Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1729
Gene name
LocationContig_1391:25..1651
Strand-
Gene length (bp)1626
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00483 NTP_transferase Nucleotidyl transferase 1.8E-31 18 213
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 1.8E-06 324 357
PF12804 NTP_transf_3 MobA-like NTP transferase domain 8.6E-07 19 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60064|YBB2_SCHPO Probable mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.02 PE=3 SV=1 17 450 5.0E-150
sp|I3LUP1|GMPPA_PIG Mannose-1-phosphate guanyltransferase alpha OS=Sus scrofa GN=GMPPA PE=1 SV=2 18 450 2.0E-119
sp|Q922H4|GMPPA_MOUSE Mannose-1-phosphate guanyltransferase alpha OS=Mus musculus GN=Gmppa PE=1 SV=1 18 450 2.0E-119
sp|Q96IJ6|GMPPA_HUMAN Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens GN=GMPPA PE=1 SV=1 18 450 3.0E-119
sp|B0CM52|GMPPA_PAPAN Mannose-1-phosphate guanyltransferase alpha OS=Papio anubis GN=GMPPA PE=3 SV=1 18 450 3.0E-119
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60064|YBB2_SCHPO Probable mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.02 PE=3 SV=1 17 450 5.0E-150
sp|I3LUP1|GMPPA_PIG Mannose-1-phosphate guanyltransferase alpha OS=Sus scrofa GN=GMPPA PE=1 SV=2 18 450 2.0E-119
sp|Q922H4|GMPPA_MOUSE Mannose-1-phosphate guanyltransferase alpha OS=Mus musculus GN=Gmppa PE=1 SV=1 18 450 2.0E-119
sp|Q96IJ6|GMPPA_HUMAN Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens GN=GMPPA PE=1 SV=1 18 450 3.0E-119
sp|B0CM52|GMPPA_PAPAN Mannose-1-phosphate guanyltransferase alpha OS=Papio anubis GN=GMPPA PE=3 SV=1 18 450 3.0E-119
sp|Q6GMK8|GMPAA_DANRE Mannose-1-phosphate guanyltransferase alpha-A OS=Danio rerio GN=gmppaa PE=2 SV=1 18 450 3.0E-119
sp|Q66KG5|GMPAB_XENLA Mannose-1-phosphate guanyltransferase alpha-B OS=Xenopus laevis GN=gmppa-b PE=2 SV=1 18 450 4.0E-119
sp|Q0VFM6|GMPPA_XENTR Mannose-1-phosphate guanyltransferase alpha OS=Xenopus tropicalis GN=gmppa PE=2 SV=1 18 450 4.0E-119
sp|Q5XIC1|GMPPA_RAT Mannose-1-phosphate guanyltransferase alpha OS=Rattus norvegicus GN=Gmppa PE=2 SV=1 18 450 6.0E-118
sp|Q7SXP8|GMPAB_DANRE Mannose-1-phosphate guanyltransferase alpha-B OS=Danio rerio GN=gmppab PE=2 SV=1 18 450 6.0E-118
sp|Q86HG0|GMPPA_DICDI Mannose-1-phosphate guanyltransferase alpha OS=Dictyostelium discoideum GN=gmppA PE=2 SV=1 16 450 8.0E-116
sp|Q6DKE9|GMPAA_XENLA Mannose-1-phosphate guanyltransferase alpha-A OS=Xenopus laevis GN=gmppa-a PE=2 SV=1 18 450 4.0E-115
sp|Q941T9|GMPP2_ORYSJ Probable mannose-1-phosphate guanylyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os01g0847200 PE=2 SV=1 18 450 4.0E-56
sp|Q6Z9A3|GMPP3_ORYSJ Probable mannose-1-phosphate guanylyltransferase 3 OS=Oryza sativa subsp. japonica GN=Os08g0237200 PE=2 SV=1 18 450 1.0E-55
sp|Q6BN12|MPG1_DEBHA Mannose-1-phosphate guanyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MPG1 PE=3 SV=1 18 450 2.0E-55
sp|Q6FRY2|MPG12_CANGA Mannose-1-phosphate guanyltransferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPG1 PE=3 SV=1 18 450 5.0E-55
sp|O93827|MPG1_CANAL Mannose-1-phosphate guanyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MPG1 PE=1 SV=1 18 450 8.0E-55
sp|Q84JH5|GMPP1_ORYSJ Probable mannose-1-phosphate guanylyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os03g0268400 PE=2 SV=1 18 450 4.0E-54
sp|P41940|MPG1_YEAST Mannose-1-phosphate guanyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSA1 PE=1 SV=2 18 450 5.0E-54
sp|Q70SJ2|MPG1_KLULA Mannose-1-phosphate guanyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MPG1 PE=1 SV=1 18 450 5.0E-54
sp|O22287|GMPP1_ARATH Mannose-1-phosphate guanylyltransferase 1 OS=Arabidopsis thaliana GN=CYT1 PE=1 SV=1 18 450 1.0E-53
sp|Q54K39|GMPPB_DICDI Mannose-1-phosphate guanyltransferase beta OS=Dictyostelium discoideum GN=gmppB PE=2 SV=1 18 450 4.0E-53
sp|Q9P8N0|MPG1_PICAN Mannose-1-phosphate guanyltransferase OS=Pichia angusta GN=MPG1 PE=3 SV=1 18 450 7.0E-53
sp|O74624|MPG1_HYPJE Mannose-1-phosphate guanyltransferase OS=Hypocrea jecorina GN=mpg1 PE=1 SV=1 18 444 1.0E-52
sp|Q4I1Y5|MPG1_GIBZE Mannose-1-phosphate guanyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MPG1 PE=3 SV=1 18 444 7.0E-52
sp|Q6CCU3|MPG1_YARLI Mannose-1-phosphate guanyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MPG1 PE=3 SV=1 18 450 1.0E-51
sp|Q7RVR8|MPG1_NEUCR Mannose-1-phosphate guanyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpg-1 PE=3 SV=1 18 450 2.0E-51
sp|Q2UJU5|MPG1_ASPOR Mannose-1-phosphate guanyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpg1 PE=3 SV=1 18 444 1.0E-50
sp|O74484|MPG1_SCHPO Mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpg1 PE=2 SV=1 18 444 2.0E-50
sp|Q9Y725|MPG11_CANGA Mannose-1-phosphate guanyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPG1 PE=1 SV=1 18 450 3.0E-50
sp|Q4U3E8|MPG1_ASPFU Mannose-1-phosphate guanyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mpg1 PE=2 SV=1 18 444 4.0E-50
sp|Q5B1J4|MPG1_EMENI Mannose-1-phosphate guanyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpg1 PE=3 SV=2 18 444 9.0E-50
sp|Q6DBU5|GMPPB_DANRE Mannose-1-phosphate guanyltransferase beta OS=Danio rerio GN=gmppb PE=2 SV=1 18 444 2.0E-49
sp|Q752H4|MPG1_ASHGO Mannose-1-phosphate guanyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MPG1 PE=3 SV=1 18 450 3.0E-49
sp|Q9M2S0|GMPP2_ARATH Probable mannose-1-phosphate guanylyltransferase 2 OS=Arabidopsis thaliana GN=At3g55590 PE=2 SV=1 18 444 3.0E-49
sp|P0C5I2|GMPPB_PIG Mannose-1-phosphate guanyltransferase beta OS=Sus scrofa GN=GMPPB PE=1 SV=1 18 444 8.0E-48
sp|Q9Y5P6|GMPPB_HUMAN Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens GN=GMPPB PE=1 SV=2 18 444 1.0E-47
sp|P0CO20|MPG1_CRYNJ Mannose-1-phosphate guanyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MPG1 PE=2 SV=1 18 445 2.0E-47
sp|P0CO21|MPG1_CRYNB Mannose-1-phosphate guanyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MPG1 PE=3 SV=1 18 445 2.0E-47
sp|Q2YDJ9|GMPPB_BOVIN Mannose-1-phosphate guanyltransferase beta OS=Bos taurus GN=GMPPB PE=2 SV=1 18 444 4.0E-47
sp|Q68EQ1|GMPPB_XENTR Mannose-1-phosphate guanyltransferase beta OS=Xenopus tropicalis GN=gmppb PE=2 SV=1 18 444 4.0E-47
sp|Q7JZB4|GMPPB_DROME Mannose-1-phosphate guanyltransferase beta OS=Drosophila melanogaster GN=CG1129 PE=2 SV=1 10 450 4.0E-47
sp|Q8BTZ7|GMPPB_MOUSE Mannose-1-phosphate guanyltransferase beta OS=Mus musculus GN=Gmppb PE=1 SV=1 18 444 4.0E-47
sp|Q295Y7|GMPPB_DROPS Mannose-1-phosphate guanyltransferase beta OS=Drosophila pseudoobscura pseudoobscura GN=GA10892 PE=3 SV=1 16 450 1.0E-46
sp|Q68EY9|GMPBA_XENLA Mannose-1-phosphate guanyltransferase beta-A OS=Xenopus laevis GN=gmppb-a PE=2 SV=1 18 444 2.0E-46
sp|A2VD83|GMPBB_XENLA Mannose-1-phosphate guanyltransferase beta-B OS=Xenopus laevis GN=gmppb-b PE=2 SV=1 18 444 3.0E-46
sp|A3QMC8|GMPPB_CAEEL Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis elegans GN=tag-335 PE=3 SV=1 18 450 4.0E-42
sp|Q8H1Q7|GMPP3_ARATH Probable mannose-1-phosphate guanylyltransferase 3 OS=Arabidopsis thaliana GN=At4g30570 PE=2 SV=1 39 425 2.0E-41
sp|Q61S97|GMPPB_CAEBR Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis briggsae GN=tag-335 PE=3 SV=2 18 450 2.0E-39
sp|A6UUQ4|GLMU_META3 Bifunctional protein GlmU OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_0642 PE=3 SV=1 19 385 2.0E-19
sp|A6VG23|GLMU_METM7 Bifunctional protein GlmU OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0329 PE=3 SV=1 19 428 3.0E-19
sp|Q58501|GLMU_METJA Bifunctional protein GlmU OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glmU PE=1 SV=1 19 428 4.0E-18
sp|B8G1G5|GLGC_DESHD Glucose-1-phosphate adenylyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=glgC PE=3 SV=1 19 398 2.0E-17
sp|Q24VW5|GLGC_DESHY Glucose-1-phosphate adenylyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=glgC PE=3 SV=1 19 398 2.0E-17
sp|P37820|MPG1_SULAC Putative mannose-1-phosphate guanyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=mpg1 PE=3 SV=2 19 447 2.0E-17
sp|D4GYH1|AGLF_HALVD UTP--glucose-1-phosphate uridylyltransferase AglF OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglF PE=1 SV=1 18 236 3.0E-17
sp|A4FX98|GLMU_METM5 Bifunctional protein GlmU OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0513 PE=3 SV=1 19 428 6.0E-17
sp|A6UP85|GLMU_METVS Bifunctional protein GlmU OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0399 PE=3 SV=1 19 428 8.0E-17
sp|Q6LYB5|GLMU_METMP Bifunctional protein GlmU OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1076 PE=3 SV=1 19 428 7.0E-16
sp|Q890J0|GLGC_LACPL Glucose-1-phosphate adenylyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glgC PE=3 SV=1 14 402 1.0E-15
sp|Q18A75|GLGC_PEPD6 Glucose-1-phosphate adenylyltransferase OS=Peptoclostridium difficile (strain 630) GN=glgC PE=3 SV=1 19 379 4.0E-13
sp|A4J4I2|GLGC_DESRM Glucose-1-phosphate adenylyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=glgC PE=3 SV=1 19 423 2.0E-12
sp|Q8DT53|GLGC_STRMU Glucose-1-phosphate adenylyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glgC PE=3 SV=2 19 393 2.0E-11
sp|B9DRS6|GLGC_STRU0 Glucose-1-phosphate adenylyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=glgC PE=3 SV=1 19 393 2.0E-11
sp|A0Q3I7|GLGC_CLONN Glucose-1-phosphate adenylyltransferase OS=Clostridium novyi (strain NT) GN=glgC PE=3 SV=1 19 417 3.0E-11
sp|A3CM02|GLGC_STRSV Glucose-1-phosphate adenylyltransferase OS=Streptococcus sanguinis (strain SK36) GN=glgC PE=3 SV=1 19 393 7.0E-11
sp|C1CRM1|GLGC_STRZT Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=glgC PE=3 SV=1 19 429 9.0E-11
sp|C1CKI5|GLGC_STRZP Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=glgC PE=3 SV=1 19 429 9.0E-11
sp|C1CEA8|GLGC_STRZJ Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=glgC PE=3 SV=1 19 429 9.0E-11
sp|Q97QS7|GLGC_STRPN Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glgC PE=3 SV=1 19 429 9.0E-11
sp|B8ZPW3|GLGC_STRPJ Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=glgC PE=3 SV=1 19 429 9.0E-11
sp|B1IBQ8|GLGC_STRPI Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=glgC PE=3 SV=1 19 429 9.0E-11
sp|Q9WY82|GLGC_THEMA Glucose-1-phosphate adenylyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glgC PE=3 SV=1 14 428 9.0E-11
sp|Q8DPS5|GLGC_STRR6 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glgC PE=3 SV=1 19 429 9.0E-11
sp|Q04KG7|GLGC_STRP2 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glgC PE=3 SV=1 19 429 9.0E-11
sp|B2IPY6|GLGC_STRPS Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=glgC PE=3 SV=1 19 429 1.0E-10
sp|B5E4N4|GLGC_STRP4 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=glgC PE=3 SV=1 19 429 1.0E-10
sp|C1C7B5|GLGC_STRP7 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=glgC PE=3 SV=1 19 429 1.0E-10
sp|B1L9R3|GLGC_THESQ Glucose-1-phosphate adenylyltransferase OS=Thermotoga sp. (strain RQ2) GN=glgC PE=3 SV=1 14 428 1.0E-10
sp|Q8RF63|GLGC_FUSNN Glucose-1-phosphate adenylyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glgC PE=3 SV=1 19 378 2.0E-10
sp|A8AYH2|GLGC_STRGC Glucose-1-phosphate adenylyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=glgC PE=3 SV=1 19 393 2.0E-10
sp|C0MH79|GLGC_STRS7 Glucose-1-phosphate adenylyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=glgC PE=3 SV=1 19 393 2.0E-10
sp|Q97GX8|GLGC_CLOAB Glucose-1-phosphate adenylyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glgC PE=3 SV=1 19 416 6.0E-10
sp|Q5FL67|GLGC_LACAC Glucose-1-phosphate adenylyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=glgC PE=3 SV=1 19 393 6.0E-10
sp|A4IS22|GLGC_GEOTN Glucose-1-phosphate adenylyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glgC PE=3 SV=1 19 378 8.0E-10
sp|Q7UXF5|GLGC_RHOBA Glucose-1-phosphate adenylyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=glgC PE=3 SV=1 17 423 9.0E-10
sp|A7HN65|GLGC_FERNB Glucose-1-phosphate adenylyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=glgC PE=3 SV=1 19 431 2.0E-09
sp|A5IKI1|GLGC_THEP1 Glucose-1-phosphate adenylyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glgC PE=3 SV=1 14 433 3.0E-09
sp|O08326|GLGC_GEOSE Glucose-1-phosphate adenylyltransferase OS=Geobacillus stearothermophilus GN=glgC PE=3 SV=1 19 378 3.0E-09
sp|D4GU70|AGL11_HALVD Low-salt glycan biosynthesis nucleotidyltransferase Agl11 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl11 PE=3 SV=1 18 386 6.0E-09
sp|B7IFV2|GLGC_THEAB Glucose-1-phosphate adenylyltransferase OS=Thermosipho africanus (strain TCF52B) GN=glgC PE=3 SV=1 19 434 7.0E-09
sp|B2GHR6|GLGC_KOCRD Glucose-1-phosphate adenylyltransferase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=glgC PE=3 SV=1 14 391 7.0E-09
sp|Q030T6|GLGC_LACLS Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=glgC PE=3 SV=1 19 447 1.0E-08
sp|Q9CHN1|GLGC_LACLA Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glgC PE=3 SV=1 19 447 1.0E-08
sp|O66863|GLMU_AQUAE Bifunctional protein GlmU OS=Aquifex aeolicus (strain VF5) GN=glmU PE=3 SV=1 18 442 2.0E-08
sp|B8J7Y5|GLGC_ANAD2 Glucose-1-phosphate adenylyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=glgC PE=3 SV=1 19 378 2.0E-08
sp|B4ULA3|GLGC_ANASK Glucose-1-phosphate adenylyltransferase OS=Anaeromyxobacter sp. (strain K) GN=glgC PE=3 SV=1 19 212 3.0E-08
sp|A2RMB7|GLGC_LACLM Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=glgC PE=3 SV=1 19 385 3.0E-08
sp|A6Q403|GLMU_NITSB Bifunctional protein GlmU OS=Nitratiruptor sp. (strain SB155-2) GN=glmU PE=3 SV=1 19 203 8.0E-08
sp|P0C7J4|RMLA_XANCP Glucose-1-phosphate thymidylyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rmlA PE=3 SV=1 18 207 9.0E-08
sp|B0RVK9|RMLA_XANCB Glucose-1-phosphate thymidylyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=rmlA PE=3 SV=1 18 207 9.0E-08
sp|Q65FS5|GLGC_BACLD Glucose-1-phosphate adenylyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glgC PE=3 SV=1 19 384 1.0E-07
sp|Q8E5V7|GLGC_STRA3 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glgC PE=3 SV=1 19 391 2.0E-07
sp|Q8E080|GLGC_STRA5 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glgC PE=3 SV=1 19 391 2.0E-07
sp|Q3K1K4|GLGC_STRA1 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=glgC PE=3 SV=1 19 391 2.0E-07
sp|Q0B0S9|GLMU_SYNWW Bifunctional protein GlmU OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=glmU PE=3 SV=1 19 373 2.0E-07
sp|Q6AMF9|GLMU_DESPS Bifunctional protein GlmU OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=glmU PE=3 SV=1 20 213 3.0E-07
sp|A1TRG1|GLGC_ACIAC Glucose-1-phosphate adenylyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=glgC PE=3 SV=1 19 215 3.0E-07
sp|B1MLL3|GLGC_MYCA9 Glucose-1-phosphate adenylyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=glgC PE=3 SV=1 19 213 5.0E-07
sp|Q6AF21|GLGC_LEIXX Glucose-1-phosphate adenylyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glgC PE=3 SV=1 19 423 6.0E-07
sp|Q2IM42|GLGC_ANADE Glucose-1-phosphate adenylyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=glgC PE=3 SV=1 19 212 6.0E-07
sp|B9J2G7|GLGC_BACCQ Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain Q1) GN=glgC PE=3 SV=1 19 384 7.0E-07
sp|Q816G7|GLGC_BACCR Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glgC PE=3 SV=1 19 385 8.0E-07
sp|A0JWV0|GLGC_ARTS2 Glucose-1-phosphate adenylyltransferase OS=Arthrobacter sp. (strain FB24) GN=glgC PE=3 SV=1 19 218 8.0E-07
sp|Q72YJ4|GLGC_BACC1 Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glgC PE=3 SV=1 19 385 9.0E-07
sp|A1WHV2|LPXD_VEREI UDP-3-O-acylglucosamine N-acyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=lpxD PE=3 SV=1 301 433 1.0E-06
sp|P39629|RMLA_BACSU Glucose-1-phosphate thymidylyltransferase OS=Bacillus subtilis (strain 168) GN=rmlA PE=1 SV=1 18 208 1.0E-06
sp|A4J0P6|GLMU_DESRM Bifunctional protein GlmU OS=Desulfotomaculum reducens (strain MI-1) GN=glmU PE=3 SV=1 19 213 1.0E-06
sp|B8H8I4|GLGC_ARTCA Glucose-1-phosphate adenylyltransferase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=glgC PE=3 SV=1 19 218 1.0E-06
sp|Q6HC16|GLGC_BACHK Glucose-1-phosphate adenylyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glgC PE=3 SV=1 19 385 1.0E-06
sp|Q632H2|GLGC_BACCZ Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=glgC PE=3 SV=1 19 385 1.0E-06
sp|Q81K83|GLGC_BACAN Glucose-1-phosphate adenylyltransferase OS=Bacillus anthracis GN=glgC PE=3 SV=1 19 385 1.0E-06
sp|A9VM89|GLGC_BACWK Glucose-1-phosphate adenylyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=glgC PE=3 SV=1 19 385 1.0E-06
sp|Q9CCA8|GLGC_MYCLE Glucose-1-phosphate adenylyltransferase OS=Mycobacterium leprae (strain TN) GN=glgC PE=3 SV=1 19 208 3.0E-06
sp|B8ZQY9|GLGC_MYCLB Glucose-1-phosphate adenylyltransferase OS=Mycobacterium leprae (strain Br4923) GN=glgC PE=3 SV=1 19 208 3.0E-06
sp|A1K6F9|GLGC_AZOSB Glucose-1-phosphate adenylyltransferase OS=Azoarcus sp. (strain BH72) GN=glgC PE=3 SV=1 19 218 3.0E-06
sp|A7GUA0|GLGC_BACCN Glucose-1-phosphate adenylyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glgC PE=3 SV=1 19 384 4.0E-06
sp|Q6NHY8|GLGC_CORDI Glucose-1-phosphate adenylyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=glgC PE=3 SV=1 19 213 5.0E-06
sp|B5YIR0|GLGC_THEYD Glucose-1-phosphate adenylyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=glgC PE=3 SV=1 19 378 7.0E-06
sp|A9BMM2|LPXD_DELAS UDP-3-O-acylglucosamine N-acyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=lpxD PE=3 SV=1 321 433 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0016779 nucleotidyltransferase activity Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1729
MSLQLPLTHRPKDQGATKAVILVGGPSRGTRFRPLSLDVPKPLFEVAGHPIIWHCLSSIARVPNKQIQEVYIIGY
YDESVFRDFIKDSAKEFPSVTIRYLREYQALGTAGGLYHFRDAILKGRPERLFVLNADVCCSFPLAEMLKLFVER
DAEAVILGTRVGDDAATNFGCIVSDAHTRRVLHYVEKPESRISNLINCGVYLFSTEAIFPSIKSAMKRRLDRPSR
LVSYPSSEHLDSYAGQGGEGGGDDDDDAGRKNEVIRLEQDILGDMADSKQFFVYETKDFWRQIKTAGSAVPANAL
YLQKAMQEASAELAPPSASIVAPVYIHPSAQVHPTAKLGPNVSIGPRVVVGAGARVRESIVLEDCEVKHDACILY
AIIGWGSRVGAWARVEGTPTPAGTHSTSIVKNGVKVQSITILGKDCAVGDEVRVSNCICLPFKELKRDVSNEVIM
*
Coding >Hirsu2|1729
ATGTCTCTCCAGCTTCCCCTCACCCATCGCCCTAAGGACCAGGGCGCGACCAAGGCCGTCATTCTGGTCGGCGGT
CCGTCGCGTGGCACCCGCTTCCGGCCCCTCTCGCTCGATGTGCCCAAGCCGCTGTTCGAGGTGGCCGGCCACCCG
ATCATCTGGCATTGCCTGTCGTCGATCGCGCGGGTGCCCAACAAGCAGATCCAGGAGGTGTACATCATCGGCTAC
TACGACGAGTCCGTCTTCCGCGACTTCATAAAGGACTCGGCCAAGGAGTTCCCGTCGGTGACGATCCGCTACCTG
CGCGAGTACCAGGCGCTGGGCACGGCCGGCGGCCTGTACCACTTCCGCGATGCCATCCTCAAGGGCCGGCCCGAG
CGGCTGTTCGTCCTCAACGCCGACGTCTGCTGCTCCTTCCCCCTGGCCGAGATGCTCAAGCTGTTCGTGGAGCGG
GACGCGGAGGCGGTGATACTGGGCACGCGCGTCGGCGACGACGCGGCGACCAACTTCGGCTGCATCGTGTCGGAC
GCGCACACGCGCCGCGTGCTGCACTACGTCGAGAAGCCCGAGTCGCGCATCAGCAACCTCATCAACTGCGGCGTC
TACCTCTTCTCGACCGAGGCCATCTTCCCCTCCATCAAGTCGGCCATGAAGCGCCGGCTCGACCGGCCGTCGCGC
CTCGTCTCGTACCCGTCGTCGGAGCACCTCGACTCGTACGCCGGCCAGGGCGGCGAGGGCGGCGGCGACGACGAC
GACGACGCCGGGCGCAAGAACGAGGTGATACGGCTGGAGCAGGACATACTCGGCGACATGGCCGACAGCAAGCAG
TTCTTCGTCTACGAGACCAAGGACTTCTGGCGCCAGATCAAGACGGCCGGCTCGGCCGTGCCGGCCAACGCGCTC
TACCTGCAGAAGGCGATGCAGGAGGCGAGCGCGGAGCTGGCGCCGCCCAGCGCCAGCATCGTCGCGCCCGTCTAC
ATCCACCCGAGCGCGCAGGTGCACCCGACGGCCAAGCTGGGCCCCAACGTCAGCATCGGCCCGCGCGTCGTGGTC
GGTGCGGGCGCGCGCGTGCGCGAGAGCATCGTGCTGGAGGACTGCGAGGTCAAGCACGACGCCTGCATCCTCTAC
GCCATCATCGGCTGGGGCAGCCGCGTCGGCGCCTGGGCCCGCGTCGAGGGCACCCCCACGCCCGCCGGCACCCAC
TCGACCAGCATCGTCAAGAACGGCGTCAAGGTGCAGAGCATCACCATCCTCGGCAAGGACTGCGCCGTCGGCGAC
GAGGTCCGCGTCTCGAACTGCATCTGCCTGCCCTTCAAGGAGCTGAAGCGCGACGTTTCCAACGAGGTCATCATG
TGA
Transcript >Hirsu2|1729
ATGTCTCTCCAGCTTCCCCTCACCCATCGCCCTAAGGACCAGGGCGCGACCAAGGCCGTCATTCTGGTCGGCGGT
CCGTCGCGTGGCACCCGCTTCCGGCCCCTCTCGCTCGATGTGCCCAAGCCGCTGTTCGAGGTGGCCGGCCACCCG
ATCATCTGGCATTGCCTGTCGTCGATCGCGCGGGTGCCCAACAAGCAGATCCAGGAGGTGTACATCATCGGCTAC
TACGACGAGTCCGTCTTCCGCGACTTCATAAAGGACTCGGCCAAGGAGTTCCCGTCGGTGACGATCCGCTACCTG
CGCGAGTACCAGGCGCTGGGCACGGCCGGCGGCCTGTACCACTTCCGCGATGCCATCCTCAAGGGCCGGCCCGAG
CGGCTGTTCGTCCTCAACGCCGACGTCTGCTGCTCCTTCCCCCTGGCCGAGATGCTCAAGCTGTTCGTGGAGCGG
GACGCGGAGGCGGTGATACTGGGCACGCGCGTCGGCGACGACGCGGCGACCAACTTCGGCTGCATCGTGTCGGAC
GCGCACACGCGCCGCGTGCTGCACTACGTCGAGAAGCCCGAGTCGCGCATCAGCAACCTCATCAACTGCGGCGTC
TACCTCTTCTCGACCGAGGCCATCTTCCCCTCCATCAAGTCGGCCATGAAGCGCCGGCTCGACCGGCCGTCGCGC
CTCGTCTCGTACCCGTCGTCGGAGCACCTCGACTCGTACGCCGGCCAGGGCGGCGAGGGCGGCGGCGACGACGAC
GACGACGCCGGGCGCAAGAACGAGGTGATACGGCTGGAGCAGGACATACTCGGCGACATGGCCGACAGCAAGCAG
TTCTTCGTCTACGAGACCAAGGACTTCTGGCGCCAGATCAAGACGGCCGGCTCGGCCGTGCCGGCCAACGCGCTC
TACCTGCAGAAGGCGATGCAGGAGGCGAGCGCGGAGCTGGCGCCGCCCAGCGCCAGCATCGTCGCGCCCGTCTAC
ATCCACCCGAGCGCGCAGGTGCACCCGACGGCCAAGCTGGGCCCCAACGTCAGCATCGGCCCGCGCGTCGTGGTC
GGTGCGGGCGCGCGCGTGCGCGAGAGCATCGTGCTGGAGGACTGCGAGGTCAAGCACGACGCCTGCATCCTCTAC
GCCATCATCGGCTGGGGCAGCCGCGTCGGCGCCTGGGCCCGCGTCGAGGGCACCCCCACGCCCGCCGGCACCCAC
TCGACCAGCATCGTCAAGAACGGCGTCAAGGTGCAGAGCATCACCATCCTCGGCAAGGACTGCGCCGTCGGCGAC
GAGGTCCGCGTCTCGAACTGCATCTGCCTGCCCTTCAAGGAGCTGAAGCGCGACGTTTCCAACGAGGTCATCATG
TGA
Gene >Hirsu2|1729
ATGTCTCTCCAGCTTCCCCTCACCCATCGCCCTAAGGACCAGGGCGCGACCAAGGCCGTCATTCTGGTGAGACTT
GTCCTATCCTTACTTTTTTTTTCTCTCTTGCTCTCGACCCGTTTCTTGCGCCTCTACTTTTCGACCCTTCAATCT
TCTACCTCGTGTCGGCGAAGAGCCGAGGAAAAAAAGGGGGGTGGGAGAGACCGGGGCAGAAGACGGCACATAAAA
CAAAAAGACAAAGCAGCTCTTGGCTAACCTCCACGATCCTTTCTCCCCACCTCCCAGGTCGGCGGTCCGTCGCGT
GGCACCCGCTTCCGGCCCCTCTCGCTCGATGTGCCCAAGCCGCTGTTCGAGGTGGCCGGCCACCCGATCATCTGG
CATTGCCTGTCGTCGATCGCGCGGGTGCCCAACAAGCAGATCCAGGAGGTGTACATCATCGGCTACTACGACGAG
TCCGTCTTCCGCGACTTCATAAAGGACTCGGCCAAGGAGTTCCCGTCGGTGACGATCCGCTACCTGCGCGAGTAC
CAGGCGCTGGGCACGGCCGGCGGCCTGTACCACTTCCGCGATGCCATCCTCAAGGGCCGGCCCGAGCGGCTGTTC
GTCCTCAACGCCGACGTCTGCTGCTCCTTCCCCCTGGCCGAGATGCTCAAGCTGTTCGTGGAGCGGGACGCGGAG
GCGGTGATACTGGGCACGCGCGTCGGCGACGACGCGGCGACCAACTTCGGCTGCATCGTGTCGGACGCGCACACG
CGCCGCGTGCTGCACTACGTCGAGAAGCCCGAGTCGCGCATCAGCAACCTCATCAACTGCGGCGTCTACCTCTTC
TCGACCGAGGCCATCTTCCCCTCCATCAAGTCGGCCATGAAGCGCCGGCTCGACCGGCCGTCGCGCCTCGTCTCG
TACCCGTCGTCGGAGCACCTCGACTCGTACGCCGGCCAGGGCGGCGAGGGCGGCGGCGACGACGACGACGACGCC
GGGCGCAAGAACGAGGTGATACGGCTGGAGCAGGACATACTCGGCGACATGGCCGACAGCAAGCAGTTCTTCGTC
TACGAGACCAAGGACTTCTGGCGCCAGATCAAGACGGCCGGCTCGGCCGTGCCGGCCAACGCGCTCTACCTGCAG
AAGGCGATGCAGGAGGCGAGCGCGGAGCTGGCGCCGCCCAGCGCCAGCATCGTCGCGCCCGTCTACATCCACCCG
AGCGCGCAGGTGCACCCGACGGCCAAGCTGGGCCCCAACGTCAGCATCGGCCCGCGCGTCGTGGTCGGTGCGGGC
GCGCGCGTGCGCGAGAGCATCGTGCTGGAGGACTGCGAGGTCAAGCACGACGCCTGCATCCTCTACGCCATCATC
GGCTGGGGCAGCCGCGTCGGCGCCTGGGCCCGCGTCGAGGGCACCCCCACGCCCGCCGGCACCCACTCGACCAGC
ATCGTCAAGAACGGCGTCAAGGTGCAGAGCATCACCATCCTCGGCAAGGACTGCGCCGTCGGCGACGAGGTCCGC
GTCTCGAACTGCATCTGCCTGCCCTTCAAGGAGCTGAAGCGCGTTCGTCATCCCTCTCTCCTCCCTCTCCCCCCA
CCACCGCTGACAGGTCGCCCGCAGGACGTTTCCAACGAGGTCATCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail