Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|174
Gene name
LocationContig_103:1101..2160
Strand-
Gene length (bp)1059
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7T6|SEC59_SCHPO Dolichol kinase sec59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec59 PE=3 SV=3 122 350 4.0E-37
sp|F4J4C8|EVN_ARATH Dolichol kinase EVAN OS=Arabidopsis thaliana GN=EVN PE=2 SV=1 93 279 1.0E-26
sp|P20048|SEC59_YEAST Dolichol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC59 PE=1 SV=1 95 348 1.0E-22
sp|Q58CR4|DOLK_BOVIN Dolichol kinase OS=Bos taurus GN=DOLK PE=2 SV=1 93 279 2.0E-22
sp|Q9UPQ8|DOLK_HUMAN Dolichol kinase OS=Homo sapiens GN=DOLK PE=1 SV=1 96 288 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7T6|SEC59_SCHPO Dolichol kinase sec59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec59 PE=3 SV=3 122 350 4.0E-37
sp|F4J4C8|EVN_ARATH Dolichol kinase EVAN OS=Arabidopsis thaliana GN=EVN PE=2 SV=1 93 279 1.0E-26
sp|P20048|SEC59_YEAST Dolichol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC59 PE=1 SV=1 95 348 1.0E-22
sp|Q58CR4|DOLK_BOVIN Dolichol kinase OS=Bos taurus GN=DOLK PE=2 SV=1 93 279 2.0E-22
sp|Q9UPQ8|DOLK_HUMAN Dolichol kinase OS=Homo sapiens GN=DOLK PE=1 SV=1 96 288 2.0E-21
sp|Q8R2Y3|DOLK_MOUSE Dolichol kinase OS=Mus musculus GN=Dolk PE=1 SV=1 96 288 6.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 98 120 22
3 132 166 34
4 198 220 22
5 241 258 17
6 273 295 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|174
MKKWLYAAYIYACLLAIILVGVRLHVQDHALSGNEPIGWGLGYVLGDWPWFRFQVVQANLERWICLPRLADSESP
GERQCHMGWVQQVRHDDLGEANTRLALGGYWLVILVVGLLIVFRLKETYEVDTRRKVFHFMMVGMFLPGTFVDPA
FAALALSLVLAVFLILDLLRASQLPPLSKPLAAFLAPYVDGRDFRGPVVISHIFLLIGCAIPLWLALATLPRAGS
GQLAGWEVPTRDVSMVAGVVCVGLGDAAASLIGRRYGHHKWFWGGGKSLEGSVAFAVAVFAGLSAARAWVRVGGW
PTTDDATGWLASARNAGICASMASLTEAVLTGGNDNVIVPVVLWTCVKSLGV*
Coding >Hirsu2|174
ATGAAAAAGTGGCTCTACGCCGCCTACATCTACGCGTGCCTGCTGGCAATCATTCTCGTTGGCGTCCGATTGCAC
GTGCAGGATCATGCCCTCAGCGGCAACGAGCCCATCGGATGGGGGCTGGGCTATGTCTTGGGTGACTGGCCGTGG
TTTCGATTTCAGGTGGTCCAGGCCAATCTCGAACGATGGATCTGCTTGCCTCGACTTGCAGACTCGGAAAGTCCG
GGCGAACGGCAATGCCACATGGGCTGGGTGCAGCAGGTTCGCCACGACGACTTGGGGGAAGCAAATACGAGGCTC
GCTCTCGGCGGATACTGGCTCGTGATTCTCGTCGTCGGCTTGCTCATCGTGTTCCGGCTCAAGGAAACGTACGAA
GTCGACACTCGGCGCAAGGTTTTCCACTTCATGATGGTCGGCATGTTCCTCCCCGGAACCTTTGTCGATCCCGCC
TTCGCCGCCCTGGCTCTGTCGTTGGTTCTGGCCGTCTTCCTCATCCTGGACCTCCTGAGAGCGAGCCAGCTGCCG
CCCCTGTCGAAACCCCTCGCGGCCTTCTTGGCGCCCTACGTCGACGGGAGAGACTTCCGGGGCCCAGTCGTCATA
TCCCACATATTCCTACTCATCGGATGCGCCATACCTCTGTGGCTGGCCCTGGCGACGCTGCCGCGAGCAGGGTCG
GGACAGCTGGCCGGCTGGGAGGTTCCCACGAGAGACGTGAGCATGGTGGCGGGCGTCGTCTGCGTTGGCCTCGGC
GATGCGGCTGCCTCGCTCATCGGGCGACGCTACGGACACCACAAGTGGTTCTGGGGGGGCGGCAAGAGCCTCGAA
GGGAGCGTCGCGTTCGCCGTCGCCGTCTTCGCCGGCCTGTCCGCGGCGCGCGCATGGGTGCGGGTTGGCGGCTGG
CCGACCACCGACGATGCGACGGGCTGGCTCGCCAGCGCCCGCAATGCCGGCATCTGCGCGTCGATGGCGAGCCTG
ACGGAGGCGGTCTTGACGGGGGGTAACGACAACGTCATCGTCCCCGTCGTCCTGTGGACCTGCGTCAAGAGTCTG
GGGGTGTAG
Transcript >Hirsu2|174
ATGAAAAAGTGGCTCTACGCCGCCTACATCTACGCGTGCCTGCTGGCAATCATTCTCGTTGGCGTCCGATTGCAC
GTGCAGGATCATGCCCTCAGCGGCAACGAGCCCATCGGATGGGGGCTGGGCTATGTCTTGGGTGACTGGCCGTGG
TTTCGATTTCAGGTGGTCCAGGCCAATCTCGAACGATGGATCTGCTTGCCTCGACTTGCAGACTCGGAAAGTCCG
GGCGAACGGCAATGCCACATGGGCTGGGTGCAGCAGGTTCGCCACGACGACTTGGGGGAAGCAAATACGAGGCTC
GCTCTCGGCGGATACTGGCTCGTGATTCTCGTCGTCGGCTTGCTCATCGTGTTCCGGCTCAAGGAAACGTACGAA
GTCGACACTCGGCGCAAGGTTTTCCACTTCATGATGGTCGGCATGTTCCTCCCCGGAACCTTTGTCGATCCCGCC
TTCGCCGCCCTGGCTCTGTCGTTGGTTCTGGCCGTCTTCCTCATCCTGGACCTCCTGAGAGCGAGCCAGCTGCCG
CCCCTGTCGAAACCCCTCGCGGCCTTCTTGGCGCCCTACGTCGACGGGAGAGACTTCCGGGGCCCAGTCGTCATA
TCCCACATATTCCTACTCATCGGATGCGCCATACCTCTGTGGCTGGCCCTGGCGACGCTGCCGCGAGCAGGGTCG
GGACAGCTGGCCGGCTGGGAGGTTCCCACGAGAGACGTGAGCATGGTGGCGGGCGTCGTCTGCGTTGGCCTCGGC
GATGCGGCTGCCTCGCTCATCGGGCGACGCTACGGACACCACAAGTGGTTCTGGGGGGGCGGCAAGAGCCTCGAA
GGGAGCGTCGCGTTCGCCGTCGCCGTCTTCGCCGGCCTGTCCGCGGCGCGCGCATGGGTGCGGGTTGGCGGCTGG
CCGACCACCGACGATGCGACGGGCTGGCTCGCCAGCGCCCGCAATGCCGGCATCTGCGCGTCGATGGCGAGCCTG
ACGGAGGCGGTCTTGACGGGGGGTAACGACAACGTCATCGTCCCCGTCGTCCTGTGGACCTGCGTCAAGAGTCTG
GGGGTGTAG
Gene >Hirsu2|174
ATGAAAAAGTGGCTCTACGCCGCCTACATCTACGCGTGCCTGCTGGCAATCATTCTCGTTGGCGTCCGATTGCAC
GTGCAGGATCATGCCCTCAGCGGCAACGAGCCCATCGGATGGGGGCTGGGCTATGTCTTGGGTGACTGGCCGTGG
TTTCGATTTCAGGTGGTCCAGGCCAATCTCGAACGATGGATCTGCTTGCCTCGACTTGCAGACTCGGAAAGTCCG
GGCGAACGGCAATGCCACATGGGCTGGGTGCAGCAGGTTCGCCACGACGACTTGGGGGAAGCAAATACGAGGCTC
GCTCTCGGCGGATACTGGCTCGTGATTCTCGTCGTCGGCTTGCTCATCGTGTTCCGGCTCAAGGAAACGTACGAA
GTCGACACTCGGCGCAAGGTTTTCCACTTCATGATGGTCGGCATGTTCCTCCCCGGAACCTTTGTCGATCCCGCC
TTCGCCGCCCTGGCTCTGTCGTTGGTTCTGGCCGTCTTCCTCATCCTGGACCTCCTGAGAGCGAGCCAGCTGCCG
CCCCTGTCGAAACCCCTCGCGGCCTTCTTGGCGCCCTACGTCGACGGGAGAGACTTCCGGGGCCCAGTCGTCATA
TCCCACATATTCCTACTCATCGGATGCGCCATACCTCTGTGGCTGGCCCTGGCGACGCTGCCGCGAGCAGGGTCG
GGACAGCTGGCCGGCTGGGAGGTTCCCACGAGAGACGTGAGCATGGTGGCGGGCGTCGTCTGCGTTGGCCTCGGC
GATGCGGCTGCCTCGCTCATCGGGCGACGCTACGGACACCACAAGTGGTTCTGGGGGGGCGGCAAGAGCCTCGAA
GGGAGCGTCGCGTTCGCCGTCGCCGTCTTCGCCGGCCTGTCCGCGGCGCGCGCATGGGTGCGGGTTGGCGGCTGG
CCGACCACCGACGATGCGACGGGCTGGCTCGCCAGCGCCCGCAATGCCGGCATCTGCGCGTCGATGGCGAGCCTG
ACGGAGGCGGTCTTGACGGGGGGTAACGACAACGTCATCGTCCCCGTCGTCCTGTGGACCTGCGTCAAGAGTCTG
GGGGTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail