding protein PstB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pstB PE=3 SV=2 701 933 1.0E-24
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 701 917 1.0E-24
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 701 917 1.0E-24
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 701 917 1.0E-24
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 717 937 1.0E-24
sp|Q8DU24|PSTB1_STRMU Phosphate import ATP-binding protein PstB 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pstB1 PE=3 SV=1 703 925 2.0E-24
sp|P63368|PSTB1_STRA5 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB1 PE=3 SV=1 703 925 2.0E-24
sp|P63367|PSTB1_STRA3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB1 PE=3 SV=1 703 925 2.0E-24
sp|Q3K199|PSTB1_STRA1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB1 PE=3 SV=2 703 925 2.0E-24
sp|Q13W55|PSTB_BURXL Phosphate import ATP-binding protein PstB OS=Burkholderia xenovorans (strain LB400) GN=pstB PE=3 SV=1 697 925 2.0E-24
sp|Q5E3B8|PSTB2_VIBF1 Phosphate import ATP-binding protein PstB 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pstB2 PE=3 SV=1 696 920 2.0E-24
sp|Q12XW6|PSTB_METBU Phosphate import ATP-binding protein PstB OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pstB PE=3 SV=1 702 919 2.0E-24
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 690 942 2.0E-24
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 710 970 2.0E-24
sp|Q1DDP4|METN_MYXXD Methionine import ATP-binding protein MetN OS=Myxococcus xanthus (strain DK 1622) GN=metN PE=3 SV=1 699 926 3.0E-24
sp|Q2J220|PSTB_RHOP2 Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain HaA2) GN=pstB PE=3 SV=1 691 925 3.0E-24
sp|P29018|CYDD_ECOLI ATP-binding/permease protein CydD OS=Escherichia coli (strain K12) GN=cydD PE=1 SV=3 644 934 3.0E-24
sp|Q8ETV7|ECFA1_OCEIH Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ecfA1 PE=3 SV=1 700 925 3.0E-24
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 690 952 3.0E-24
sp|Q9KU04|PSTB1_VIBCH Phosphate import ATP-binding protein PstB 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pstB1 PE=3 SV=1 696 917 4.0E-24
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 690 942 4.0E-24
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 698 926 5.0E-24
sp|Q1GBJ0|ECFA1_LACDA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ecfA1 PE=3 SV=1 703 925 5.0E-24
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 710 970 6.0E-24
sp|Q5L3R0|ECFA1_GEOKA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Geobacillus kaustophilus (strain HTA426) GN=ecfA1 PE=3 SV=1 708 925 6.0E-24
sp|Q0ASG3|PSTB_MARMM Phosphate import ATP-binding protein PstB OS=Maricaulis maris (strain MCS10) GN=pstB PE=3 SV=1 687 925 6.0E-24
sp|Q5LS19|PSTB_RUEPO Phosphate import ATP-binding protein PstB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pstB PE=3 SV=2 718 919 6.0E-24
sp|Q3IS07|PSTB1_NATPD Phosphate import ATP-binding protein PstB 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pstB1 PE=3 SV=1 718 917 7.0E-24
sp|Q13CR0|PSTB_RHOPS Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain BisB5) GN=pstB PE=3 SV=1 707 925 7.0E-24
sp|Q3AJS9|PSTB_SYNSC Phosphate import ATP-binding protein PstB OS=Synechococcus sp. (strain CC9605) GN=pstB PE=3 SV=1 686 920 7.0E-24
sp|Q12L15|PSTB_SHEDO Phosphate import ATP-binding protein PstB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pstB PE=3 SV=1 683 917 7.0E-24
sp|Q6KIS8|PSTB_MYCMO Phosphate import ATP-binding protein PstB OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=pstB PE=3 SV=1 707 925 8.0E-24
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 703 926 8.0E-24
sp|Q98FL5|PSTB_RHILO Phosphate import ATP-binding protein PstB OS=Rhizobium loti (strain MAFF303099) GN=pstB PE=3 SV=1 700 925 8.0E-24
sp|Q5M4F2|PSTB2_STRT2 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pstB2 PE=3 SV=1 703 925 9.0E-24
sp|Q5LZU2|PSTB2_STRT1 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pstB2 PE=3 SV=1 703 925 9.0E-24
sp|Q3IM36|PSTB3_NATPD Phosphate import ATP-binding protein PstB 3 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pstB3 PE=3 SV=1 718 917 9.0E-24
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 703 970 1.0E-23
sp|Q46BM0|PSTB_METBF Phosphate import ATP-binding protein PstB OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pstB PE=3 SV=1 716 917 1.0E-23
sp|Q6XYT0|PSTB_SPIKU Phosphate import ATP-binding protein PstB OS=Spiroplasma kunkelii GN=pstB PE=3 SV=1 703 917 1.0E-23
sp|Q8DFC3|METN_VIBVU Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain CMCP6) GN=metN PE=3 SV=1 704 926 1.0E-23
sp|Q7MN25|METN_VIBVY Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain YJ016) GN=metN PE=3 SV=1 704 926 1.0E-23
sp|O67154|PSTB_AQUAE Phosphate import ATP-binding protein PstB OS=Aquifex aeolicus (strain VF5) GN=pstB PE=3 SV=1 718 926 1.0E-23
sp|Q04BY7|ECFA1_LACDB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=ecfA1 PE=3 SV=1 703 925 1.0E-23
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 644 1036 1.0E-23
sp|Q2NHW1|PSTB_METST Phosphate import ATP-binding protein PstB OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pstB PE=3 SV=1 719 925 2.0E-23
sp|Q11DN5|PSTB_CHESB Phosphate import ATP-binding protein PstB OS=Chelativorans sp. (strain BNC1) GN=pstB PE=3 SV=1 679 925 2.0E-23
sp|Q084V3|PSTB_SHEFN Phosphate import ATP-binding protein PstB OS=Shewanella frigidimarina (strain NCIMB 400) GN=pstB PE=3 SV=1 716 917 2.0E-23
sp|Q8ELQ6|METN3_OCEIH Methionine import ATP-binding protein MetN 3 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN3 PE=3 SV=1 709 951 2.0E-23
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 716 934 2.0E-23
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 443 973 2.0E-23
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 710 970 3.0E-23
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 625 901 3.0E-23
sp|Q8CQS7|METN2_STAES Methionine import ATP-binding protein MetN 2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=metN2 PE=3 SV=1 718 926 3.0E-23
sp|Q5HRU5|METN1_STAEQ Methionine import ATP-binding protein MetN 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=metN1 PE=3 SV=1 718 926 3.0E-23
sp|Q722B1|POTA_LISMF Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=potA PE=3 SV=2 703 920 3.0E-23
sp|Q6F1W5|ECFA1_MESFL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ecfA1 PE=3 SV=1 703 925 3.0E-23
sp|Q0HTE5|PSTB_SHESR Phosphate import ATP-binding protein PstB OS=Shewanella sp. (strain MR-7) GN=pstB PE=3 SV=1 716 917 3.0E-23
sp|Q0HH38|PSTB_SHESM Phosphate import ATP-binding protein PstB OS=Shewanella sp. (strain MR-4) GN=pstB PE=3 SV=1 716 917 3.0E-23
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 504 982 4.0E-23
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 623 929 4.0E-23
sp|Q0SVB6|PSTB_CLOPS Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain SM101 / Type A) GN=pstB PE=3 SV=1 696 917 4.0E-23
sp|Q8XMP8|PSTB_CLOPE Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain 13 / Type A) GN=pstB PE=3 SV=1 696 917 4.0E-23
sp|Q0TTG6|PSTB_CLOP1 Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pstB PE=3 SV=1 696 917 4.0E-23
sp|Q20WP4|PSTB_RHOPB Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain BisB18) GN=pstB PE=3 SV=1 700 925 4.0E-23
sp|Q3SJQ8|PSTB_THIDA Phosphate import ATP-binding protein PstB OS=Thiobacillus denitrificans (strain ATCC 25259) GN=pstB PE=3 SV=1 703 917 4.0E-23
sp|Q8EG82|PSTB1_SHEON Phosphate import ATP-binding protein PstB 1 OS=Shewanella oneidensis (strain MR-1) GN=pstB1 PE=3 SV=2 716 917 4.0E-23
sp|Q1QXH6|PSTB1_CHRSD Phosphate import ATP-binding protein PstB 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pstB1 PE=3 SV=1 703 926 5.0E-23
sp|Q65P77|ECFA1_BACLD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ecfA1 PE=3 SV=1 707 925 5.0E-23
sp|Q6N0I5|PSTB_RHOPA Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pstB PE=3 SV=1 691 925 5.0E-23
sp|Q39HM4|PSTB_BURL3 Phosphate import ATP-binding protein PstB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pstB PE=3 SV=1 692 925 6.0E-23
sp|Q8XHV3|ECFA2_CLOPE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain 13 / Type A) GN=ecfA2 PE=3 SV=1 716 925 6.0E-23
sp|Q0TMS8|ECFA2_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA2 PE=3 SV=1 716 925 6.0E-23
sp|Q89VF2|PSTB_BRADU Phosphate import ATP-binding protein PstB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pstB PE=3 SV=1 691 917 7.0E-23
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 686 1014 8.0E-23
sp|A0AGP9|POTA_LISW6 Spermidine/putrescine import ATP-binding protein PotA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=potA PE=3 SV=1 703 920 8.0E-23
sp|Q8Y8T6|POTA_LISMO Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2 703 920 8.0E-23
sp|Q47Y12|PSTB_COLP3 Phosphate import ATP-binding protein PstB OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pstB PE=3 SV=1 690 917 9.0E-23
sp|Q1QQH1|PSTB_NITHX Phosphate import ATP-binding protein PstB OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pstB PE=3 SV=1 683 925 9.0E-23
sp|Q92DL6|POTA_LISIN Spermidine/putrescine import ATP-binding protein PotA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=potA PE=3 SV=2 703 920 1.0E-22
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 703 926 1.0E-22
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 623 929 8.0E-22
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 538 958 3.0E-21
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 511 925 4.0E-21
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 699 925 4.0E-21
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 644 926 1.0E-20
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 639 925 3.0E-20
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 659 937 4.0E-19
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 718 955 2.0E-18
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 717 947 2.0E-18
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 717 947 2.0E-18
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 644 924 3.0E-18
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 717 957 5.0E-18
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 531 994 6.0E-18
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 644 976 2.0E-17
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 459 924 3.0E-17
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 509 925 1.0E-16
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 509 925 1.0E-16
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 653 925 2.0E-16
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 653 976 3.0E-16
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 718 924 5.0E-16
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 653 925 1.0E-15
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 718 924 2.0E-15
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 719 924 4.0E-15
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 718 934 5.0E-15
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 718 924 8.0E-15
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 719 1005 2.0E-14
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 719 1015 2.0E-14
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 719 924 2.0E-14
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 644 976 3.0E-14
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 680 945 3.0E-14
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 543 938 8.0E-14
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 644 937 4.0E-13
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 718 926 5.0E-13
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 509 925 2.0E-12
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 719 925 2.0E-12
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 565 909 4.0E-12
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 729 944 5.0E-11
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 831 925 1.0E-10
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 831 925 1.0E-10
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 831 925 2.0E-10
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 719 880 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 102 124 22
3 139 161 22
4 173 195 22
5 223 245 22
6 616 635 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1740
MPADDEKQASPRQGSDHGRPSSVDLILRETQYLYALVLLAVFITGAAWYSVYNAKKQEDLAQPVVKGPGGKPLPV
TKRKRRDDNERKIGPRFGRTGKNVFRYLVFVIFSTYIASSAALFVHAFWHENPYKWSKEGLPWAGEWTVVHVTGS
TFFYLYILFSLFDWRKGPNIVHLTVWVLAFAAEAVMATATFVAAARCHFARPPRSGDASRARSCVDYWTRIDLIL
YFVRMLHLLAAIGLFAAAWVCKVRRTHDRSEEGHMSESTPLLNGSGYTSYDTQQNADHAESAQARAERRRRQSAS
NAANGSAANGVGGGGGGGGKPAGKGAPGGKDEPAAFYRPEKLPHRTWWEYLRGYSLFFPYLWPKDTLALQLHVLA
CFGLVILQRLVNVAVPYQIGQVVNKLEAAIREVRNGGSLTTESFPLKDFSLLGALWILQGQSGLLGSLRSLLWIP
VSQYSYRGLTTAAFNHVHSLSLDFHLSKRTGEVLSALNKGSAINQFLEQVTFQVVPMLFDLFLSISVFYYQYGPL
YAEINLVDTCWYLYMTIKMASTRADQRREMTNADREEEAVKNDSISSYETVKYFNAEEYESNRYQDKVGVFQSAE
AKVQMGMVMMNICQTLVFNLGRIVAAVVCGWQVAVGMRNTGDWFMVVSYLTQLQGPLNFFGTFYRTVQQAMISGE
RLLELFKIQPTVVDTPHAVALADFRGHIRWNDVSFSYDRRKPALRNVSFECAPGTTTAFVGESGGGKSTLFRHMF
RYYDCDEGSIELDGRNVKDLTIDSVRANIGVVPQDTSLFNESLMYNLKYANPAASDEEVYEACRAASIHDRIMTF
PDRYETQVGERGLRLSGGEKQRVAIARTILKDPRIIMLDEATSALDTHTEQEIQDNVWKIGKGRTLLVIAHRLST
ITHADQIVVLHAGEIVEKGTHEELLAVQGRYASMWEKQIRAERALDKAREATIKAAKAMKRANMGAKADAADEHT
DDYHTLGSSGILSDNDTSKSKGDEECSSSSSSGSSASSDVDSAHEVERAAAQHAGAQSSLTVPRPGPGR*
Coding >Hirsu2|1740
ATGCCGGCCGACGACGAGAAGCAGGCCTCCCCACGACAAGGCTCCGACCATGGCCGCCCCAGCTCGGTCGACCTC
ATCCTCCGCGAAACCCAGTACCTCTACGCCCTGGTCCTGCTGGCCGTCTTCATCACCGGCGCCGCCTGGTACAGC
GTTTACAATGCCAAGAAGCAGGAGGACCTCGCCCAGCCCGTCGTCAAGGGCCCCGGCGGAAAGCCGCTGCCCGTC
ACCAAGCGCAAGAGGCGTGACGACAACGAGCGCAAGATCGGGCCTCGCTTCGGCCGAACCGGCAAGAACGTCTTC
CGATACCTCGTCTTCGTCATCTTCTCGACCTACATCGCCAGCAGCGCCGCCCTCTTCGTCCACGCCTTTTGGCAC
GAGAACCCCTACAAGTGGTCCAAGGAAGGCCTTCCTTGGGCCGGCGAATGGACCGTGGTTCATGTGACCGGCTCC
ACCTTCTTCTACCTCTACATCCTATTCTCGCTCTTTGACTGGCGCAAAGGCCCCAACATTGTCCATCTGACCGTC
TGGGTCCTGGCCTTCGCGGCCGAGGCCGTCATGGCCACGGCCACCTTCGTCGCCGCCGCCCGTTGCCACTTCGCC
CGCCCGCCCCGATCCGGGGACGCCTCCAGGGCACGCAGCTGCGTCGACTACTGGACCAGGATCGACCTCATCCTC
TACTTCGTCCGCATGCTGCACCTGCTGGCCGCCATTGGCCTCTTCGCCGCCGCCTGGGTCTGCAAGGTCCGACGC
ACGCACGACCGGTCCGAGGAGGGCCACATGTCCGAGTCGACACCGCTCCTCAACGGCTCCGGCTACACCTCGTAC
GACACGCAGCAGAATGCCGATCATGCCGAGTCCGCCCAGGCCCGAGCCGAGCGCCGACGCCGACAGTCGGCCTCG
AACGCCGCCAACGGCAGCGCCGCCAACGGAGTCGGCGGCGGCGGCGGCGGCGGCGGCAAACCCGCGGGAAAGGGT
GCGCCCGGCGGCAAGGACGAGCCGGCCGCCTTTTATCGCCCCGAAAAGCTGCCGCACCGGACCTGGTGGGAGTAC
CTTAGGGGCTACTCCCTCTTCTTCCCGTACCTGTGGCCCAAGGACACGCTGGCGCTGCAGCTGCACGTGCTGGCC
TGCTTCGGCCTGGTCATCCTGCAGAGGCTGGTCAACGTGGCCGTCCCGTACCAGATCGGCCAGGTCGTCAACAAG
CTCGAGGCGGCCATCAGGGAGGTCCGGAACGGGGGCTCCCTCACGACCGAGAGCTTCCCCCTCAAGGACTTCAGC
TTGCTCGGCGCGCTCTGGATACTCCAGGGCCAGTCGGGGCTCCTGGGCTCCCTGAGGTCGCTGCTCTGGATCCCC
GTGTCGCAGTACTCGTACCGGGGCCTGACGACGGCCGCCTTCAACCACGTCCACTCGCTCAGCCTCGACTTCCAC
CTGTCGAAGCGCACCGGCGAGGTGCTCTCGGCCCTCAACAAGGGGTCCGCCATCAACCAGTTTCTCGAGCAGGTG
ACGTTCCAGGTGGTGCCCATGCTCTTCGACCTGTTCCTCTCCATCTCCGTCTTCTACTACCAGTACGGCCCGCTC
TACGCCGAGATCAACCTGGTCGACACGTGCTGGTACCTGTACATGACGATCAAGATGGCCTCGACCCGGGCGGAC
CAGAGGCGCGAGATGACCAACGCGGACCGCGAAGAGGAGGCCGTCAAGAATGATTCCATCTCGAGCTACGAGACG
GTCAAGTACTTCAACGCCGAGGAGTACGAGTCGAACCGGTACCAGGACAAGGTCGGCGTCTTCCAGTCGGCCGAG
GCCAAGGTGCAGATGGGCATGGTCATGATGAACATCTGCCAGACGCTCGTCTTCAACCTGGGCCGCATCGTCGCC
GCCGTCGTGTGCGGATGGCAGGTGGCCGTCGGCATGCGGAACACGGGCGACTGGTTCATGGTGGTCTCGTACCTG
ACGCAGCTGCAGGGCCCCCTCAACTTCTTCGGCACCTTCTACCGCACCGTCCAGCAGGCCATGATCTCGGGCGAG
CGCCTCCTCGAGCTCTTCAAGATCCAGCCGACCGTCGTCGACACGCCGCACGCCGTCGCCCTCGCCGACTTCCGC
GGCCACATCCGGTGGAACGACGTCAGCTTCTCGTACGACCGGCGCAAGCCGGCCCTGCGCAACGTCAGCTTCGAG
TGCGCGCCGGGCACGACGACGGCCTTCGTCGGCGAGTCGGGCGGCGGCAAGTCGACGCTCTTCCGCCACATGTTC
CGCTACTACGACTGCGACGAGGGCAGCATCGAGCTCGACGGCAGGAACGTCAAGGACCTGACGATCGACTCGGTG
CGGGCGAACATTGGCGTCGTGCCCCAGGACACGAGCCTCTTCAACGAGTCGCTCATGTACAACCTCAAGTACGCC
AACCCCGCGGCCAGCGACGAGGAAGTGTACGAGGCCTGCCGCGCCGCCAGCATCCACGACCGCATCATGACCTTC
CCGGACAGGTACGAGACGCAGGTGGGCGAGAGGGGGCTGCGGCTCAGCGGCGGCGAGAAGCAGCGGGTCGCCATC
GCCCGCACCATCCTGAAGGACCCGCGCATCATCATGCTGGACGAGGCCACGTCGGCGCTCGACACGCACACGGAG
CAGGAGATTCAGGACAACGTGTGGAAGATTGGCAAGGGCCGCACCTTGCTCGTGATTGCGCACCGTCTGTCCACC
ATTACGCATGCGGACCAGATTGTCGTGCTGCACGCCGGAGAGATCGTGGAGAAGGGCACGCACGAGGAGCTGCTG
GCCGTGCAGGGGCGCTACGCCTCCATGTGGGAGAAGCAGATACGGGCCGAGAGAGCCCTGGACAAAGCAAGAGAG
GCTACCATCAAAGCGGCCAAGGCGATGAAGCGGGCTAACATGGGTGCCAAGGCGGACGCGGCCGACGAGCACACG
GACGACTACCACACGCTCGGGTCTTCGGGCATCCTGTCGGACAACGACACGTCGAAGAGCAAAGGCGACGAGGAG
TGCTCGTCGTCGTCGTCGTCGGGCTCGTCGGCCTCTTCGGACGTCGACTCGGCGCACGAAGTCGAACGCGCGGCG
GCGCAGCATGCCGGCGCCCAGTCGAGCCTCACGGTTCCACGTCCCGGACCGGGGCGATAG
Transcript >Hirsu2|1740
ATGCCGGCCGACGACGAGAAGCAGGCCTCCCCACGACAAGGCTCCGACCATGGCCGCCCCAGCTCGGTCGACCTC
ATCCTCCGCGAAACCCAGTACCTCTACGCCCTGGTCCTGCTGGCCGTCTTCATCACCGGCGCCGCCTGGTACAGC
GTTTACAATGCCAAGAAGCAGGAGGACCTCGCCCAGCCCGTCGTCAAGGGCCCCGGCGGAAAGCCGCTGCCCGTC
ACCAAGCGCAAGAGGCGTGACGACAACGAGCGCAAGATCGGGCCTCGCTTCGGCCGAACCGGCAAGAACGTCTTC
CGATACCTCGTCTTCGTCATCTTCTCGACCTACATCGCCAGCAGCGCCGCCCTCTTCGTCCACGCCTTTTGGCAC
GAGAACCCCTACAAGTGGTCCAAGGAAGGCCTTCCTTGGGCCGGCGAATGGACCGTGGTTCATGTGACCGGCTCC
ACCTTCTTCTACCTCTACATCCTATTCTCGCTCTTTGACTGGCGCAAAGGCCCCAACATTGTCCATCTGACCGTC
TGGGTCCTGGCCTTCGCGGCCGAGGCCGTCATGGCCACGGCCACCTTCGTCGCCGCCGCCCGTTGCCACTTCGCC
CGCCCGCCCCGATCCGGGGACGCCTCCAGGGCACGCAGCTGCGTCGACTACTGGACCAGGATCGACCTCATCCTC
TACTTCGTCCGCATGCTGCACCTGCTGGCCGCCATTGGCCTCTTCGCCGCCGCCTGGGTCTGCAAGGTCCGACGC
ACGCACGACCGGTCCGAGGAGGGCCACATGTCCGAGTCGACACCGCTCCTCAACGGCTCCGGCTACACCTCGTAC
GACACGCAGCAGAATGCCGATCATGCCGAGTCCGCCCAGGCCCGAGCCGAGCGCCGACGCCGACAGTCGGCCTCG
AACGCCGCCAACGGCAGCGCCGCCAACGGAGTCGGCGGCGGCGGCGGCGGCGGCGGCAAACCCGCGGGAAAGGGT
GCGCCCGGCGGCAAGGACGAGCCGGCCGCCTTTTATCGCCCCGAAAAGCTGCCGCACCGGACCTGGTGGGAGTAC
CTTAGGGGCTACTCCCTCTTCTTCCCGTACCTGTGGCCCAAGGACACGCTGGCGCTGCAGCTGCACGTGCTGGCC
TGCTTCGGCCTGGTCATCCTGCAGAGGCTGGTCAACGTGGCCGTCCCGTACCAGATCGGCCAGGTCGTCAACAAG
CTCGAGGCGGCCATCAGGGAGGTCCGGAACGGGGGCTCCCTCACGACCGAGAGCTTCCCCCTCAAGGACTTCAGC
TTGCTCGGCGCGCTCTGGATACTCCAGGGCCAGTCGGGGCTCCTGGGCTCCCTGAGGTCGCTGCTCTGGATCCCC
GTGTCGCAGTACTCGTACCGGGGCCTGACGACGGCCGCCTTCAACCACGTCCACTCGCTCAGCCTCGACTTCCAC
CTGTCGAAGCGCACCGGCGAGGTGCTCTCGGCCCTCAACAAGGGGTCCGCCATCAACCAGTTTCTCGAGCAGGTG
ACGTTCCAGGTGGTGCCCATGCTCTTCGACCTGTTCCTCTCCATCTCCGTCTTCTACTACCAGTACGGCCCGCTC
TACGCCGAGATCAACCTGGTCGACACGTGCTGGTACCTGTACATGACGATCAAGATGGCCTCGACCCGGGCGGAC
CAGAGGCGCGAGATGACCAACGCGGACCGCGAAGAGGAGGCCGTCAAGAATGATTCCATCTCGAGCTACGAGACG
GTCAAGTACTTCAACGCCGAGGAGTACGAGTCGAACCGGTACCAGGACAAGGTCGGCGTCTTCCAGTCGGCCGAG
GCCAAGGTGCAGATGGGCATGGTCATGATGAACATCTGCCAGACGCTCGTCTTCAACCTGGGCCGCATCGTCGCC
GCCGTCGTGTGCGGATGGCAGGTGGCCGTCGGCATGCGGAACACGGGCGACTGGTTCATGGTGGTCTCGTACCTG
ACGCAGCTGCAGGGCCCCCTCAACTTCTTCGGCACCTTCTACCGCACCGTCCAGCAGGCCATGATCTCGGGCGAG
CGCCTCCTCGAGCTCTTCAAGATCCAGCCGACCGTCGTCGACACGCCGCACGCCGTCGCCCTCGCCGACTTCCGC
GGCCACATCCGGTGGAACGACGTCAGCTTCTCGTACGACCGGCGCAAGCCGGCCCTGCGCAACGTCAGCTTCGAG
TGCGCGCCGGGCACGACGACGGCCTTCGTCGGCGAGTCGGGCGGCGGCAAGTCGACGCTCTTCCGCCACATGTTC
CGCTACTACGACTGCGACGAGGGCAGCATCGAGCTCGACGGCAGGAACGTCAAGGACCTGACGATCGACTCGGTG
CGGGCGAACATTGGCGTCGTGCCCCAGGACACGAGCCTCTTCAACGAGTCGCTCATGTACAACCTCAAGTACGCC
AACCCCGCGGCCAGCGACGAGGAAGTGTACGAGGCCTGCCGCGCCGCCAGCATCCACGACCGCATCATGACCTTC
CCGGACAGGTACGAGACGCAGGTGGGCGAGAGGGGGCTGCGGCTCAGCGGCGGCGAGAAGCAGCGGGTCGCCATC
GCCCGCACCATCCTGAAGGACCCGCGCATCATCATGCTGGACGAGGCCACGTCGGCGCTCGACACGCACACGGAG
CAGGAGATTCAGGACAACGTGTGGAAGATTGGCAAGGGCCGCACCTTGCTCGTGATTGCGCACCGTCTGTCCACC
ATTACGCATGCGGACCAGATTGTCGTGCTGCACGCCGGAGAGATCGTGGAGAAGGGCACGCACGAGGAGCTGCTG
GCCGTGCAGGGGCGCTACGCCTCCATGTGGGAGAAGCAGATACGGGCCGAGAGAGCCCTGGACAAAGCAAGAGAG
GCTACCATCAAAGCGGCCAAGGCGATGAAGCGGGCTAACATGGGTGCCAAGGCGGACGCGGCCGACGAGCACACG
GACGACTACCACACGCTCGGGTCTTCGGGCATCCTGTCGGACAACGACACGTCGAAGAGCAAAGGCGACGAGGAG
TGCTCGTCGTCGTCGTCGTCGGGCTCGTCGGCCTCTTCGGACGTCGACTCGGCGCACGAAGTCGAACGCGCGGCG
GCGCAGCATGCCGGCGCCCAGTCGAGCCTCACGGTTCCACGTCCCGGACCGGGGCGATAG
Gene >Hirsu2|1740
ATGCCGGCCGACGACGAGAAGCAGGCCTCCCCACGACAAGGCTCCGACCATGGCCGCCCCAGCTCGGTCGACCTC
ATCCTCCGCGAAACCCAGTACCTCTACGCCCTGGTCCTGCTGGCCGTCTTCATCACCGGCGCCGCCTGGTACAGC
GTTTACAATGCCAAGAAGCAGGAGGACCTCGCCCAGCCCGTCGTCAAGGGCCCCGGCGGAAAGCCGCTGCCCGTC
ACCAAGCGCAAGAGGCGTGACGACAACGAGCGCAAGATCGGGCCTCGCTTCGGCCGAACCGGCAAGAACGTCTTC
CGATACCTCGTCTTCGTCATCTTCTCGACCTACATCGCCAGCAGCGCCGCCCTCTTCGTCCACGCCTTTTGGCAC
GAGAACCCCTACAAGTGGTCCAAGGAAGGCCTTCCTTGGGCCGGCGAATGGACCGTGGTACGTCGTCCCTCCCCC
CCCCTCCAGCCACTCACGCCCGTCTGGCCCGTCCGTTGGCGTCGACGCCGTCGTCCCTCGGGCACCAACGGTCCA
CGGCCGAGCCGAGCCACCCCCCTGCCTGCTCGCCCTCGCCTGCTTACCCAGTACCACATAGGTTCATGTGACCGG
CTCCACCTTCTTCTACCTCTACATCCTATTCTCGCTCTTTGACTGGCGCAAAGGCCCCAACATTGTCCATCTGAC
CGTCTGGGTCCTGGCCTTCGCGGCCGAGGCCGTCATGGCCACGGCCACCTTCGTCGCCGCCGCCCGTTGCCACTT
CGCCCGCCCGCCCCGATCCGGGGACGCCTCCAGGGCACGCAGCTGCGTCGACTACTGGACCAGGATCGACCTCAT
CCTCTACTTCGTCCGCATGCTGCACCTGCTGGCCGCCATTGGCCTCTTCGCCGCCGCCTGGGTCTGCAAGGTCCG
ACGCACGCACGACCGGTCCGAGGAGGGCCACATGTCCGAGTCGACACCGCTCCTCAACGGCTCCGGCTACACCTC
GTACGACACGCAGCAGAATGCCGATCATGCCGAGTCCGCCCAGGCCCGAGCCGAGCGCCGACGCCGACAGTCGGC
CTCGAACGCCGCCAACGGCAGCGCCGCCAACGGAGTCGGCGGCGGCGGCGGCGGCGGCGGCAAACCCGCGGGAAA
GGGTGCGCCCGGCGGCAAGGACGAGCCGGCCGCCTTTTATCGCCCCGAAAAGCTGCCGCACCGGACCTGGTGGGA
GTACCTTAGGGGCTACTCCCTCTTCTTCCCGTACCTGTGGCCCAAGGACACGCTGGCGCTGCAGCTGCACGTGCT
GGCCTGCTTCGGCCTGGTCATCCTGCAGAGGCTGGTCAACGTGGCCGTCCCGTACCAGATCGGCCAGGTCGTCAA
CAAGCTCGAGGCGGCCATCAGGGAGGTCCGGAACGGGGGCTCCCTCACGACCGAGAGCTTCCCCCTCAAGGACTT
CAGCTTGCTCGGCGCGCTCTGGATACTCCAGGGCCAGTCGGGGCTCCTGGGCTCCCTGAGGTCGCTGCTCTGGAT
CCCCGTGTCGCAGTACTCGTACCGGGGCCTGACGACGGCCGCCTTCAACCACGTCCACTCGCTCAGCCTCGACTT
CCACCTGTCGAAGCGCACCGGCGAGGTGCTCTCGGCCCTCAACAAGGGGTCCGCCATCAACCAGTTTCTCGAGCA
GGTGACGTTCCAGGTGGTGCCCATGCTCTTCGACCTGTTCCTCTCCATCTCCGTCTTCTACTACCAGTACGGCCC
GCTCTACGCCGAGATCAACCTGGTCGACACGTGCTGGTACCTGTACATGACGATCAAGATGGCCTCGACCCGGGC
GGACCAGAGGCGCGAGATGACCAACGCGGACCGCGAAGAGGAGGCCGTCAAGAATGATTCCATCTCGAGCTACGA
GACGGTCAAGTACTTCAACGCCGAGGAGTACGAGTCGAACCGGTACCAGGACAAGGTCGGCGTCTTCCAGTCGGC
CGAGGCCAAGGTGCAGATGGGCATGGTCATGATGAACATCTGCCAGACGCTCGTCTTCAACCTGGGCCGCATCGT
CGCCGCCGTCGTGTGCGGATGGCAGGTGGCCGTCGGCATGCGGAACACGGGCGACTGGTTCATGGTGGTCTCGTA
CCTGACGCAGCTGCAGGGCCCCCTCAACTTCTTCGGCACCTTCTACCGCACCGTCCAGCAGGCCATGATCTCGGG
CGAGCGCCTCCTCGAGCTCTTCAAGATCCAGCCGACCGTCGTCGACACGCCGCACGCCGTCGCCCTCGCCGACTT
CCGCGGCCACATCCGGTGGAACGACGTCAGCTTCTCGTACGACCGGCGCAAGCCGGCCCTGCGCAACGTCAGCTT
CGAGTGCGCGCCGGGCACGACGACGGCCTTCGTCGGCGAGTCGGGCGGCGGCAAGTCGACGCTCTTCCGCCACAT
GTTCCGCTACTACGACTGCGACGAGGGCAGCATCGAGCTCGACGGCAGGAACGTCAAGGACCTGACGATCGACTC
GGTGCGGGCGAACATTGGCGTCGTGCCCCAGGACACGAGCCTCTTCAACGAGTCGCTCATGTACAACCTCAAGTA
CGCCAACCCCGCGGCCAGCGACGAGGAAGTGTACGAGGCCTGCCGCGCCGCCAGCATCCACGACCGCATCATGAC
CTTCCCGGACAGGTACGAGACGCAGGTGGGCGAGAGGGGGCTGCGGCTCAGCGGCGGCGAGAAGCAGCGGGTCGC
CATCGCCCGCACCATCCTGAAGGACCCGCGCATCATCATGCTGGACGAGGCCACGTCGGCGCTCGACACGCACAC
GGAGCAGGAGATTCAGGACAACGTGTGGAAGATTGGCAAGGGCCGCACCTTGCTCGTGATTGCGTGAGTCGAGCG
ACCCCCCACCCCCCTTGCAAAAAGTCTGTTGACGGGAACGTGCTGACGTTGTCCGCGCAGGCACCGTCTGTCCAC
CATTACGCATGCGGACCAGATTGTCGTGCTGCACGCCGGAGAGATCGTGGAGAAGGGCACGCACGAGGAGCTGCT
GGCCGTGCAGGGGCGCTACGCCTCCATGTGGGAGAAGCAGATACGGGCCGAGAGAGCCCTGGACAAAGCAAGAGA
GGCTACCATCAAAGCGGCCAAGGCGATGAAGCGGGCTAACATGGGTGCCAAGGCGGACGCGGCCGACGAGCACAC
GGACGACTACCACACGCTCGGGTCTTCGGGCATCCTGTCGGACAACGACACGTCGAAGAGCAAAGGCGACGAGGA
GTGCTCGTCGTCGTCGTCGTCGGGCTCGTCGGCCTCTTCGGACGTCGACTCGGCGCACGAAGTCGAACGCGCGGC
GGCGCAGCATGCCGGCGCCCAGTCGAGCCTCACGGTTCCACGTCCCGGACCGGGGCGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail