Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|172
Gene name
LocationContig_1029:5157..9748
Strand+
Gene length (bp)4591
Transcript length (bp)4359
Coding sequence length (bp)4359
Protein length (aa) 1453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04997 RNA_pol_Rpb1_1 RNA polymerase Rpb1, domain 1 5.5E-81 17 363
PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5 7.8E-77 850 1362
PF00623 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2 1.3E-71 365 534
PF04983 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3 7.8E-36 537 712
PF05000 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4 6.1E-30 739 843

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04051|RPC1_YEAST DNA-directed RNA polymerase III subunit RPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO31 PE=1 SV=1 7 1439 0.0E+00
sp|Q6BI69|RPC1_DEBHA DNA-directed RNA polymerase III subunit RPC1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPC1 PE=3 SV=2 7 1429 0.0E+00
sp|O94666|RPC1_SCHPO DNA-directed RNA polymerase III subunit rpc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc1 PE=2 SV=1 7 1438 0.0E+00
sp|A4IF62|RPC1_BOVIN DNA-directed RNA polymerase III subunit RPC1 OS=Bos taurus GN=POLR3A PE=2 SV=1 7 1429 0.0E+00
sp|O14802|RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens GN=POLR3A PE=1 SV=2 7 1429 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04051|RPC1_YEAST DNA-directed RNA polymerase III subunit RPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO31 PE=1 SV=1 7 1439 0.0E+00
sp|Q6BI69|RPC1_DEBHA DNA-directed RNA polymerase III subunit RPC1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPC1 PE=3 SV=2 7 1429 0.0E+00
sp|O94666|RPC1_SCHPO DNA-directed RNA polymerase III subunit rpc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc1 PE=2 SV=1 7 1438 0.0E+00
sp|A4IF62|RPC1_BOVIN DNA-directed RNA polymerase III subunit RPC1 OS=Bos taurus GN=POLR3A PE=2 SV=1 7 1429 0.0E+00
sp|O14802|RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens GN=POLR3A PE=1 SV=2 7 1429 0.0E+00
sp|Q5ZL98|RPC1_CHICK DNA-directed RNA polymerase III subunit RPC1 OS=Gallus gallus GN=POLR3A PE=2 SV=1 7 1413 0.0E+00
sp|F4JXF9|NRPC1_ARATH DNA-directed RNA polymerase III subunit 1 OS=Arabidopsis thaliana GN=NRPC1 PE=2 SV=1 8 1413 0.0E+00
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 13 962 0.0E+00
sp|P35084|RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum GN=polr2a PE=2 SV=2 17 1410 0.0E+00
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 2 962 0.0E+00
sp|P18616|NRPB1_ARATH DNA-directed RNA polymerase II subunit 1 OS=Arabidopsis thaliana GN=NRPB1 PE=1 SV=3 18 1410 0.0E+00
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 22 1411 0.0E+00
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 22 1411 0.0E+00
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 17 1411 0.0E+00
sp|Q75A34|RPB1_ASHGO DNA-directed RNA polymerase II subunit RPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB1 PE=3 SV=2 17 1411 0.0E+00
sp|P04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO21 PE=1 SV=2 7 1411 0.0E+00
sp|P11512|RPOA1_SULAC DNA-directed RNA polymerase subunit A' OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoA1 PE=3 SV=2 17 919 0.0E+00
sp|Q8SSC4|RPB1_ENCCU DNA-directed RNA polymerase II subunit RPB1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPB1 PE=3 SV=1 14 1414 0.0E+00
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 446 1412 0.0E+00
sp|Q980R2|RPOA1_SULSO DNA-directed RNA polymerase subunit A' OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoA1 PE=1 SV=1 17 919 0.0E+00
sp|P31813|RPOA1_THECE DNA-directed RNA polymerase subunit A' OS=Thermococcus celer GN=rpoA1 PE=3 SV=1 22 919 0.0E+00
sp|P41556|RPOA1_METVS DNA-directed RNA polymerase subunit A' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoA1 PE=3 SV=1 15 918 0.0E+00
sp|O27125|RPOA1_METTH DNA-directed RNA polymerase subunit A' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoA1 PE=3 SV=1 17 918 0.0E+00
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 17 935 0.0E+00
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 17 935 0.0E+00
sp|P36594|RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb1 PE=1 SV=1 17 922 0.0E+00
sp|P17545|RPB1B_TRYBB DNA-directed RNA polymerase II subunit RPB1-B OS=Trypanosoma brucei brucei GN=TRP5.9 PE=1 SV=1 73 1415 0.0E+00
sp|P17546|RPB1A_TRYBB DNA-directed RNA polymerase II subunit RPB1-A OS=Trypanosoma brucei brucei GN=TRP4.8 PE=1 SV=1 73 1415 6.0E-180
sp|P0CX02|RPOA1_HALSA DNA-directed RNA polymerase subunit A' OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoA1 PE=3 SV=1 14 926 5.0E-177
sp|B0R8D4|RPOA1_HALS3 DNA-directed RNA polymerase subunit A' OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoA1 PE=1 SV=1 14 926 5.0E-177
sp|Q03585|RPOA1_THEAC DNA-directed RNA polymerase subunit A' OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoA1 PE=3 SV=1 15 918 7.0E-172
sp|P09846|RPOA1_METTW DNA-directed RNA polymerase subunit A' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoA1 PE=3 SV=2 17 918 4.0E-164
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 430 936 5.0E-160
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 256 1151 2.0E-126
sp|Q7T6X5|RPO1_MIMIV DNA-directed RNA polymerase subunit 1 OS=Acanthamoeba polyphaga mimivirus GN=RPO1 PE=1 SV=2 22 917 8.0E-125
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 255 1151 1.0E-120
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 343 1155 2.0E-114
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 303 1155 2.0E-112
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 21 917 6.0E-111
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 160 1188 9.0E-109
sp|Q196X0|RPB1_IIV3 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 3 GN=IIV3-090L PE=3 SV=1 22 1410 9.0E-107
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 17 917 2.0E-104
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 17 917 3.0E-102
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 17 612 5.0E-95
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 1032 1430 1.0E-94
sp|Q58445|RPOA1_METJA DNA-directed RNA polymerase subunit A' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoA1 PE=3 SV=2 14 502 1.0E-93
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 17 569 7.0E-91
sp|P42486|RPB1_ASFB7 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-99 PE=3 SV=1 21 1405 1.0E-89
sp|O55766|RPB1_IIV6 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 6 GN=IIV6-176R PE=3 SV=1 17 932 1.0E-89
sp|P0C989|RPB1_ASFK5 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-111 PE=3 SV=1 21 1405 1.0E-89
sp|Q65215|RPB1_ASFM2 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-107 PE=3 SV=2 21 1405 2.0E-89
sp|P28364|RPB1_EUPOC DNA-directed RNA polymerase II subunit RPB1 (Fragment) OS=Euplotes octocarinatus GN=RPB1 PE=3 SV=1 17 511 7.0E-89
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 252 918 7.0E-84
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 789 1411 3.0E-83
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 6 431 9.0E-82
sp|Q58445|RPOA1_METJA DNA-directed RNA polymerase subunit A' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoA1 PE=3 SV=2 502 919 2.0E-78
sp|P0C987|RPB1_ASFP4 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-111 PE=3 SV=1 21 922 5.0E-72
sp|P0C988|RPB1_ASFWA Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-109 PE=3 SV=1 21 922 6.0E-72
sp|Q6GZW7|RPB1_FRG3G Putative DNA-directed RNA polymerase 008R OS=Frog virus 3 (isolate Goorha) GN=FV3-008R PE=3 SV=1 18 931 7.0E-71
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 1051 1411 4.0E-59
sp|P15349|RPOA1_HALMO DNA-directed RNA polymerase subunit A' (Fragment) OS=Halococcus morrhuae GN=rpoA1 PE=3 SV=1 647 924 6.0E-58
sp|O28390|RPOA2_ARCFU DNA-directed RNA polymerase subunit A'' OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpoA2 PE=3 SV=1 1046 1415 3.0E-54
sp|Q976A6|RPOA2_SULTO DNA-directed RNA polymerase subunit A'' OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpoA2 PE=3 SV=2 1043 1417 9.0E-53
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 14 429 2.0E-51
sp|C5A207|RPOA2_THEGJ DNA-directed RNA polymerase subunit A'' OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpoA2 PE=3 SV=1 1038 1419 2.0E-51
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 643 916 3.0E-51
sp|P11514|RPOA2_SULAC DNA-directed RNA polymerase subunit A'' OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoA2 PE=3 SV=2 1042 1417 3.0E-51
sp|A6UV49|RPOA2_META3 DNA-directed RNA polymerase subunit A'' OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpoA2 PE=3 SV=1 1048 1406 5.0E-51
sp|Q8U0M5|RPOA2_PYRFU DNA-directed RNA polymerase subunit A'' OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpoA2 PE=1 SV=1 1042 1419 5.0E-51
sp|B6YT17|RPOA2_THEON DNA-directed RNA polymerase subunit A'' OS=Thermococcus onnurineus (strain NA1) GN=rpoA2 PE=3 SV=1 1038 1418 6.0E-51
sp|P58192|RPOA2_SULSO DNA-directed RNA polymerase subunit A'' OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoA2 PE=1 SV=1 1043 1417 1.0E-50
sp|C3N7Q1|RPOA2_SULIY DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpoA2 PE=3 SV=1 1037 1417 1.0E-50
sp|C3NFS2|RPOA2_SULIN DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpoA2 PE=3 SV=1 1037 1417 1.0E-50
sp|C3MYA0|RPOA2_SULIM DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpoA2 PE=3 SV=1 1037 1417 1.0E-50
sp|C3MRK4|RPOA2_SULIL DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpoA2 PE=3 SV=1 1037 1417 1.0E-50
sp|C4KIV9|RPOA2_SULIK DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpoA2 PE=3 SV=1 1037 1417 1.0E-50
sp|C3MZM9|RPOA2_SULIA DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.16.27) GN=rpoA2 PE=3 SV=1 1037 1417 1.0E-50
sp|O93777|RPOA2_PYRHO DNA-directed RNA polymerase subunit A'' OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpoA2 PE=3 SV=1 1042 1419 3.0E-50
sp|P14247|RPOA2_METVS DNA-directed RNA polymerase subunit A'' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoA2 PE=3 SV=2 1052 1410 4.0E-50
sp|Q9V113|RPOA2_PYRAB DNA-directed RNA polymerase subunit A'' OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpoA2 PE=3 SV=1 1042 1419 5.0E-50
sp|P29158|RPOA2_THECE DNA-directed RNA polymerase subunit A'' OS=Thermococcus celer GN=rpoA2 PE=3 SV=2 1038 1418 8.0E-50
sp|Q5JE34|RPOA2_THEKO DNA-directed RNA polymerase subunit A'' OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpoA2 PE=1 SV=1 1042 1418 2.0E-49
sp|A9VP70|RPOC_BACWK DNA-directed RNA polymerase subunit beta' OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpoC PE=3 SV=1 257 897 4.0E-49
sp|A4YCR0|RPOA2_METS5 DNA-directed RNA polymerase subunit A'' OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpoA2 PE=3 SV=1 1042 1413 5.0E-49
sp|A7GK13|RPOC_BACCN DNA-directed RNA polymerase subunit beta' OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpoC PE=3 SV=1 256 897 7.0E-49
sp|B9KBJ4|RPOC_THENN DNA-directed RNA polymerase subunit beta' OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpoC PE=3 SV=1 256 1112 9.0E-49
sp|P77819|RPOC_BACAN DNA-directed RNA polymerase subunit beta' OS=Bacillus anthracis GN=rpoC PE=3 SV=3 257 897 1.0E-48
sp|B1YGU3|RPOC_EXIS2 DNA-directed RNA polymerase subunit beta' OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpoC PE=3 SV=1 216 917 1.0E-48
sp|A4FWF5|RPOA2_METM5 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpoA2 PE=3 SV=1 1059 1410 2.0E-48
sp|Q8PUR2|RPOA2_METMA DNA-directed RNA polymerase subunit A'' OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpoA2 PE=3 SV=1 1041 1413 3.0E-48
sp|A6VGV0|RPOA2_METM7 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpoA2 PE=3 SV=1 1051 1408 3.0E-48
sp|Q8E238|RPOC_STRA5 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoC PE=3 SV=1 256 897 3.0E-48
sp|Q8E7J7|RPOC_STRA3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoC PE=3 SV=1 256 897 3.0E-48
sp|Q3K3L1|RPOC_STRA1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoC PE=3 SV=1 256 897 3.0E-48
sp|Q82Z41|RPOC_ENTFA DNA-directed RNA polymerase subunit beta' OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoC PE=3 SV=1 256 920 4.0E-48
sp|A8AZI2|RPOC_STRGC DNA-directed RNA polymerase subunit beta' OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoC PE=3 SV=1 256 920 5.0E-48
sp|Q5WLR9|RPOC_BACSK DNA-directed RNA polymerase subunit beta' OS=Bacillus clausii (strain KSM-K16) GN=rpoC PE=3 SV=1 257 917 6.0E-48
sp|Q6HPR5|RPOC_BACHK DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpoC PE=3 SV=1 257 897 6.0E-48
sp|A0R8H3|RPOC_BACAH DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis (strain Al Hakam) GN=rpoC PE=3 SV=1 257 897 6.0E-48
sp|Q63H97|RPOC_BACCZ DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ZK / E33L) GN=rpoC PE=3 SV=1 257 897 7.0E-48
sp|Q73FA3|RPOC_BACC1 DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpoC PE=3 SV=1 257 897 9.0E-48
sp|Q81J47|RPOC_BACCR DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpoC PE=3 SV=1 257 897 9.0E-48
sp|P36252|RPOC_THEMA DNA-directed RNA polymerase subunit beta' OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpoC PE=3 SV=1 256 1112 9.0E-48
sp|B1L934|RPOC_THESQ DNA-directed RNA polymerase subunit beta' OS=Thermotoga sp. (strain RQ2) GN=rpoC PE=3 SV=1 256 1112 1.0E-47
sp|P77882|RPOC_LISGR DNA-directed RNA polymerase subunit beta' (Fragment) OS=Listeria grayi GN=rpoC PE=3 SV=2 257 939 1.0E-47
sp|Q6LXI7|RPOA2_METMP DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain S2 / LL) GN=rpoA2 PE=3 SV=1 1059 1410 1.0E-47
sp|A4IJI2|RPOC_GEOTN DNA-directed RNA polymerase subunit beta' OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoC PE=3 SV=2 87 897 2.0E-47
sp|A9A9U9|RPOA2_METM6 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpoA2 PE=3 SV=1 1051 1408 2.0E-47
sp|A3CKD4|RPOC_STRSV DNA-directed RNA polymerase subunit beta' OS=Streptococcus sanguinis (strain SK36) GN=rpoC PE=3 SV=1 256 920 2.0E-47
sp|Q9Z9M1|RPOC_BACHD DNA-directed RNA polymerase subunit beta' OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoC PE=3 SV=1 257 897 3.0E-47
sp|Q03586|RPOA2_THEAC DNA-directed RNA polymerase subunit A'' OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoA2 PE=1 SV=1 989 1413 3.0E-47
sp|A5IJW2|RPOC_THEP1 DNA-directed RNA polymerase subunit beta' OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpoC PE=3 SV=1 256 1112 4.0E-47
sp|Q65PB4|RPOC_BACLD DNA-directed RNA polymerase subunit beta' OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoC PE=3 SV=1 256 897 5.0E-47
sp|Q5L404|RPOC_GEOKA DNA-directed RNA polymerase subunit beta' OS=Geobacillus kaustophilus (strain HTA426) GN=rpoC PE=3 SV=1 87 897 6.0E-47
sp|Q5UZR5|RPOA2_HALMA DNA-directed RNA polymerase subunit A'' OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpoA2 PE=3 SV=1 1037 1415 7.0E-47
sp|P77879|RPOC_LISIN DNA-directed RNA polymerase subunit beta' OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoC PE=3 SV=3 257 939 9.0E-47
sp|Q724E9|RPOC_LISMF DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoC PE=3 SV=1 257 939 9.0E-47
sp|O27126|RPOA2_METTH DNA-directed RNA polymerase subunit A'' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoA2 PE=3 SV=1 1051 1411 1.0E-46
sp|Q8YA96|RPOC_LISMO DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoC PE=3 SV=1 257 939 1.0E-46
sp|Q8ETY7|RPOC_OCEIH DNA-directed RNA polymerase subunit beta' OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoC PE=3 SV=1 260 919 1.0E-46
sp|A7Z0N0|RPOC_BACMF DNA-directed RNA polymerase subunit beta' OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoC PE=3 SV=1 256 897 1.0E-46
sp|Q979F5|RPOA2_THEVO DNA-directed RNA polymerase subunit A'' OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpoA2 PE=3 SV=1 983 1413 2.0E-46
sp|Q8DS47|RPOC_STRMU DNA-directed RNA polymerase subunit beta' OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoC PE=3 SV=2 256 897 2.0E-46
sp|A4XI31|RPOC_CALS8 DNA-directed RNA polymerase subunit beta' OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoC PE=3 SV=2 216 920 3.0E-46
sp|Q9CEN7|RPOC_LACLA DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoC PE=3 SV=2 260 919 3.0E-46
sp|A8F4G1|RPOC_PSELT DNA-directed RNA polymerase subunit beta' OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpoC PE=3 SV=1 256 1182 3.0E-46
sp|A8F977|RPOC_BACP2 DNA-directed RNA polymerase subunit beta' OS=Bacillus pumilus (strain SAFR-032) GN=rpoC PE=3 SV=1 256 897 3.0E-46
sp|Q8TRB8|RPOA2_METAC DNA-directed RNA polymerase subunit A'' OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpoA2 PE=3 SV=1 1059 1413 4.0E-46
sp|Q1WVA4|RPOC_LACS1 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus salivarius (strain UCC118) GN=rpoC PE=3 SV=1 256 919 4.0E-46
sp|A2RML8|RPOC_LACLM DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoC PE=3 SV=1 260 919 5.0E-46
sp|Q8R7U7|RPOC_CALS4 DNA-directed RNA polymerase subunit beta' OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoC PE=3 SV=1 256 897 6.0E-46
sp|P96177|RPOC_WEIHE DNA-directed RNA polymerase subunit beta' (Fragment) OS=Weissella hellenica GN=rpoC PE=3 SV=1 256 897 6.0E-46
sp|Q02X60|RPOC_LACLS DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoC PE=3 SV=1 260 919 7.0E-46
sp|C0M7R5|RPOC_STRE4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoC PE=3 SV=1 256 897 7.0E-46
sp|B2A4D2|RPOC_NATTJ DNA-directed RNA polymerase subunit beta' OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpoC PE=3 SV=1 256 903 8.0E-46
sp|Q3A9Q8|RPOC_CARHZ DNA-directed RNA polymerase subunit beta' OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoC PE=3 SV=1 256 920 9.0E-46
sp|A0AF64|RPOC_LISW6 DNA-directed RNA polymerase subunit beta' OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoC PE=3 SV=1 257 939 1.0E-45
sp|Q9YAU2|RPOA2_AERPE DNA-directed RNA polymerase subunit A'' OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpoA2 PE=3 SV=2 1052 1415 1.0E-45
sp|B9DSZ6|RPOC_STRU0 DNA-directed RNA polymerase subunit beta' OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoC PE=3 SV=1 256 897 1.0E-45
sp|B5E2F2|RPOC_STRP4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoC PE=3 SV=1 216 897 1.0E-45
sp|C1CTL3|RPOC_STRZT DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoC PE=3 SV=1 216 897 1.0E-45
sp|C1CGP3|RPOC_STRZJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain JJA) GN=rpoC PE=3 SV=1 216 897 1.0E-45
sp|B2IM39|RPOC_STRPS DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain CGSP14) GN=rpoC PE=3 SV=1 216 897 1.0E-45
sp|Q97NQ8|RPOC_STRPN DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoC PE=3 SV=1 216 897 1.0E-45
sp|B1I8R3|RPOC_STRPI DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoC PE=3 SV=1 216 897 1.0E-45
sp|C1CA05|RPOC_STRP7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain 70585) GN=rpoC PE=3 SV=1 216 897 1.0E-45
sp|C1CMQ7|RPOC_STRZP DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain P1031) GN=rpoC PE=3 SV=1 216 897 2.0E-45
sp|P37871|RPOC_BACSU DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) GN=rpoC PE=1 SV=4 256 897 2.0E-45
sp|Q8DNF1|RPOC_STRR6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoC PE=3 SV=1 216 897 2.0E-45
sp|B8ZNW6|RPOC_STRPJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoC PE=3 SV=1 216 897 2.0E-45
sp|Q04IK7|RPOC_STRP2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoC PE=3 SV=1 216 897 2.0E-45
sp|A4VSK3|RPOC_STRSY DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 05ZYH33) GN=rpoC PE=3 SV=2 256 939 2.0E-45
sp|A4VYU4|RPOC_STRS2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 98HAH33) GN=rpoC PE=3 SV=2 256 939 2.0E-45
sp|P09847|RPOA2_METTW DNA-directed RNA polymerase subunit A'' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoA2 PE=1 SV=2 1059 1411 2.0E-45
sp|B9LL90|RPOC_CHLSY DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpoC PE=3 SV=1 256 897 2.0E-45
sp|Q5XE96|RPOC_STRP6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoC PE=3 SV=1 256 897 2.0E-45
sp|A2RC52|RPOC_STRPG DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoC PE=3 SV=1 256 897 2.0E-45
sp|Q03PV0|RPOC_LACBA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpoC PE=3 SV=1 256 919 2.0E-45
sp|B0K5G9|RPOC_THEPX DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter sp. (strain X514) GN=rpoC PE=3 SV=2 256 897 3.0E-45
sp|Q8P2Y2|RPOC_STRP8 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoC PE=3 SV=1 256 897 3.0E-45
sp|B0KCJ3|RPOC_THEP3 DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoC PE=3 SV=1 256 897 3.0E-45
sp|Q2FJ97|RPOC_STAA3 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain USA300) GN=rpoC PE=3 SV=2 256 933 4.0E-45
sp|P0C0E0|RPOC_STRP1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M1 GN=rpoC PE=3 SV=1 256 897 4.0E-45
sp|Q48VR0|RPOC_STRPM DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoC PE=3 SV=1 256 897 4.0E-45
sp|Q1J8X0|RPOC_STRPF DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoC PE=3 SV=1 256 897 4.0E-45
sp|B8G4U8|RPOC_CHLAD DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpoC PE=3 SV=1 256 897 5.0E-45
sp|P36594|RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb1 PE=1 SV=1 1058 1410 6.0E-45
sp|P0DF32|RPOC_STRP3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoC PE=3 SV=1 256 897 6.0E-45
sp|Q1JNX6|RPOC_STRPC DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoC PE=3 SV=1 256 897 6.0E-45
sp|Q1JE19|RPOC_STRPB DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoC PE=3 SV=1 256 897 6.0E-45
sp|P0DF33|RPOC_STRPQ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoC PE=3 SV=1 256 897 7.0E-45
sp|Q1JJ22|RPOC_STRPD DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoC PE=3 SV=1 256 897 8.0E-45
sp|Q49V53|RPOC_STAS1 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoC PE=3 SV=1 219 918 9.0E-45
sp|Q6GJC5|RPOC_STAAR DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MRSA252) GN=rpoC PE=3 SV=1 256 918 1.0E-44
sp|P60286|RPOC_STAAW DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MW2) GN=rpoC PE=3 SV=1 256 918 1.0E-44
sp|Q6GBU4|RPOC_STAAS DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MSSA476) GN=rpoC PE=3 SV=1 256 918 1.0E-44
sp|P60285|RPOC_STAAN DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain N315) GN=rpoC PE=1 SV=1 256 918 1.0E-44
sp|P60284|RPOC_STAAM DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoC PE=3 SV=1 256 918 1.0E-44
sp|Q5HID2|RPOC_STAAC DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain COL) GN=rpoC PE=3 SV=1 256 918 1.0E-44
sp|Q2G0N5|RPOC_STAA8 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoC PE=3 SV=2 256 918 1.0E-44
sp|Q2YSB8|RPOC_STAAB DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoC PE=3 SV=1 256 918 1.0E-44
sp|P96178|RPOC_WEIPA DNA-directed RNA polymerase subunit beta' (Fragment) OS=Weissella paramesenteroides GN=rpoC PE=3 SV=1 256 919 1.0E-44
sp|C0MEE4|RPOC_STRS7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoC PE=3 SV=1 256 897 1.0E-44
sp|B0TC49|RPOC_HELMI DNA-directed RNA polymerase subunit beta' OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoC PE=3 SV=1 256 891 2.0E-44
sp|A9WH11|RPOC_CHLAA DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpoC PE=3 SV=1 256 897 2.0E-44
sp|P0C1T4|RPOC_STAAU DNA-directed RNA polymerase subunit beta' (Fragment) OS=Staphylococcus aureus GN=rpoC PE=3 SV=1 256 918 3.0E-44
sp|Q03IK3|RPOC_STRTD DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoC PE=3 SV=1 216 897 3.0E-44
sp|B2GDX6|RPOC_LACF3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpoC PE=3 SV=1 256 919 4.0E-44
sp|Q5M2F6|RPOC_STRT2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoC PE=3 SV=1 216 897 4.0E-44
sp|Q5LXV4|RPOC_STRT1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoC PE=3 SV=1 216 897 4.0E-44
sp|Q67JT4|RPOC_SYMTH DNA-directed RNA polymerase subunit beta' OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoC PE=3 SV=1 256 903 6.0E-44
sp|Q5FM96|RPOC_LACAC DNA-directed RNA polymerase subunit beta' OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoC PE=3 SV=1 256 919 9.0E-44
sp|B0SSI3|RPOC_LEPBP DNA-directed RNA polymerase subunit beta' OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rpoC PE=3 SV=1 221 897 1.0E-43
sp|B0SAG0|RPOC_LEPBA DNA-directed RNA polymerase subunit beta' OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rpoC PE=3 SV=1 221 897 1.0E-43
sp|P77839|RPOC_BROTH DNA-directed RNA polymerase subunit beta' (Fragment) OS=Brochothrix thermosphacta GN=rpoC PE=3 SV=2 256 891 1.0E-43
sp|Q4L3K4|RPOC_STAHJ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoC PE=3 SV=1 257 918 1.0E-43
sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta' OS=Nitratiruptor sp. (strain SB155-2) GN=rpoC PE=3 SV=1 256 920 2.0E-43
sp|Q046D1|RPOC_LACGA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpoC PE=3 SV=1 256 919 2.0E-43
sp|A8YXJ9|RPOC_LACH4 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoC PE=3 SV=1 256 919 2.0E-43
sp|Q250N9|RPOC_DESHY DNA-directed RNA polymerase subunit beta' OS=Desulfitobacterium hafniense (strain Y51) GN=rpoC PE=3 SV=1 256 903 3.0E-43
sp|Q8CQ83|RPOC_STAES DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoC PE=3 SV=1 257 918 3.0E-43
sp|Q5HRK9|RPOC_STAEQ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoC PE=3 SV=1 257 918 3.0E-43
sp|P15353|RPOA2_HALMO DNA-directed RNA polymerase subunit A'' OS=Halococcus morrhuae GN=rpoA2 PE=1 SV=1 1058 1415 4.0E-43
sp|Q88XZ2|RPOC_LACPL DNA-directed RNA polymerase subunit beta' OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoC PE=3 SV=1 198 919 5.0E-43
sp|P94892|RPOC_LEUMM DNA-directed RNA polymerase subunit beta' OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoC PE=3 SV=2 212 919 5.0E-43
sp|B5YFV7|RPOC_THEYD DNA-directed RNA polymerase subunit beta' OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpoC PE=3 SV=1 256 920 5.0E-43
sp|Q74L94|RPOC_LACJO DNA-directed RNA polymerase subunit beta' OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpoC PE=3 SV=1 256 919 5.0E-43
sp|Q9LQ02|NRPD1_ARATH DNA-directed RNA polymerase IV subunit 1 OS=Arabidopsis thaliana GN=NRPD1 PE=1 SV=1 363 925 5.0E-43
sp|P0CX07|RPOA2_HALSA DNA-directed RNA polymerase subunit A'' OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoA2 PE=3 SV=1 1058 1415 1.0E-42
sp|B0R8D3|RPOA2_HALS3 DNA-directed RNA polymerase subunit A'' OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoA2 PE=1 SV=1 1058 1415 1.0E-42
sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoC PE=3 SV=1 256 919 1.0E-42
sp|Q6FF89|RPOC_ACIAD DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpoC PE=3 SV=2 253 919 1.0E-42
sp|Q034X1|RPOC_LACC3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain ATCC 334) GN=rpoC PE=3 SV=1 213 919 2.0E-42
sp|B2UQY1|RPOC_AKKM8 DNA-directed RNA polymerase subunit beta' OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rpoC PE=3 SV=1 249 915 2.0E-42
sp|A7GJ81|RPOC_CLOBL DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoC PE=3 SV=1 256 919 2.0E-42
sp|P94899|RPOC_LEUPS DNA-directed RNA polymerase subunit beta' (Fragment) OS=Leuconostoc pseudomesenteroides GN=rpoC PE=3 SV=1 213 919 2.0E-42
sp|Q03EB0|RPOC_PEDPA DNA-directed RNA polymerase subunit beta' OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoC PE=3 SV=1 257 919 3.0E-42
sp|B3WAM7|RPOC_LACCB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain BL23) GN=rpoC PE=3 SV=1 213 919 3.0E-42
sp|Q5X865|RPOC_LEGPA DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila (strain Paris) GN=rpoC PE=3 SV=1 216 919 3.0E-42
sp|Q5ZYP9|RPOC_LEGPH DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpoC PE=3 SV=2 216 919 4.0E-42
sp|A5IHS0|RPOC_LEGPC DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila (strain Corby) GN=rpoC PE=3 SV=2 216 919 4.0E-42
sp|Q8ZYQ7|RPOA2_PYRAE DNA-directed RNA polymerase subunit A'' OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpoA2 PE=3 SV=1 1048 1411 5.0E-42
sp|Q64NJ8|RPOC_BACFR DNA-directed RNA polymerase subunit beta' OS=Bacteroides fragilis (strain YCH46) GN=rpoC PE=3 SV=1 256 897 5.0E-42
sp|Q5L898|RPOC_BACFN DNA-directed RNA polymerase subunit beta' OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpoC PE=3 SV=1 256 897 5.0E-42
sp|B1IGG1|RPOC_CLOBK DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoC PE=3 SV=1 256 919 6.0E-42
sp|A5USR6|RPOC_ROSS1 DNA-directed RNA polymerase subunit beta' OS=Roseiflexus sp. (strain RS-1) GN=rpoC PE=3 SV=1 256 897 6.0E-42
sp|Q890N5|RPOC_CLOTE DNA-directed RNA polymerase subunit beta' OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoC PE=3 SV=2 216 919 6.0E-42
sp|P0C0D9|RPOC_STRPY DNA-directed RNA polymerase subunit beta' (Fragment) OS=Streptococcus pyogenes GN=rpoC PE=3 SV=1 256 897 7.0E-42
sp|B1MVW7|RPOC_LEUCK DNA-directed RNA polymerase subunit beta' OS=Leuconostoc citreum (strain KM20) GN=rpoC PE=3 SV=1 253 891 1.0E-41
sp|A5I7L3|RPOC_CLOBH DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoC PE=3 SV=1 256 919 1.0E-41
sp|A7FZ76|RPOC_CLOB1 DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoC PE=3 SV=1 256 919 1.0E-41
sp|Q5WZL8|RPOC_LEGPL DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila (strain Lens) GN=rpoC PE=3 SV=1 216 919 1.0E-41
sp|O57204|RP147_VACCA DNA-directed RNA polymerase 147 kDa polypeptide OS=Vaccinia virus (strain Ankara) GN=RPO147 PE=3 SV=1 61 1416 1.0E-41
sp|Q0AUH3|RPOC_SYNWW DNA-directed RNA polymerase subunit beta' OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoC PE=3 SV=1 257 919 2.0E-41
sp|B1KSN2|RPOC_CLOBM DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoC PE=3 SV=1 256 919 3.0E-41
sp|B4U738|RPOC_HYDS0 DNA-directed RNA polymerase subunit beta' OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpoC PE=3 SV=1 201 896 3.0E-41
sp|P20504|RP147_VACCC DNA-directed RNA polymerase 147 kDa polypeptide OS=Vaccinia virus (strain Copenhagen) GN=RPO147 PE=3 SV=1 61 1416 3.0E-41
sp|P07392|RP147_VACCW DNA-directed RNA polymerase 147 kDa polypeptide OS=Vaccinia virus (strain Western Reserve) GN=RPO147 PE=3 SV=1 61 1416 3.0E-41
sp|A7NJM0|RPOC_ROSCS DNA-directed RNA polymerase subunit beta' OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpoC PE=3 SV=1 256 897 4.0E-41
sp|B0VDH9|RPOC_ACIBY DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain AYE) GN=rpoC PE=3 SV=1 253 919 4.0E-41
sp|A3M1G4|RPOC_ACIBT DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpoC PE=3 SV=2 253 919 4.0E-41
sp|B2I1Z2|RPOC_ACIBC DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain ACICU) GN=rpoC PE=3 SV=1 253 919 4.0E-41
sp|B0S2E5|RPOC_FINM2 DNA-directed RNA polymerase subunit beta' OS=Finegoldia magna (strain ATCC 29328) GN=rpoC PE=3 SV=2 257 897 4.0E-41
sp|P33053|RP147_VAR67 DNA-directed RNA polymerase 147 kDa polypeptide OS=Variola virus (isolate Human/India/Ind3/1967) GN=RPO147 PE=3 SV=1 61 1416 5.0E-41
sp|Q1MPW9|RPOC_LAWIP DNA-directed RNA polymerase subunit beta' OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpoC PE=3 SV=1 256 914 7.0E-41
sp|Q8A470|RPOC_BACTN DNA-directed RNA polymerase subunit beta' OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpoC PE=3 SV=1 256 897 8.0E-41
sp|B5RLU8|RPOC_BORDL DNA-directed RNA polymerase subunit beta' OS=Borrelia duttonii (strain Ly) GN=rpoC PE=3 SV=1 256 919 9.0E-41
sp|B0VLZ5|RPOC_ACIBS DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain SDF) GN=rpoC PE=3 SV=1 253 919 9.0E-41
sp|Q1Q8Q0|RPOC_PSYCK DNA-directed RNA polymerase subunit beta' OS=Psychrobacter cryohalolentis (strain K5) GN=rpoC PE=3 SV=1 253 897 1.0E-40
sp|Q4FQH4|RPOC_PSYA2 DNA-directed RNA polymerase subunit beta' OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpoC PE=3 SV=1 253 897 1.0E-40
sp|B5RRJ6|RPOC_BORRA DNA-directed RNA polymerase subunit beta' OS=Borrelia recurrentis (strain A1) GN=rpoC PE=3 SV=1 256 919 1.0E-40
sp|P77917|RPOC_PEDAC DNA-directed RNA polymerase subunit beta' (Fragment) OS=Pediococcus acidilactici GN=rpoC PE=3 SV=2 257 919 2.0E-40
sp|B3E164|RPOC_METI4 DNA-directed RNA polymerase subunit beta' OS=Methylacidiphilum infernorum (isolate V4) GN=rpoC PE=3 SV=1 249 915 2.0E-40
sp|A8MLD3|RPOC_ALKOO DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoC PE=3 SV=1 216 917 2.0E-40
sp|Q38UQ3|RPOC_LACSS DNA-directed RNA polymerase subunit beta' OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoC PE=3 SV=1 256 919 3.0E-40
sp|Q8F0S3|RPOC_LEPIN DNA-directed RNA polymerase subunit beta' OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpoC PE=3 SV=1 256 897 3.0E-40
sp|Q72UA7|RPOC_LEPIC DNA-directed RNA polymerase subunit beta' OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpoC PE=3 SV=1 256 897 3.0E-40
sp|A6TWI9|RPOC_ALKMQ DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoC PE=3 SV=1 253 891 3.0E-40
sp|A1QZH6|RPOC_BORT9 DNA-directed RNA polymerase subunit beta' OS=Borrelia turicatae (strain 91E135) GN=rpoC PE=3 SV=1 256 919 5.0E-40
sp|Q0ABI1|RPOC_ALKEH DNA-directed RNA polymerase subunit beta' OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpoC PE=3 SV=1 256 903 6.0E-40
sp|A0PXT9|RPOC_CLONN DNA-directed RNA polymerase subunit beta' OS=Clostridium novyi (strain NT) GN=rpoC PE=3 SV=1 256 917 6.0E-40
sp|B2S091|RPOC_BORHD DNA-directed RNA polymerase subunit beta' OS=Borrelia hermsii (strain HS1 / DAH) GN=rpoC PE=3 SV=1 256 919 9.0E-40
sp|A4SUV5|RPOC_POLSQ DNA-directed RNA polymerase subunit beta' OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpoC PE=3 SV=1 256 903 1.0E-39
sp|Q12SW5|RPOC_SHEDO DNA-directed RNA polymerase subunit beta' OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpoC PE=3 SV=1 256 919 2.0E-39
sp|Q04QJ0|RPOC_LEPBJ DNA-directed RNA polymerase subunit beta' OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpoC PE=3 SV=1 256 897 2.0E-39
sp|B2UUV9|RPOBC_HELPS Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain Shi470) GN=rpoBC PE=3 SV=1 256 920 2.0E-39
sp|A5WH34|RPOC_PSYWF DNA-directed RNA polymerase subunit beta' OS=Psychrobacter sp. (strain PRwf-1) GN=rpoC PE=3 SV=1 253 897 2.0E-39
sp|A1S212|RPOC_SHEAM DNA-directed RNA polymerase subunit beta' OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpoC PE=3 SV=1 216 961 2.0E-39
sp|B2KEN0|RPOC_ELUMP DNA-directed RNA polymerase subunit beta' OS=Elusimicrobium minutum (strain Pei191) GN=rpoC PE=3 SV=1 256 920 3.0E-39
sp|Q054E1|RPOC_LEPBL DNA-directed RNA polymerase subunit beta' OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpoC PE=3 SV=1 256 897 3.0E-39
sp|Q058E6|RPOC_BUCCC DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpoC PE=3 SV=1 250 891 4.0E-39
sp|Q18CF3|RPOC_PEPD6 DNA-directed RNA polymerase subunit beta' OS=Peptoclostridium difficile (strain 630) GN=rpoC PE=3 SV=1 256 891 4.0E-39
sp|B9KFG8|RPOC_CAMLR DNA-directed RNA polymerase subunit beta' OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpoC PE=3 SV=1 256 897 4.0E-39
sp|Q73JJ8|RPOC_TREDE DNA-directed RNA polymerase subunit beta' OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpoC PE=3 SV=1 256 903 5.0E-39
sp|Q0SQD7|RPOC_CLOPS DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoC PE=3 SV=1 256 917 5.0E-39
sp|P0C2E8|RPOC_CLOPE DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain 13 / Type A) GN=rpoC PE=3 SV=1 256 917 5.0E-39
sp|Q0TMN9|RPOC_CLOP1 DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoC PE=3 SV=1 256 917 5.0E-39
sp|Q3SLQ5|RPOC_THIDA DNA-directed RNA polymerase subunit beta' OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpoC PE=3 SV=1 256 897 6.0E-39
sp|A9H3S0|RPOC_GLUDA DNA-directed RNA polymerase subunit beta' OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpoC PE=3 SV=1 253 981 8.0E-39
sp|Q04E86|RPOC_OENOB DNA-directed RNA polymerase subunit beta' OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoC PE=3 SV=1 256 919 9.0E-39
sp|B1XSP4|RPOC_POLNS DNA-directed RNA polymerase subunit beta' OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rpoC PE=3 SV=1 256 903 1.0E-38
sp|Q2N5Q5|RPOC_ERYLH DNA-directed RNA polymerase subunit beta' OS=Erythrobacter litoralis (strain HTCC2594) GN=rpoC PE=3 SV=1 211 890 1.0E-38
sp|Q28UX6|RPOC_JANSC DNA-directed RNA polymerase subunit beta' OS=Jannaschia sp. (strain CCS1) GN=rpoC PE=3 SV=1 211 897 1.0E-38
sp|Q5FTX8|RPOC_GLUOX DNA-directed RNA polymerase subunit beta' OS=Gluconobacter oxydans (strain 621H) GN=rpoC PE=3 SV=1 203 890 1.0E-38
sp|A5N4P0|RPOC_CLOK5 DNA-directed RNA polymerase subunit beta' OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoC PE=3 SV=1 256 919 1.0E-38
sp|B1W441|RPOC_STRGG DNA-directed RNA polymerase subunit beta' OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpoC PE=3 SV=1 256 897 1.0E-38
sp|A6LPQ5|RPOC_CLOB8 DNA-directed RNA polymerase subunit beta' OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoC PE=3 SV=1 257 897 2.0E-38
sp|Q9J593|RP147_FOWPN DNA-directed RNA polymerase 147 kDa polypeptide OS=Fowlpox virus (strain NVSL) GN=RPO147 PE=3 SV=1 250 1408 2.0E-38
sp|Q9ZK23|RPOBC_HELPJ Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpoBC PE=3 SV=1 256 920 2.0E-38
sp|Q9KWU6|RPOC_THEAQ DNA-directed RNA polymerase subunit beta' OS=Thermus aquaticus GN=rpoC PE=1 SV=2 256 911 2.0E-38
sp|Q5LMQ6|RPOC_RUEPO DNA-directed RNA polymerase subunit beta' OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpoC PE=3 SV=1 211 890 2.0E-38
sp|P95405|RPOC_OENOE DNA-directed RNA polymerase subunit beta' (Fragment) OS=Oenococcus oeni GN=rpoC PE=3 SV=1 256 919 3.0E-38
sp|Q01VB2|RPOC_SOLUE DNA-directed RNA polymerase subunit beta' OS=Solibacter usitatus (strain Ellin6076) GN=rpoC PE=3 SV=1 182 903 3.0E-38
sp|B6IRP7|RPOC_RHOCS DNA-directed RNA polymerase subunit beta' OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpoC PE=3 SV=1 242 903 3.0E-38
sp|O25806|RPOBC_HELPY Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpoBC PE=1 SV=1 256 920 3.0E-38
sp|Q1CS68|RPOBC_HELPH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain HPAG1) GN=rpoBC PE=3 SV=1 256 920 4.0E-38
sp|Q1IHH5|RPOC_KORVE DNA-directed RNA polymerase subunit beta' OS=Koribacter versatilis (strain Ellin345) GN=rpoC PE=3 SV=2 256 896 4.0E-38
sp|A6LE80|RPOC_PARD8 DNA-directed RNA polymerase subunit beta' OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpoC PE=3 SV=1 256 897 4.0E-38
sp|P28363|RPA1_EUPOC DNA-directed RNA polymerase I subunit RPA1 (Fragment) OS=Euplotes octocarinatus GN=RPA1 PE=3 SV=1 312 514 4.0E-38
sp|Q17VN6|RPOBC_HELAH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter acinonychis (strain Sheeba) GN=rpoBC PE=3 SV=1 256 920 4.0E-38
sp|Q1J0P7|RPOC_DEIGD DNA-directed RNA polymerase subunit beta' OS=Deinococcus geothermalis (strain DSM 11300) GN=rpoC PE=3 SV=1 257 885 5.0E-38
sp|A8G1F4|RPOC_SHESH DNA-directed RNA polymerase subunit beta' OS=Shewanella sediminis (strain HAW-EB3) GN=rpoC PE=3 SV=1 216 919 5.0E-38
sp|A8LM41|RPOC_DINSH DNA-directed RNA polymerase subunit beta' OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpoC PE=3 SV=1 211 897 6.0E-38
sp|A8GYX0|RPOC_SHEPA DNA-directed RNA polymerase subunit beta' OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpoC PE=3 SV=1 216 919 6.0E-38
sp|Q58446|RPOA2_METJA DNA-directed RNA polymerase subunit A'' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoA2 PE=3 SV=1 1083 1410 7.0E-38
sp|Q92QH6|RPOC_RHIME DNA-directed RNA polymerase subunit beta' OS=Rhizobium meliloti (strain 1021) GN=rpoC PE=3 SV=1 87 897 7.0E-38
sp|A0L5W7|RPOC_MAGMM DNA-directed RNA polymerase subunit beta' OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpoC PE=3 SV=1 253 917 7.0E-38
sp|O33431|RPOC_PORCN DNA-directed RNA polymerase subunit beta' (Fragment) OS=Porphyromonas cangingivalis GN=rpoC PE=3 SV=1 256 897 8.0E-38
sp|A1VYJ5|RPOC_CAMJJ DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpoC PE=3 SV=1 87 897 9.0E-38
sp|A8FKR4|RPOC_CAMJ8 DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpoC PE=3 SV=1 87 897 1.0E-37
sp|A6U852|RPOC_SINMW DNA-directed RNA polymerase subunit beta' OS=Sinorhizobium medicae (strain WSM419) GN=rpoC PE=3 SV=1 87 897 1.0E-37
sp|P47716|RPOC_MYCGA DNA-directed RNA polymerase subunit beta' OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpoC PE=3 SV=2 260 907 1.0E-37
sp|Q8RHI7|RPOC_FUSNN DNA-directed RNA polymerase subunit beta' OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpoC PE=3 SV=1 256 885 1.0E-37
sp|Q9PI30|RPOC_CAMJE DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpoC PE=3 SV=1 87 897 1.0E-37
sp|A4T1P3|RPOC_MYCGI DNA-directed RNA polymerase subunit beta' OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpoC PE=3 SV=1 257 916 1.0E-37
sp|Q1GK48|RPOC_RUEST DNA-directed RNA polymerase subunit beta' OS=Ruegeria sp. (strain TM1040) GN=rpoC PE=3 SV=1 211 890 1.0E-37
sp|Q5HVY8|RPOC_CAMJR DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni (strain RM1221) GN=rpoC PE=3 SV=1 87 897 1.0E-37
sp|B0TM18|RPOC_SHEHH DNA-directed RNA polymerase subunit beta' OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpoC PE=3 SV=1 256 919 1.0E-37
sp|Q8RQE8|RPOC_THET8 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpoC PE=1 SV=1 256 910 2.0E-37
sp|A1B017|RPOC_PARDP DNA-directed RNA polymerase subunit beta' OS=Paracoccus denitrificans (strain Pd 1222) GN=rpoC PE=3 SV=1 216 890 2.0E-37
sp|A5FZX0|RPOC_ACICJ DNA-directed RNA polymerase subunit beta' OS=Acidiphilium cryptum (strain JF-5) GN=rpoC PE=3 SV=1 256 890 2.0E-37
sp|Q72HM6|RPOC_THET2 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpoC PE=3 SV=2 256 910 2.0E-37
sp|Q30X04|RPOC_DESAG DNA-directed RNA polymerase subunit beta' OS=Desulfovibrio alaskensis (strain G20) GN=rpoC PE=3 SV=1 253 956 2.0E-37
sp|A1SEK2|RPOC_NOCSJ DNA-directed RNA polymerase subunit beta' OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpoC PE=3 SV=1 256 897 2.0E-37
sp|A9IJ22|RPOC_BORPD DNA-directed RNA polymerase subunit beta' OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpoC PE=3 SV=1 237 919 2.0E-37
sp|Q7VKL8|RPOC_HAEDU DNA-directed RNA polymerase subunit beta' OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpoC PE=3 SV=1 256 897 2.0E-37
sp|Q2NJ16|RPOC_AYWBP DNA-directed RNA polymerase subunit beta' OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpoC PE=3 SV=1 83 897 2.0E-37
sp|A4W5A8|RPOC_ENT38 DNA-directed RNA polymerase subunit beta' OS=Enterobacter sp. (strain 638) GN=rpoC PE=3 SV=1 213 897 3.0E-37
sp|B3PW60|RPOC_RHIE6 DNA-directed RNA polymerase subunit beta' OS=Rhizobium etli (strain CIAT 652) GN=rpoC PE=3 SV=1 87 903 3.0E-37
sp|B3QYL5|RPOC_CHLT3 DNA-directed RNA polymerase subunit beta' OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rpoC PE=3 SV=1 87 903 3.0E-37
sp|B1MH61|RPOC_MYCA9 DNA-directed RNA polymerase subunit beta' OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=rpoC PE=3 SV=1 231 933 3.0E-37
sp|Q0I5B8|RPOC_HAES1 DNA-directed RNA polymerase subunit beta' OS=Haemophilus somnus (strain 129Pt) GN=rpoC PE=3 SV=1 256 897 3.0E-37
sp|C0ZVQ7|RPOC_RHOE4 DNA-directed RNA polymerase subunit beta' OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpoC PE=3 SV=1 257 891 3.0E-37
sp|A9BF32|RPOC_PETMO DNA-directed RNA polymerase subunit beta' OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpoC PE=3 SV=1 216 897 3.0E-37
sp|B0URZ7|RPOC_HISS2 DNA-directed RNA polymerase subunit beta' OS=Histophilus somni (strain 2336) GN=rpoC PE=3 SV=1 256 897 3.0E-37
sp|Q6AP77|RPOC_DESPS DNA-directed RNA polymerase subunit beta' OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpoC PE=3 SV=1 256 968 3.0E-37
sp|Q0VSM1|RPOC_ALCBS DNA-directed RNA polymerase subunit beta' OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpoC PE=3 SV=1 257 919 3.0E-37
sp|Q6YQW2|RPOC_ONYPE DNA-directed RNA polymerase subunit beta' OS=Onion yellows phytoplasma (strain OY-M) GN=rpoC PE=3 SV=1 83 897 3.0E-37
sp|Q2K9M3|RPOC_RHIEC DNA-directed RNA polymerase subunit beta' OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpoC PE=3 SV=1 87 903 4.0E-37
sp|Q6MDM0|RPOC_PARUW DNA-directed RNA polymerase subunit beta' OS=Protochlamydia amoebophila (strain UWE25) GN=rpoC PE=3 SV=1 216 919 4.0E-37
sp|Q822J2|RPOC_CHLCV DNA-directed RNA polymerase subunit beta' OS=Chlamydophila caviae (strain GPIC) GN=rpoC PE=3 SV=1 216 919 4.0E-37
sp|Q47LI6|RPOC_THEFY DNA-directed RNA polymerase subunit beta' OS=Thermobifida fusca (strain YX) GN=rpoC PE=3 SV=1 257 891 5.0E-37
sp|A9M5Q8|RPOC_BRUC2 DNA-directed RNA polymerase subunit beta' OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpoC PE=3 SV=1 87 890 5.0E-37
sp|A2SLG4|RPOC_METPP DNA-directed RNA polymerase subunit beta' OS=Methylibium petroleiphilum (strain PM1) GN=rpoC PE=3 SV=1 87 897 6.0E-37
sp|B4S498|RPOC_PROA2 DNA-directed RNA polymerase subunit beta' OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpoC PE=3 SV=1 256 903 6.0E-37
sp|Q6MRX5|RPOC_MYCMS DNA-directed RNA polymerase subunit beta' OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpoC PE=3 SV=1 249 897 7.0E-37
sp|A9NEL8|RPOC_ACHLI DNA-directed RNA polymerase subunit beta' OS=Acholeplasma laidlawii (strain PG-8A) GN=rpoC PE=3 SV=1 249 903 8.0E-37
sp|Q4QN34|RPOC_HAEI8 DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain 86-028NP) GN=rpoC PE=3 SV=1 256 919 8.0E-37
sp|B2RL44|RPOC_PORG3 DNA-directed RNA polymerase subunit beta' OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpoC PE=3 SV=1 256 897 8.0E-37
sp|Q160X8|RPOC_ROSDO DNA-directed RNA polymerase subunit beta' OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpoC PE=3 SV=1 211 890 8.0E-37
sp|A5U9X9|RPOC_HAEIE DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain PittEE) GN=rpoC PE=3 SV=1 256 919 8.0E-37
sp|A1USC9|RPOC_BARBK DNA-directed RNA polymerase subunit beta' OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpoC PE=3 SV=1 256 890 8.0E-37
sp|B0BSF6|RPOC_ACTPJ DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpoC PE=3 SV=1 256 897 9.0E-37
sp|Q0BYA8|RPOC_HYPNA DNA-directed RNA polymerase subunit beta' OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpoC PE=3 SV=1 86 914 1.0E-36
sp|B3GYV5|RPOC_ACTP7 DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpoC PE=3 SV=1 256 897 1.0E-36
sp|B3PK31|RPOC_CELJU DNA-directed RNA polymerase subunit beta' OS=Cellvibrio japonicus (strain Ueda107) GN=rpoC PE=3 SV=2 256 903 1.0E-36
sp|A5CUC6|RPOC_CLAM3 DNA-directed RNA polymerase subunit beta' OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rpoC PE=3 SV=1 257 897 1.0E-36
sp|B0RB26|RPOC_CLAMS DNA-directed RNA polymerase subunit beta' OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rpoC PE=3 SV=1 257 914 1.0E-36
sp|A1TYJ1|RPOC_MARHV DNA-directed RNA polymerase subunit beta' OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpoC PE=3 SV=1 256 897 1.0E-36
sp|A3N326|RPOC_ACTP2 DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpoC PE=3 SV=1 256 897 1.0E-36
sp|A6KYK2|RPOC_BACV8 DNA-directed RNA polymerase subunit beta' OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpoC PE=3 SV=1 256 897 1.0E-36
sp|A5UH19|RPOC_HAEIG DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain PittGG) GN=rpoC PE=3 SV=1 256 919 1.0E-36
sp|O67763|RPOC_AQUAE DNA-directed RNA polymerase subunit beta' OS=Aquifex aeolicus (strain VF5) GN=rpoC PE=3 SV=1 249 897 1.0E-36
sp|P43739|RPOC_HAEIN DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpoC PE=3 SV=1 256 919 1.0E-36
sp|A1T4J3|RPOC_MYCVP DNA-directed RNA polymerase subunit beta' OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rpoC PE=3 SV=1 257 897 2.0E-36
sp|Q6MJ10|RPOC_BDEBA DNA-directed RNA polymerase subunit beta' OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpoC PE=3 SV=1 256 891 2.0E-36
sp|C0RJK9|RPOC_BRUMB DNA-directed RNA polymerase subunit beta' OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpoC PE=3 SV=1 87 890 2.0E-36
sp|Q1MIE8|RPOC_RHIL3 DNA-directed RNA polymerase subunit beta' OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpoC PE=3 SV=1 87 903 2.0E-36
sp|B0CH40|RPOC_BRUSI DNA-directed RNA polymerase subunit beta' OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpoC PE=3 SV=1 87 890 2.0E-36
sp|Q2RQV4|RPOC_RHORT DNA-directed RNA polymerase subunit beta' OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpoC PE=3 SV=1 256 897 2.0E-36
sp|Q8G070|RPOC_BRUSU DNA-directed RNA polymerase subunit beta' OS=Brucella suis biovar 1 (strain 1330) GN=rpoC PE=3 SV=1 87 890 2.0E-36
sp|Q8YHP7|RPOC_BRUME DNA-directed RNA polymerase subunit beta' OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpoC PE=3 SV=1 87 890 2.0E-36
sp|A5VR14|RPOC_BRUO2 DNA-directed RNA polymerase subunit beta' OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpoC PE=3 SV=1 87 890 2.0E-36
sp|A4XBQ5|RPOC_SALTO DNA-directed RNA polymerase subunit beta' OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rpoC PE=3 SV=1 257 897 2.0E-36
sp|Q9CK92|RPOC_PASMU DNA-directed RNA polymerase subunit beta' OS=Pasteurella multocida (strain Pm70) GN=rpoC PE=3 SV=1 256 897 2.0E-36
sp|A6Q6I3|RPOC_SULNB DNA-directed RNA polymerase subunit beta' OS=Sulfurovum sp. (strain NBC37-1) GN=rpoC PE=3 SV=1 256 919 2.0E-36
sp|Q88QP1|RPOC_PSEPK DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain KT2440) GN=rpoC PE=3 SV=1 257 919 2.0E-36
sp|Q7MX26|RPOC_PORGI DNA-directed RNA polymerase subunit beta' OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpoC PE=3 SV=1 256 897 3.0E-36
sp|Q255E5|RPOC_CHLFF DNA-directed RNA polymerase subunit beta' OS=Chlamydophila felis (strain Fe/C-56) GN=rpoC PE=3 SV=1 216 919 3.0E-36
sp|Q13TG3|RPOC_BURXL DNA-directed RNA polymerase subunit beta' OS=Burkholderia xenovorans (strain LB400) GN=rpoC PE=3 SV=1 256 903 3.0E-36
sp|Q57CP9|RPOC_BRUAB DNA-directed RNA polymerase subunit beta' OS=Brucella abortus biovar 1 (strain 9-941) GN=rpoC PE=3 SV=1 87 890 3.0E-36
sp|Q2YM16|RPOC_BRUA2 DNA-directed RNA polymerase subunit beta' OS=Brucella abortus (strain 2308) GN=rpoC PE=3 SV=1 87 890 3.0E-36
sp|B2S686|RPOC_BRUA1 DNA-directed RNA polymerase subunit beta' OS=Brucella abortus (strain S19) GN=rpoC PE=3 SV=1 87 890 3.0E-36
sp|Q7VJ82|RPOBC_HELHP Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpoBC PE=3 SV=1 256 920 3.0E-36
sp|Q9Z999|RPOC_CHLPN DNA-directed RNA polymerase subunit beta' OS=Chlamydia pneumoniae GN=rpoC PE=3 SV=2 216 919 3.0E-36
sp|A5VXP1|RPOC_PSEP1 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpoC PE=3 SV=1 257 919 3.0E-36
sp|B2T758|RPOC_BURPP DNA-directed RNA polymerase subunit beta' OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpoC PE=3 SV=1 256 903 3.0E-36
sp|Q2L2L3|RPOC_BORA1 DNA-directed RNA polymerase subunit beta' OS=Bordetella avium (strain 197N) GN=rpoC PE=3 SV=1 237 919 3.0E-36
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 1058 1411 4.0E-36
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 1058 1411 4.0E-36
sp|Q8UE09|RPOC_AGRFC DNA-directed RNA polymerase subunit beta' OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpoC PE=3 SV=2 87 890 4.0E-36
sp|Q1IFX2|RPOC_PSEE4 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas entomophila (strain L48) GN=rpoC PE=3 SV=1 257 919 4.0E-36
sp|A4VHM4|RPOC_PSEU5 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas stutzeri (strain A1501) GN=rpoC PE=3 SV=1 257 919 5.0E-36
sp|B0BBU5|RPOC_CHLTB DNA-directed RNA polymerase subunit beta' OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpoC PE=3 SV=1 216 919 5.0E-36
sp|A1ALT5|RPOC_PELPD DNA-directed RNA polymerase subunit beta' OS=Pelobacter propionicus (strain DSM 2379) GN=rpoC PE=3 SV=1 256 897 5.0E-36
sp|B0B7N0|RPOC_CHLT2 DNA-directed RNA polymerase subunit beta' OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpoC PE=3 SV=1 216 919 5.0E-36
sp|A6UZI2|RPOC_PSEA7 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas aeruginosa (strain PA7) GN=rpoC PE=3 SV=1 256 919 5.0E-36
sp|Q3Z8V3|RPOC_DEHM1 DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpoC PE=3 SV=1 253 908 5.0E-36
sp|Q0SNB9|RPOC_BORAP DNA-directed RNA polymerase subunit beta' OS=Borrelia afzelii (strain PKo) GN=rpoC PE=3 SV=1 256 919 5.0E-36
sp|Q9HWC9|RPOC_PSEAE DNA-directed RNA polymerase subunit beta' OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpoC PE=3 SV=1 256 919 6.0E-36
sp|Q02T86|RPOC_PSEAB DNA-directed RNA polymerase subunit beta' OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpoC PE=3 SV=1 256 919 6.0E-36
sp|Q9X6Y2|RPOC_AQUPY DNA-directed RNA polymerase subunit beta' OS=Aquifex pyrophilus GN=rpoC PE=3 SV=1 184 897 6.0E-36
sp|B0KK61|RPOC_PSEPG DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain GB-1) GN=rpoC PE=3 SV=1 257 919 6.0E-36
sp|Q0ANP4|RPOC_MARMM DNA-directed RNA polymerase subunit beta' OS=Maricaulis maris (strain MCS10) GN=rpoC PE=3 SV=1 256 903 6.0E-36
sp|O84316|RPOC_CHLTR DNA-directed RNA polymerase subunit beta' OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpoC PE=3 SV=1 216 919 7.0E-36
sp|Q3KM48|RPOC_CHLTA DNA-directed RNA polymerase subunit beta' OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpoC PE=3 SV=1 216 919 7.0E-36
sp|C5CKF4|RPOC_VARPS DNA-directed RNA polymerase subunit beta' OS=Variovorax paradoxus (strain S110) GN=rpoC PE=3 SV=1 87 897 7.0E-36
sp|A6VKC4|RPOC_ACTSZ DNA-directed RNA polymerase subunit beta' OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpoC PE=3 SV=1 256 897 7.0E-36
sp|P30761|RPOC_MYCLE DNA-directed RNA polymerase subunit beta' OS=Mycobacterium leprae (strain TN) GN=rpoC PE=3 SV=2 257 909 7.0E-36
sp|B8ZSC6|RPOC_MYCLB DNA-directed RNA polymerase subunit beta' OS=Mycobacterium leprae (strain Br4923) GN=rpoC PE=3 SV=1 257 909 7.0E-36
sp|Q0BUQ5|RPOC_GRABC DNA-directed RNA polymerase subunit beta' OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpoC PE=3 SV=1 255 890 8.0E-36
sp|A6X0B0|RPOC_OCHA4 DNA-directed RNA polymerase subunit beta' OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpoC PE=3 SV=1 87 890 1.0E-35
sp|Q9PK79|RPOC_CHLMU DNA-directed RNA polymerase subunit beta' OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpoC PE=3 SV=1 216 919 1.0E-35
sp|A0LII5|RPOC_SYNFM DNA-directed RNA polymerase subunit beta' OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpoC PE=3 SV=1 253 891 1.0E-35
sp|B1JDX0|RPOC_PSEPW DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain W619) GN=rpoC PE=3 SV=1 257 919 1.0E-35
sp|A5FIJ4|RPOC_FLAJ1 DNA-directed RNA polymerase subunit beta' OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rpoC PE=3 SV=1 254 897 1.0E-35
sp|A7HCH6|RPOC_ANADF DNA-directed RNA polymerase subunit beta' OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpoC PE=3 SV=1 87 896 1.0E-35
sp|Q7MA56|RPOBC_WOLSU Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpoBC PE=3 SV=1 256 920 1.0E-35
sp|A7IKQ1|RPOC_XANP2 DNA-directed RNA polymerase subunit beta' OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpoC PE=3 SV=1 216 890 1.0E-35
sp|Q11HB4|RPOC_CHESB DNA-directed RNA polymerase subunit beta' OS=Chelativorans sp. (strain BNC1) GN=rpoC PE=3 SV=1 256 890 1.0E-35
sp|Q2LQ86|RPOC_SYNAS DNA-directed RNA polymerase subunit beta' OS=Syntrophus aciditrophicus (strain SB) GN=rpoC PE=3 SV=1 216 896 2.0E-35
sp|Q5L5I4|RPOC_CHLAB DNA-directed RNA polymerase subunit beta' OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpoC PE=3 SV=1 216 919 2.0E-35
sp|A8M538|RPOC_SALAI DNA-directed RNA polymerase subunit beta' OS=Salinispora arenicola (strain CNS-205) GN=rpoC PE=3 SV=1 257 897 2.0E-35
sp|A1WCM8|RPOC_ACISJ DNA-directed RNA polymerase subunit beta' OS=Acidovorax sp. (strain JS42) GN=rpoC PE=3 SV=1 256 903 2.0E-35
sp|Q65W40|RPOC_MANSM DNA-directed RNA polymerase subunit beta' OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpoC PE=3 SV=2 256 897 2.0E-35
sp|B9M6V1|RPOC_GEODF DNA-directed RNA polymerase subunit beta' OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpoC PE=3 SV=1 256 890 2.0E-35
sp|Q3A6Q3|RPOC_PELCD DNA-directed RNA polymerase subunit beta' OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpoC PE=3 SV=1 256 928 2.0E-35
sp|Q3J5S9|RPOC_RHOS4 DNA-directed RNA polymerase subunit beta' OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpoC PE=3 SV=1 217 897 2.0E-35
sp|A5GAY2|RPOC_GEOUR DNA-directed RNA polymerase subunit beta' OS=Geobacter uraniireducens (strain Rf4) GN=rpoC PE=3 SV=1 256 890 3.0E-35
sp|Q1BDE9|RPOC_MYCSS DNA-directed RNA polymerase subunit beta' OS=Mycobacterium sp. (strain MCS) GN=rpoC PE=3 SV=1 257 897 3.0E-35
sp|A1UBJ4|RPOC_MYCSK DNA-directed RNA polymerase subunit beta' OS=Mycobacterium sp. (strain KMS) GN=rpoC PE=3 SV=1 257 897 3.0E-35
sp|A3PV79|RPOC_MYCSJ DNA-directed RNA polymerase subunit beta' OS=Mycobacterium sp. (strain JLS) GN=rpoC PE=3 SV=1 257 897 3.0E-35
sp|Q2S1Q6|RPOC_SALRD DNA-directed RNA polymerase subunit beta' OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpoC PE=3 SV=1 256 896 3.0E-35
sp|B9MH46|RPOC_ACIET DNA-directed RNA polymerase subunit beta' OS=Acidovorax ebreus (strain TPSY) GN=rpoC PE=3 SV=1 256 903 3.0E-35
sp|A8HTZ1|RPOC_AZOC5 DNA-directed RNA polymerase subunit beta' OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpoC PE=3 SV=1 256 890 3.0E-35
sp|A3PGJ0|RPOC_RHOS1 DNA-directed RNA polymerase subunit beta' OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpoC1 PE=3 SV=1 217 897 3.0E-35
sp|Q39Y12|RPOC_GEOMG DNA-directed RNA polymerase subunit beta' OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpoC PE=3 SV=1 256 928 3.0E-35
sp|Q661N0|RPOC_BORBP DNA-directed RNA polymerase subunit beta' OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpoC PE=3 SV=1 256 919 3.0E-35
sp|A0LRL4|RPOC_ACIC1 DNA-directed RNA polymerase subunit beta' OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpoC PE=3 SV=1 257 897 3.0E-35
sp|A8EVZ3|RPOC_ARCB4 DNA-directed RNA polymerase subunit beta' OS=Arcobacter butzleri (strain RM4018) GN=rpoC PE=3 SV=1 256 920 4.0E-35
sp|Q2GFP4|RPOC_EHRCR DNA-directed RNA polymerase subunit beta' OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpoC PE=3 SV=1 256 896 5.0E-35
sp|P9WGY6|RPOC_MYCTO DNA-directed RNA polymerase subunit beta' OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpoC PE=3 SV=1 257 909 5.0E-35
sp|A0JZ92|RPOC_ARTS2 DNA-directed RNA polymerase subunit beta' OS=Arthrobacter sp. (strain FB24) GN=rpoC PE=3 SV=1 257 897 5.0E-35
sp|A4WVL5|RPOC_RHOS5 DNA-directed RNA polymerase subunit beta' OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpoC PE=3 SV=1 217 897 5.0E-35
sp|Q6G3X4|RPOC_BARHE DNA-directed RNA polymerase subunit beta' OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpoC PE=3 SV=1 87 890 7.0E-35
sp|B6YPZ6|RPOC_AZOPC DNA-directed RNA polymerase subunit beta' OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpoC PE=3 SV=1 254 885 7.0E-35
sp|Q3K5Y2|RPOC_PSEPF DNA-directed RNA polymerase subunit beta' OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpoC PE=3 SV=1 257 919 7.0E-35
sp|C3K2Y2|RPOC_PSEFS DNA-directed RNA polymerase subunit beta' OS=Pseudomonas fluorescens (strain SBW25) GN=rpoC PE=3 SV=1 257 919 8.0E-35
sp|A6LKB7|RPOC_THEM4 DNA-directed RNA polymerase subunit beta' OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpoC PE=3 SV=1 178 885 8.0E-35
sp|A5FRK6|RPOC_DEHMB DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpoC PE=3 SV=2 253 908 8.0E-35
sp|Q6FZM0|RPOC_BARQU DNA-directed RNA polymerase subunit beta' OS=Bartonella quintana (strain Toulouse) GN=rpoC PE=3 SV=1 256 890 8.0E-35
sp|Q3ZX00|RPOC_DEHMC DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpoC PE=3 SV=1 253 908 8.0E-35
sp|Q82T76|RPOC_NITEU DNA-directed RNA polymerase subunit beta' OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpoC PE=3 SV=1 87 908 8.0E-35
sp|Q2RFP0|RPOC_MOOTA DNA-directed RNA polymerase subunit beta' OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoC PE=3 SV=1 256 563 8.0E-35
sp|A1KRG7|RPOC_NEIMF DNA-directed RNA polymerase subunit beta' OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpoC PE=3 SV=1 87 903 1.0E-34
sp|Q1QN43|RPOC_NITHX DNA-directed RNA polymerase subunit beta' OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpoC PE=3 SV=1 256 897 1.0E-34
sp|B3EER3|RPOC_CHLL2 DNA-directed RNA polymerase subunit beta' OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpoC PE=3 SV=1 256 903 1.0E-34
sp|B4UDT1|RPOC_ANASK DNA-directed RNA polymerase subunit beta' OS=Anaeromyxobacter sp. (strain K) GN=rpoC PE=3 SV=1 216 896 1.0E-34
sp|Q3YST4|RPOC_EHRCJ DNA-directed RNA polymerase subunit beta' OS=Ehrlichia canis (strain Jake) GN=rpoC PE=3 SV=1 256 896 1.0E-34
sp|A5ELN6|RPOC_BRASB DNA-directed RNA polymerase subunit beta' OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpoC PE=3 SV=1 256 897 1.0E-34
sp|B3EL62|RPOC_CHLPB DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeobacteroides (strain BS1) GN=rpoC PE=3 SV=1 256 903 1.0E-34
sp|A0PM25|RPOC_MYCUA DNA-directed RNA polymerase subunit beta' OS=Mycobacterium ulcerans (strain Agy99) GN=rpoC PE=3 SV=1 257 897 2.0E-34
sp|C1AL01|RPOC_MYCBT DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpoC PE=3 SV=1 257 909 2.0E-34
sp|Q5HC04|RPOC_EHRRW DNA-directed RNA polymerase subunit beta' OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpoC PE=3 SV=1 256 896 2.0E-34
sp|A1KGE8|RPOC_MYCBP DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpoC PE=3 SV=1 257 909 2.0E-34
sp|P9WGY7|RPOC_MYCTU DNA-directed RNA polymerase subunit beta' OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpoC PE=1 SV=1 257 909 2.0E-34
sp|A5U053|RPOC_MYCTA DNA-directed RNA polymerase subunit beta' OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpoC PE=3 SV=1 257 909 2.0E-34
sp|P0A675|RPOC_MYCBO DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpoC PE=3 SV=1 257 909 2.0E-34
sp|C5C0K2|RPOC_BEUC1 DNA-directed RNA polymerase subunit beta' OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=rpoC PE=3 SV=1 228 897 2.0E-34
sp|Q4FLL3|RPOC_PELUB DNA-directed RNA polymerase subunit beta' OS=Pelagibacter ubique (strain HTCC1062) GN=rpoC PE=3 SV=1 256 892 2.0E-34
sp|B2V7L9|RPOC_SULSY DNA-directed RNA polymerase subunit beta' OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpoC PE=3 SV=1 249 897 2.0E-34
sp|Q3ATP4|RPOC_CHLCH DNA-directed RNA polymerase subunit beta' OS=Chlorobium chlorochromatii (strain CaD3) GN=rpoC PE=3 SV=1 256 903 2.0E-34
sp|B1I1M9|RPOC_DESAP DNA-directed RNA polymerase subunit beta' OS=Desulforudis audaxviator (strain MP104C) GN=rpoC PE=3 SV=1 216 562 3.0E-34
sp|B2HSJ4|RPOC_MYCMM DNA-directed RNA polymerase subunit beta' OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpoC PE=3 SV=1 257 897 3.0E-34
sp|Q820D6|RPOC_TROWT DNA-directed RNA polymerase subunit beta' OS=Tropheryma whipplei (strain Twist) GN=rpoC PE=3 SV=1 253 903 3.0E-34
sp|Q820D9|RPOC_TROW8 DNA-directed RNA polymerase subunit beta' OS=Tropheryma whipplei (strain TW08/27) GN=rpoC PE=3 SV=2 253 903 3.0E-34
sp|Q2II85|RPOC_ANADE DNA-directed RNA polymerase subunit beta' OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpoC PE=3 SV=1 216 896 4.0E-34
sp|Q2JFI4|RPOC_FRASC DNA-directed RNA polymerase subunit beta' OS=Frankia sp. (strain CcI3) GN=rpoC PE=3 SV=1 257 897 4.0E-34
sp|A6GYT9|RPOC_FLAPJ DNA-directed RNA polymerase subunit beta' OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpoC PE=3 SV=1 254 897 5.0E-34
sp|A9ISG4|RPOC_BART1 DNA-directed RNA polymerase subunit beta' OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpoC PE=3 SV=1 256 890 5.0E-34
sp|B2GIK0|RPOC_KOCRD DNA-directed RNA polymerase subunit beta' OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rpoC PE=3 SV=1 257 900 6.0E-34
sp|A1TVS9|RPOC_ACIAC DNA-directed RNA polymerase subunit beta' OS=Acidovorax citrulli (strain AAC00-1) GN=rpoC PE=3 SV=1 256 903 7.0E-34
sp|Q1D7U2|RPOC_MYXXD DNA-directed RNA polymerase subunit beta' OS=Myxococcus xanthus (strain DK 1622) GN=rpoC PE=3 SV=1 256 896 7.0E-34
sp|A0RQI4|RPOC_CAMFF DNA-directed RNA polymerase subunit beta' OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpoC PE=3 SV=1 256 897 9.0E-34
sp|B2G8Y5|RPOC_LACRJ DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain JCM 1112) GN=rpoC PE=3 SV=1 256 566 9.0E-34
sp|A5VLL3|RPOC_LACRD DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoC PE=3 SV=1 256 566 9.0E-34
sp|A4YSI2|RPOC_BRASO DNA-directed RNA polymerase subunit beta' OS=Bradyrhizobium sp. (strain ORS278) GN=rpoC PE=3 SV=1 256 897 9.0E-34
sp|Q5D869|NRPE1_ARATH DNA-directed RNA polymerase V subunit 1 OS=Arabidopsis thaliana GN=NRPE1 PE=1 SV=1 258 914 9.0E-34
sp|A4J104|RPOC_DESRM DNA-directed RNA polymerase subunit beta' OS=Desulfotomaculum reducens (strain MI-1) GN=rpoC PE=3 SV=1 216 562 1.0E-33
sp|A5D5I3|RPOC_PELTS DNA-directed RNA polymerase subunit beta' OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpoC PE=3 SV=1 256 920 1.0E-33
sp|B5EFP4|RPOC_GEOBB DNA-directed RNA polymerase subunit beta' OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpoC PE=3 SV=1 256 890 2.0E-33
sp|Q8NT25|RPOC_CORGL DNA-directed RNA polymerase subunit beta' OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rpoC PE=3 SV=1 222 897 2.0E-33
sp|A4QBG3|RPOC_CORGB DNA-directed RNA polymerase subunit beta' OS=Corynebacterium glutamicum (strain R) GN=rpoC PE=3 SV=1 222 897 2.0E-33
sp|A4FPP2|RPOC_SACEN DNA-directed RNA polymerase subunit beta' OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpoC PE=3 SV=1 257 897 2.0E-33
sp|B4SG10|RPOC_PELPB DNA-directed RNA polymerase subunit beta' OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpoC PE=3 SV=1 256 903 2.0E-33
sp|B1HMZ5|RPOC_LYSSC DNA-directed RNA polymerase subunit beta' OS=Lysinibacillus sphaericus (strain C3-41) GN=rpoC PE=3 SV=2 257 562 2.0E-33
sp|A9BR99|RPOC_DELAS DNA-directed RNA polymerase subunit beta' OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpoC PE=3 SV=1 256 903 2.0E-33
sp|A3DIZ5|RPOC_CLOTH DNA-directed RNA polymerase subunit beta' OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoC PE=3 SV=1 253 562 3.0E-33
sp|P19176|RPOC_PSEPU DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida GN=rpoC PE=3 SV=3 257 919 3.0E-33
sp|Q73SE3|RPOC_MYCPA DNA-directed RNA polymerase subunit beta' OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpoC PE=3 SV=1 257 909 4.0E-33
sp|B0UHX5|RPOC_METS4 DNA-directed RNA polymerase subunit beta' OS=Methylobacterium sp. (strain 4-46) GN=rpoC PE=3 SV=1 256 890 6.0E-33
sp|A9B6J1|RPOC_HERA2 DNA-directed RNA polymerase subunit beta' OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpoC PE=3 SV=1 256 562 8.0E-33
sp|Q5GRY9|RPOBC_WOLTR Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpoBC PE=3 SV=1 256 908 1.0E-32
sp|B3E7S9|RPOC_GEOLS DNA-directed RNA polymerase subunit beta' OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpoC PE=3 SV=1 256 919 1.0E-32
sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoC PE=3 SV=1 256 565 2.0E-32
sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoC PE=3 SV=1 256 565 2.0E-32
sp|Q9RVW0|RPOC_DEIRA DNA-directed RNA polymerase subunit beta' OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpoC PE=3 SV=1 257 566 2.0E-32
sp|C6E4R3|RPOC_GEOSM DNA-directed RNA polymerase subunit beta' OS=Geobacter sp. (strain M21) GN=rpoC PE=3 SV=1 256 890 3.0E-32
sp|Q98N65|RPOC_RHILO DNA-directed RNA polymerase subunit beta' OS=Rhizobium loti (strain MAFF303099) GN=rpoC PE=3 SV=1 256 890 3.0E-32
sp|Q5PBG3|RPOC_ANAMM DNA-directed RNA polymerase subunit beta' OS=Anaplasma marginale (strain St. Maries) GN=rpoC PE=3 SV=1 256 896 4.0E-32
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 1043 1205 1.0E-31
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 1272 1411 9.0E-30
sp|Q7T6X5|RPO1_MIMIV DNA-directed RNA polymerase subunit 1 OS=Acanthamoeba polyphaga mimivirus GN=RPO1 PE=1 SV=2 1062 1411 3.0E-24
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 1051 1155 2.0E-18
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 1035 1155 1.0E-17
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 1014 1178 1.0E-17
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 1032 1155 1.0E-16
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 1272 1411 3.0E-16
sp|Q250N9|RPOC_DESHY DNA-directed RNA polymerase subunit beta' OS=Desulfitobacterium hafniense (strain Y51) GN=rpoC PE=3 SV=1 1063 1149 6.0E-16
sp|P0C987|RPB1_ASFP4 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-111 PE=3 SV=1 1039 1405 4.0E-15
sp|P0C988|RPB1_ASFWA Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-109 PE=3 SV=1 1039 1405 5.0E-15
sp|A7NJM0|RPOC_ROSCS DNA-directed RNA polymerase subunit beta' OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpoC PE=3 SV=1 1064 1406 8.0E-14
sp|A0PXT9|RPOC_CLONN DNA-directed RNA polymerase subunit beta' OS=Clostridium novyi (strain NT) GN=rpoC PE=3 SV=1 1067 1157 1.0E-13
sp|Q4L3K4|RPOC_STAHJ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoC PE=3 SV=1 1064 1148 2.0E-13
sp|Q2FJ97|RPOC_STAA3 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain USA300) GN=rpoC PE=3 SV=2 1064 1148 3.0E-13
sp|Q6GJC5|RPOC_STAAR DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MRSA252) GN=rpoC PE=3 SV=1 1064 1148 3.0E-13
sp|P60286|RPOC_STAAW DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MW2) GN=rpoC PE=3 SV=1 1064 1148 3.0E-13
sp|Q6GBU4|RPOC_STAAS DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MSSA476) GN=rpoC PE=3 SV=1 1064 1148 3.0E-13
sp|P60285|RPOC_STAAN DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain N315) GN=rpoC PE=1 SV=1 1064 1148 3.0E-13
sp|P60284|RPOC_STAAM DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoC PE=3 SV=1 1064 1148 3.0E-13
sp|Q5HID2|RPOC_STAAC DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain COL) GN=rpoC PE=3 SV=1 1064 1148 3.0E-13
sp|Q2G0N5|RPOC_STAA8 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoC PE=3 SV=2 1064 1148 3.0E-13
sp|Q2YSB8|RPOC_STAAB DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoC PE=3 SV=1 1064 1148 3.0E-13
sp|P0C1T4|RPOC_STAAU DNA-directed RNA polymerase subunit beta' (Fragment) OS=Staphylococcus aureus GN=rpoC PE=3 SV=1 1064 1148 3.0E-13
sp|Q49V53|RPOC_STAS1 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoC PE=3 SV=1 1064 1123 4.0E-13
sp|P77839|RPOC_BROTH DNA-directed RNA polymerase subunit beta' (Fragment) OS=Brochothrix thermosphacta GN=rpoC PE=3 SV=2 1062 1123 4.0E-13
sp|Q8CQ83|RPOC_STAES DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoC PE=3 SV=1 1064 1123 4.0E-13
sp|Q5HRK9|RPOC_STAEQ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoC PE=3 SV=1 1064 1123 4.0E-13
sp|P77819|RPOC_BACAN DNA-directed RNA polymerase subunit beta' OS=Bacillus anthracis GN=rpoC PE=3 SV=3 1064 1146 5.0E-13
sp|Q6HPR5|RPOC_BACHK DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpoC PE=3 SV=1 1064 1146 5.0E-13
sp|A0R8H3|RPOC_BACAH DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis (strain Al Hakam) GN=rpoC PE=3 SV=1 1064 1146 5.0E-13
sp|Q63H97|RPOC_BACCZ DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ZK / E33L) GN=rpoC PE=3 SV=1 1064 1146 5.0E-13
sp|Q73FA3|RPOC_BACC1 DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpoC PE=3 SV=1 1064 1146 5.0E-13
sp|Q81J47|RPOC_BACCR DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpoC PE=3 SV=1 1064 1146 5.0E-13
sp|A9VP70|RPOC_BACWK DNA-directed RNA polymerase subunit beta' OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpoC PE=3 SV=1 1064 1146 6.0E-13
sp|Q9Z9M1|RPOC_BACHD DNA-directed RNA polymerase subunit beta' OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoC PE=3 SV=1 1062 1146 6.0E-13
sp|Q5L404|RPOC_GEOKA DNA-directed RNA polymerase subunit beta' OS=Geobacillus kaustophilus (strain HTA426) GN=rpoC PE=3 SV=1 1064 1164 6.0E-13
sp|Q82Z41|RPOC_ENTFA DNA-directed RNA polymerase subunit beta' OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoC PE=3 SV=1 1062 1123 8.0E-13
sp|A7GK13|RPOC_BACCN DNA-directed RNA polymerase subunit beta' OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpoC PE=3 SV=1 1064 1146 9.0E-13
sp|Q3Z8V3|RPOC_DEHM1 DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpoC PE=3 SV=1 1064 1401 9.0E-13
sp|P77879|RPOC_LISIN DNA-directed RNA polymerase subunit beta' OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoC PE=3 SV=3 1062 1123 1.0E-12
sp|Q724E9|RPOC_LISMF DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoC PE=3 SV=1 1062 1123 1.0E-12
sp|Q8YA96|RPOC_LISMO DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoC PE=3 SV=1 1062 1123 1.0E-12
sp|A0AF64|RPOC_LISW6 DNA-directed RNA polymerase subunit beta' OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoC PE=3 SV=1 1062 1123 1.0E-12
sp|A5D5I3|RPOC_PELTS DNA-directed RNA polymerase subunit beta' OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpoC PE=3 SV=1 1017 1122 1.0E-12
sp|Q5WLR9|RPOC_BACSK DNA-directed RNA polymerase subunit beta' OS=Bacillus clausii (strain KSM-K16) GN=rpoC PE=3 SV=1 1062 1123 2.0E-12
sp|Q8ETY7|RPOC_OCEIH DNA-directed RNA polymerase subunit beta' OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoC PE=3 SV=1 1062 1123 2.0E-12
sp|P96177|RPOC_WEIHE DNA-directed RNA polymerase subunit beta' (Fragment) OS=Weissella hellenica GN=rpoC PE=3 SV=1 1064 1123 2.0E-12
sp|P96178|RPOC_WEIPA DNA-directed RNA polymerase subunit beta' (Fragment) OS=Weissella paramesenteroides GN=rpoC PE=3 SV=1 1064 1123 2.0E-12
sp|Q18CF3|RPOC_PEPD6 DNA-directed RNA polymerase subunit beta' OS=Peptoclostridium difficile (strain 630) GN=rpoC PE=3 SV=1 1063 1123 2.0E-12
sp|B1HMZ5|RPOC_LYSSC DNA-directed RNA polymerase subunit beta' OS=Lysinibacillus sphaericus (strain C3-41) GN=rpoC PE=3 SV=2 1064 1123 2.0E-12
sp|P77882|RPOC_LISGR DNA-directed RNA polymerase subunit beta' (Fragment) OS=Listeria grayi GN=rpoC PE=3 SV=2 1062 1123 3.0E-12
sp|Q8R7U7|RPOC_CALS4 DNA-directed RNA polymerase subunit beta' OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoC PE=3 SV=1 1064 1123 3.0E-12
sp|A5FRK6|RPOC_DEHMB DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpoC PE=3 SV=2 1064 1401 3.0E-12
sp|B0TC49|RPOC_HELMI DNA-directed RNA polymerase subunit beta' OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoC PE=3 SV=1 1064 1149 4.0E-12
sp|B1IGG1|RPOC_CLOBK DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoC PE=3 SV=1 1054 1123 4.0E-12
sp|A5I7L3|RPOC_CLOBH DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoC PE=3 SV=1 1054 1123 4.0E-12
sp|A7FZ76|RPOC_CLOB1 DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoC PE=3 SV=1 1054 1123 4.0E-12
sp|B1KSN2|RPOC_CLOBM DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoC PE=3 SV=1 1054 1123 4.0E-12
sp|B1YGU3|RPOC_EXIS2 DNA-directed RNA polymerase subunit beta' OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpoC PE=3 SV=1 1064 1123 5.0E-12
sp|A7GJ81|RPOC_CLOBL DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoC PE=3 SV=1 1054 1123 5.0E-12
sp|Q3A9Q8|RPOC_CARHZ DNA-directed RNA polymerase subunit beta' OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoC PE=3 SV=1 1064 1123 6.0E-12
sp|P37871|RPOC_BACSU DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) GN=rpoC PE=1 SV=4 1062 1123 6.0E-12
sp|A8MLD3|RPOC_ALKOO DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoC PE=3 SV=1 1064 1123 6.0E-12
sp|A4IJI2|RPOC_GEOTN DNA-directed RNA polymerase subunit beta' OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoC PE=3 SV=2 1064 1123 7.0E-12
sp|B2A4D2|RPOC_NATTJ DNA-directed RNA polymerase subunit beta' OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpoC PE=3 SV=1 1067 1123 8.0E-12
sp|A6TWI9|RPOC_ALKMQ DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoC PE=3 SV=1 1064 1123 8.0E-12
sp|Q65PB4|RPOC_BACLD DNA-directed RNA polymerase subunit beta' OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoC PE=3 SV=1 1064 1113 9.0E-12
sp|A7Z0N0|RPOC_BACMF DNA-directed RNA polymerase subunit beta' OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoC PE=3 SV=1 1064 1113 9.0E-12
sp|A8F977|RPOC_BACP2 DNA-directed RNA polymerase subunit beta' OS=Bacillus pumilus (strain SAFR-032) GN=rpoC PE=3 SV=1 1064 1113 9.0E-12
sp|Q0SQD7|RPOC_CLOPS DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoC PE=3 SV=1 1067 1156 9.0E-12
sp|P0C2E8|RPOC_CLOPE DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain 13 / Type A) GN=rpoC PE=3 SV=1 1067 1156 9.0E-12
sp|Q0TMN9|RPOC_CLOP1 DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoC PE=3 SV=1 1067 1156 9.0E-12
sp|A4XI31|RPOC_CALS8 DNA-directed RNA polymerase subunit beta' OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoC PE=3 SV=2 1064 1123 1.0E-11
sp|B0K5G9|RPOC_THEPX DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter sp. (strain X514) GN=rpoC PE=3 SV=2 1064 1123 1.0E-11
sp|B0KCJ3|RPOC_THEP3 DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoC PE=3 SV=1 1064 1123 1.0E-11
sp|Q67JT4|RPOC_SYMTH DNA-directed RNA polymerase subunit beta' OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoC PE=3 SV=1 1064 1122 1.0E-11
sp|Q88XZ2|RPOC_LACPL DNA-directed RNA polymerase subunit beta' OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoC PE=3 SV=1 1063 1146 1.0E-11
sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoC PE=3 SV=1 1067 1123 1.0E-11
sp|A6LPQ5|RPOC_CLOB8 DNA-directed RNA polymerase subunit beta' OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoC PE=3 SV=1 1064 1123 1.0E-11
sp|B1HMZ5|RPOC_LYSSC DNA-directed RNA polymerase subunit beta' OS=Lysinibacillus sphaericus (strain C3-41) GN=rpoC PE=3 SV=2 671 939 1.0E-11
sp|A3DIZ5|RPOC_CLOTH DNA-directed RNA polymerase subunit beta' OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoC PE=3 SV=1 1067 1123 1.0E-11
sp|C0M7R5|RPOC_STRE4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoC PE=3 SV=1 1064 1147 2.0E-11
sp|A2RC52|RPOC_STRPG DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoC PE=3 SV=1 1064 1147 2.0E-11
sp|P0C0E0|RPOC_STRP1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M1 GN=rpoC PE=3 SV=1 1064 1147 2.0E-11
sp|Q48VR0|RPOC_STRPM DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoC PE=3 SV=1 1064 1147 2.0E-11
sp|P0DF32|RPOC_STRP3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoC PE=3 SV=1 1064 1147 2.0E-11
sp|Q1JNX6|RPOC_STRPC DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoC PE=3 SV=1 1064 1147 2.0E-11
sp|Q1JE19|RPOC_STRPB DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoC PE=3 SV=1 1064 1147 2.0E-11
sp|P0DF33|RPOC_STRPQ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoC PE=3 SV=1 1064 1147 2.0E-11
sp|Q1JJ22|RPOC_STRPD DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoC PE=3 SV=1 1064 1147 2.0E-11
sp|C0MEE4|RPOC_STRS7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoC PE=3 SV=1 1064 1147 2.0E-11
sp|P0C0D9|RPOC_STRPY DNA-directed RNA polymerase subunit beta' (Fragment) OS=Streptococcus pyogenes GN=rpoC PE=3 SV=1 1064 1147 2.0E-11
sp|A4XBQ5|RPOC_SALTO DNA-directed RNA polymerase subunit beta' OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rpoC PE=3 SV=1 1064 1113 2.0E-11
sp|A8M538|RPOC_SALAI DNA-directed RNA polymerase subunit beta' OS=Salinispora arenicola (strain CNS-205) GN=rpoC PE=3 SV=1 1064 1113 2.0E-11
sp|B2G8Y5|RPOC_LACRJ DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain JCM 1112) GN=rpoC PE=3 SV=1 1064 1123 2.0E-11
sp|A5VLL3|RPOC_LACRD DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoC PE=3 SV=1 1064 1123 2.0E-11
sp|A4J104|RPOC_DESRM DNA-directed RNA polymerase subunit beta' OS=Desulfotomaculum reducens (strain MI-1) GN=rpoC PE=3 SV=1 1029 1149 2.0E-11
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 1261 1410 3.0E-11
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 1265 1410 3.0E-11
sp|A8AZI2|RPOC_STRGC DNA-directed RNA polymerase subunit beta' OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoC PE=3 SV=1 1064 1123 3.0E-11
sp|Q5XE96|RPOC_STRP6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoC PE=3 SV=1 1064 1147 3.0E-11
sp|Q8P2Y2|RPOC_STRP8 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoC PE=3 SV=1 1064 1147 3.0E-11
sp|Q1J8X0|RPOC_STRPF DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoC PE=3 SV=1 1064 1147 3.0E-11
sp|B0S2E5|RPOC_FINM2 DNA-directed RNA polymerase subunit beta' OS=Finegoldia magna (strain ATCC 29328) GN=rpoC PE=3 SV=2 1064 1123 3.0E-11
sp|A5N4P0|RPOC_CLOK5 DNA-directed RNA polymerase subunit beta' OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoC PE=3 SV=1 1064 1123 3.0E-11
sp|Q2RFP0|RPOC_MOOTA DNA-directed RNA polymerase subunit beta' OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoC PE=3 SV=1 1063 1149 3.0E-11
sp|Q2JFI4|RPOC_FRASC DNA-directed RNA polymerase subunit beta' OS=Frankia sp. (strain CcI3) GN=rpoC PE=3 SV=1 1021 1113 3.0E-11
sp|Q9CEN7|RPOC_LACLA DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoC PE=3 SV=2 1064 1123 4.0E-11
sp|A2RML8|RPOC_LACLM DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoC PE=3 SV=1 1064 1123 4.0E-11
sp|A4VSK3|RPOC_STRSY DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 05ZYH33) GN=rpoC PE=3 SV=2 1064 1123 4.0E-11
sp|A4VYU4|RPOC_STRS2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 98HAH33) GN=rpoC PE=3 SV=2 1064 1123 4.0E-11
sp|Q890N5|RPOC_CLOTE DNA-directed RNA polymerase subunit beta' OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoC PE=3 SV=2 1067 1123 4.0E-11
sp|B1I1M9|RPOC_DESAP DNA-directed RNA polymerase subunit beta' OS=Desulforudis audaxviator (strain MP104C) GN=rpoC PE=3 SV=1 1064 1115 4.0E-11
sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoC PE=3 SV=1 1063 1123 4.0E-11
sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoC PE=3 SV=1 1063 1123 4.0E-11
sp|Q8DS47|RPOC_STRMU DNA-directed RNA polymerase subunit beta' OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoC PE=3 SV=2 1064 1123 5.0E-11
sp|Q02X60|RPOC_LACLS DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoC PE=3 SV=1 1064 1123 5.0E-11
sp|B9DSZ6|RPOC_STRU0 DNA-directed RNA polymerase subunit beta' OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoC PE=3 SV=1 1064 1123 5.0E-11
sp|Q5M2F6|RPOC_STRT2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoC PE=3 SV=1 1064 1123 5.0E-11
sp|Q5LXV4|RPOC_STRT1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoC PE=3 SV=1 1064 1123 5.0E-11
sp|Q034X1|RPOC_LACC3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain ATCC 334) GN=rpoC PE=3 SV=1 1063 1123 5.0E-11
sp|B3WAM7|RPOC_LACCB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain BL23) GN=rpoC PE=3 SV=1 1063 1123 5.0E-11
sp|P77917|RPOC_PEDAC DNA-directed RNA polymerase subunit beta' (Fragment) OS=Pediococcus acidilactici GN=rpoC PE=3 SV=2 1064 1113 5.0E-11
sp|A9NEL8|RPOC_ACHLI DNA-directed RNA polymerase subunit beta' OS=Acholeplasma laidlawii (strain PG-8A) GN=rpoC PE=3 SV=1 1064 1113 5.0E-11
sp|Q8E238|RPOC_STRA5 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoC PE=3 SV=1 1064 1123 6.0E-11
sp|Q8E7J7|RPOC_STRA3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoC PE=3 SV=1 1064 1123 6.0E-11
sp|Q3K3L1|RPOC_STRA1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoC PE=3 SV=1 1064 1123 6.0E-11
sp|Q03IK3|RPOC_STRTD DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoC PE=3 SV=1 1064 1123 6.0E-11
sp|B2GDX6|RPOC_LACF3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpoC PE=3 SV=1 1063 1113 6.0E-11
sp|Q38UQ3|RPOC_LACSS DNA-directed RNA polymerase subunit beta' OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoC PE=3 SV=1 1064 1123 7.0E-11
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 1261 1410 8.0E-11
sp|A3CKD4|RPOC_STRSV DNA-directed RNA polymerase subunit beta' OS=Streptococcus sanguinis (strain SK36) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|B5E2F2|RPOC_STRP4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|C1CTL3|RPOC_STRZT DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|C1CGP3|RPOC_STRZJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain JJA) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|B2IM39|RPOC_STRPS DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain CGSP14) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|Q97NQ8|RPOC_STRPN DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|B1I8R3|RPOC_STRPI DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|C1CA05|RPOC_STRP7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain 70585) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|C1CMQ7|RPOC_STRZP DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain P1031) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|Q8DNF1|RPOC_STRR6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|B8ZNW6|RPOC_STRPJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|Q04IK7|RPOC_STRP2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoC PE=3 SV=1 1064 1123 8.0E-11
sp|Q5FM96|RPOC_LACAC DNA-directed RNA polymerase subunit beta' OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoC PE=3 SV=1 1063 1113 8.0E-11
sp|A8YXJ9|RPOC_LACH4 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoC PE=3 SV=1 1063 1113 8.0E-11
sp|Q0AUH3|RPOC_SYNWW DNA-directed RNA polymerase subunit beta' OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoC PE=3 SV=1 1063 1123 8.0E-11
sp|P94892|RPOC_LEUMM DNA-directed RNA polymerase subunit beta' OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoC PE=3 SV=2 1063 1113 9.0E-11
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 1269 1414 1.0E-10
sp|P94899|RPOC_LEUPS DNA-directed RNA polymerase subunit beta' (Fragment) OS=Leuconostoc pseudomesenteroides GN=rpoC PE=3 SV=1 1063 1113 1.0E-10
sp|Q03EB0|RPOC_PEDPA DNA-directed RNA polymerase subunit beta' OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoC PE=3 SV=1 1064 1113 1.0E-10
sp|B1MVW7|RPOC_LEUCK DNA-directed RNA polymerase subunit beta' OS=Leuconostoc citreum (strain KM20) GN=rpoC PE=3 SV=1 1063 1113 1.0E-10
sp|B1W441|RPOC_STRGG DNA-directed RNA polymerase subunit beta' OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpoC PE=3 SV=1 1064 1113 1.0E-10
sp|Q2NJ16|RPOC_AYWBP DNA-directed RNA polymerase subunit beta' OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpoC PE=3 SV=1 1064 1115 1.0E-10
sp|Q6YQW2|RPOC_ONYPE DNA-directed RNA polymerase subunit beta' OS=Onion yellows phytoplasma (strain OY-M) GN=rpoC PE=3 SV=1 1064 1115 1.0E-10
sp|Q47LI6|RPOC_THEFY DNA-directed RNA polymerase subunit beta' OS=Thermobifida fusca (strain YX) GN=rpoC PE=3 SV=1 1064 1113 1.0E-10
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 1275 1410 2.0E-10
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 1262 1414 2.0E-10
sp|Q1WVA4|RPOC_LACS1 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus salivarius (strain UCC118) GN=rpoC PE=3 SV=1 1063 1123 2.0E-10
sp|B9LL90|RPOC_CHLSY DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpoC PE=3 SV=1 1064 1113 2.0E-10
sp|B8G4U8|RPOC_CHLAD DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpoC PE=3 SV=1 1064 1113 2.0E-10
sp|A9WH11|RPOC_CHLAA DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpoC PE=3 SV=1 1064 1113 2.0E-10
sp|Q8RQE8|RPOC_THET8 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpoC PE=1 SV=1 1064 1123 2.0E-10
sp|Q72HM6|RPOC_THET2 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpoC PE=3 SV=2 1064 1123 2.0E-10
sp|A4FPP2|RPOC_SACEN DNA-directed RNA polymerase subunit beta' OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpoC PE=3 SV=1 1064 1113 2.0E-10
sp|A9BF32|RPOC_PETMO DNA-directed RNA polymerase subunit beta' OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpoC PE=3 SV=1 1054 1120 3.0E-10
sp|Q6MRX5|RPOC_MYCMS DNA-directed RNA polymerase subunit beta' OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpoC PE=3 SV=1 1064 1120 3.0E-10
sp|A0LRL4|RPOC_ACIC1 DNA-directed RNA polymerase subunit beta' OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpoC PE=3 SV=1 1016 1113 3.0E-10
sp|A9B6J1|RPOC_HERA2 DNA-directed RNA polymerase subunit beta' OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpoC PE=3 SV=1 1064 1113 3.0E-10
sp|Q046D1|RPOC_LACGA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpoC PE=3 SV=1 1064 1113 4.0E-10
sp|Q74L94|RPOC_LACJO DNA-directed RNA polymerase subunit beta' OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpoC PE=3 SV=1 1064 1113 4.0E-10
sp|Q04E86|RPOC_OENOB DNA-directed RNA polymerase subunit beta' OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoC PE=3 SV=1 1064 1113 4.0E-10
sp|P95405|RPOC_OENOE DNA-directed RNA polymerase subunit beta' (Fragment) OS=Oenococcus oeni GN=rpoC PE=3 SV=1 1064 1113 4.0E-10
sp|C0ZVQ7|RPOC_RHOE4 DNA-directed RNA polymerase subunit beta' OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpoC PE=3 SV=1 1064 1113 4.0E-10
sp|A5USR6|RPOC_ROSS1 DNA-directed RNA polymerase subunit beta' OS=Roseiflexus sp. (strain RS-1) GN=rpoC PE=3 SV=1 1064 1113 5.0E-10
sp|Q9KWU6|RPOC_THEAQ DNA-directed RNA polymerase subunit beta' OS=Thermus aquaticus GN=rpoC PE=1 SV=2 1064 1123 6.0E-10
sp|A6LKB7|RPOC_THEM4 DNA-directed RNA polymerase subunit beta' OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpoC PE=3 SV=1 1067 1120 7.0E-10
sp|Q03PV0|RPOC_LACBA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpoC PE=3 SV=1 1063 1113 1.0E-09
sp|Q3ZX00|RPOC_DEHMC DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpoC PE=3 SV=1 1064 1113 1.0E-09
sp|Q820D6|RPOC_TROWT DNA-directed RNA polymerase subunit beta' OS=Tropheryma whipplei (strain Twist) GN=rpoC PE=3 SV=1 1044 1126 1.0E-09
sp|Q820D9|RPOC_TROW8 DNA-directed RNA polymerase subunit beta' OS=Tropheryma whipplei (strain TW08/27) GN=rpoC PE=3 SV=2 1044 1126 1.0E-09
sp|B2GIK0|RPOC_KOCRD DNA-directed RNA polymerase subunit beta' OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rpoC PE=3 SV=1 997 1126 1.0E-09
sp|A0JZ92|RPOC_ARTS2 DNA-directed RNA polymerase subunit beta' OS=Arthrobacter sp. (strain FB24) GN=rpoC PE=3 SV=1 972 1113 2.0E-09
sp|C5C0K2|RPOC_BEUC1 DNA-directed RNA polymerase subunit beta' OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=rpoC PE=3 SV=1 1064 1113 3.0E-09
sp|A4J104|RPOC_DESRM DNA-directed RNA polymerase subunit beta' OS=Desulfotomaculum reducens (strain MI-1) GN=rpoC PE=3 SV=1 678 917 3.0E-09
sp|A5CUC6|RPOC_CLAM3 DNA-directed RNA polymerase subunit beta' OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rpoC PE=3 SV=1 1064 1113 4.0E-09
sp|Q1J0P7|RPOC_DEIGD DNA-directed RNA polymerase subunit beta' OS=Deinococcus geothermalis (strain DSM 11300) GN=rpoC PE=3 SV=1 1064 1122 6.0E-09
sp|Q73SE3|RPOC_MYCPA DNA-directed RNA polymerase subunit beta' OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpoC PE=3 SV=1 983 1113 7.0E-09
sp|A1SEK2|RPOC_NOCSJ DNA-directed RNA polymerase subunit beta' OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpoC PE=3 SV=1 1064 1113 8.0E-09
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 1266 1411 9.0E-09
sp|B0RB26|RPOC_CLAMS DNA-directed RNA polymerase subunit beta' OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rpoC PE=3 SV=1 1064 1113 1.0E-08
sp|Q2RFP0|RPOC_MOOTA DNA-directed RNA polymerase subunit beta' OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoC PE=3 SV=1 680 912 1.0E-08
sp|Q9RVW0|RPOC_DEIRA DNA-directed RNA polymerase subunit beta' OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpoC PE=3 SV=1 1064 1122 1.0E-08
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 10 134 2.0E-08
sp|P30761|RPOC_MYCLE DNA-directed RNA polymerase subunit beta' OS=Mycobacterium leprae (strain TN) GN=rpoC PE=3 SV=2 1064 1113 2.0E-08
sp|B8ZSC6|RPOC_MYCLB DNA-directed RNA polymerase subunit beta' OS=Mycobacterium leprae (strain Br4923) GN=rpoC PE=3 SV=1 1064 1113 2.0E-08
sp|Q1BDE9|RPOC_MYCSS DNA-directed RNA polymerase subunit beta' OS=Mycobacterium sp. (strain MCS) GN=rpoC PE=3 SV=1 1064 1113 2.0E-08
sp|A1UBJ4|RPOC_MYCSK DNA-directed RNA polymerase subunit beta' OS=Mycobacterium sp. (strain KMS) GN=rpoC PE=3 SV=1 1064 1113 2.0E-08
sp|A3PV79|RPOC_MYCSJ DNA-directed RNA polymerase subunit beta' OS=Mycobacterium sp. (strain JLS) GN=rpoC PE=3 SV=1 1064 1113 2.0E-08
sp|P9WGY6|RPOC_MYCTO DNA-directed RNA polymerase subunit beta' OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpoC PE=3 SV=1 1064 1113 2.0E-08
sp|A0PM25|RPOC_MYCUA DNA-directed RNA polymerase subunit beta' OS=Mycobacterium ulcerans (strain Agy99) GN=rpoC PE=3 SV=1 1064 1113 2.0E-08
sp|C1AL01|RPOC_MYCBT DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpoC PE=3 SV=1 1064 1113 2.0E-08
sp|A1KGE8|RPOC_MYCBP DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpoC PE=3 SV=1 1064 1113 2.0E-08
sp|P9WGY7|RPOC_MYCTU DNA-directed RNA polymerase subunit beta' OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpoC PE=1 SV=1 1064 1113 2.0E-08
sp|A5U053|RPOC_MYCTA DNA-directed RNA polymerase subunit beta' OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpoC PE=3 SV=1 1064 1113 2.0E-08
sp|P0A675|RPOC_MYCBO DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpoC PE=3 SV=1 1064 1113 2.0E-08
sp|B2HSJ4|RPOC_MYCMM DNA-directed RNA polymerase subunit beta' OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpoC PE=3 SV=1 1064 1113 2.0E-08
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 1298 1416 3.0E-08
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 1062 1138 3.0E-08
sp|A4T1P3|RPOC_MYCGI DNA-directed RNA polymerase subunit beta' OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpoC PE=3 SV=1 1064 1113 5.0E-08
sp|A1T4J3|RPOC_MYCVP DNA-directed RNA polymerase subunit beta' OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rpoC PE=3 SV=1 1064 1113 5.0E-08
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 15 159 7.0E-08
sp|P47716|RPOC_MYCGA DNA-directed RNA polymerase subunit beta' OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpoC PE=3 SV=2 1064 1113 7.0E-08
sp|B1MH61|RPOC_MYCA9 DNA-directed RNA polymerase subunit beta' OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=rpoC PE=3 SV=1 1064 1113 2.0E-07
sp|B2G8Y5|RPOC_LACRJ DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain JCM 1112) GN=rpoC PE=3 SV=1 689 919 2.0E-07
sp|A5VLL3|RPOC_LACRD DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoC PE=3 SV=1 689 919 2.0E-07
sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoC PE=3 SV=1 689 897 2.0E-07
sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoC PE=3 SV=1 689 897 2.0E-07
sp|B2RL44|RPOC_PORG3 DNA-directed RNA polymerase subunit beta' OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpoC PE=3 SV=1 983 1251 7.0E-07
sp|P28363|RPA1_EUPOC DNA-directed RNA polymerase I subunit RPA1 (Fragment) OS=Euplotes octocarinatus GN=RPA1 PE=3 SV=1 15 119 9.0E-07
sp|B1I1M9|RPOC_DESAP DNA-directed RNA polymerase subunit beta' OS=Desulforudis audaxviator (strain MP104C) GN=rpoC PE=3 SV=1 678 891 9.0E-07
sp|Q7MX26|RPOC_PORGI DNA-directed RNA polymerase subunit beta' OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpoC PE=3 SV=1 983 1251 1.0E-06
sp|B6YPZ6|RPOC_AZOPC DNA-directed RNA polymerase subunit beta' OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpoC PE=3 SV=1 1001 1222 2.0E-06
sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta' OS=Nitratiruptor sp. (strain SB155-2) GN=rpoC PE=3 SV=1 1064 1099 3.0E-06
sp|A6KYK2|RPOC_BACV8 DNA-directed RNA polymerase subunit beta' OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpoC PE=3 SV=1 1064 1097 4.0E-06
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 22 134 7.0E-06
sp|Q8RHI7|RPOC_FUSNN DNA-directed RNA polymerase subunit beta' OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpoC PE=3 SV=1 1067 1170 7.0E-06
sp|Q0BYA8|RPOC_HYPNA DNA-directed RNA polymerase subunit beta' OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpoC PE=3 SV=1 1008 1099 7.0E-06
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 1295 1410 9.0E-06
sp|Q8A470|RPOC_BACTN DNA-directed RNA polymerase subunit beta' OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpoC PE=3 SV=1 1064 1150 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0097747 RNA polymerase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|172
MATAESVKQQIVDKLPKRFRGIKFGIQSNQDIANQAVLEVCDRLLYDIEKNRAPYRHGPLDPRLGTSSKIGRCAT
CQDALKDCIGHFGHVRLPLPAFHIGYLRFVMSILQDICKDCGRVLLEEPDRRAFLKELRRPFLDNLRRTQICKRI
NEKCRKAKTCPYCGSVNGQIRKVGVLKLAHDKFVTYNKSTAIKKVPPEGKIRFDNSFATAKSENPELEKHLRKAM
EDLNPLRVLNLFKMISPSDCELLGLDPAEGRPEMFIWQFVPAPPVCIRPSVAQDNASNEDDITTKLADIVWVSGM
IRSALQKGSPIQTIMEQWEYLQTQIAMYVNSDVPGLQQPGFGKPSRGFCQRLKGKQGRFRGNLSGKRVDFSGRTV
ISPDPNLGIDQVAVPELVAKNLTYPERVNRQNIEKLRQCVINGCGVWPGAQSVMKRDGDTHDKFNLRFGDRERIA
RDLRIGDIVERHLEDGDVVLFNRQPSLHKLSIMSHLVKVRPWRTFRLNECVCNPYNADFDGDEMNLHVPQTEEAR
AEAINLMGVKYNLATPKNGEPIIAATQDFITAAFLLSSKDRFFDRKTFTFICMHMMDGRTPLDLPPPAIIAPRCL
WTGKQVFSVLMRPNKKSPVKVNLDAKCRAYKARPGQCPDMDPNDGWLVVRNSEVMCGRMDKSTVGSGKKDSIFYV
IMRDFGPDEAVVAMNRLAKLCARQLTNRGFSIGVGDVFPTQSLNAEKESLVSIAYKQCDDLIETFKQGKLDKAPG
CNMEQTLENLISGILSKVRQQAGTYCIDTLSRNNAPLIMAKSGSKGSDINVAQMVAVVGQQIIGGQRVPDGFQDR
SLPHFHKNARQPPSKGFVKNSFYSGLFPTEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSTQYDDTVR
TSGGGIVQFQFGADKLDPVDMEGSAEPVHFQRTWTHAENLTWDNEEAAMAPGEIRAFCDAMLAVERKRFPRRGLL
HGEELAYDDGSDYAIDEHESARRFLTTIERHVDGLASKLERVLGLAGVEAGATVPAAAQAHADRTAKVTATTLRL
FIKMCLEKYKKAHVEPGHAVGAVGAQSIGEPGTQMTLKTFHFAGVAGMSITQGVPRIKEIIDASKSISTPVITCP
LLNNEQIEAAKVVKGRIEKTYISDVLHFIEDEWRAEEGNVVLQIDKDALSDMHLGIGVHDIAEAICRQRKLKLQR
DDLSIYGDRIVVRVRDASEMPAKRTTRSKGGADDGGDMLLRANFLRRGLPMVPISGYAEATRAIIQTSEQNTHTV
LVEGYGLRECMTTEGVIGTRARSNHVLECQAILGIEAARTTIANEIGEVMGDMGIDPRHMQLLADVMTYKGEVLG
ITRFGLSKMRDSVLQLASFEKTPDHLFDAAAGMKTDQIEGVSECIIMGQTMRVGTGAFHLVRRMGIRPHDLRPKP
TLFEDAWAAELALKRAARRAAARPDRA*
Coding >Hirsu2|172
ATGGCGACCGCCGAATCCGTCAAGCAGCAGATCGTCGACAAGCTGCCAAAGCGCTTCAGGGGCATCAAGTTTGGC
ATCCAGTCCAACCAAGATATCGCCAATCAGGCCGTTCTCGAAGTCTGCGATCGACTGCTCTACGACATCGAGAAG
AACCGTGCCCCCTACCGCCACGGACCTCTTGATCCTCGCCTTGGTACGTCGAGCAAGATTGGCCGATGCGCCACC
TGCCAGGATGCTCTCAAGGACTGCATCGGCCACTTTGGCCATGTCAGGCTTCCCCTGCCGGCCTTCCACATCGGC
TACCTGCGATTCGTCATGTCCATCCTACAAGATATCTGCAAGGATTGTGGCCGCGTCTTGCTCGAGGAGCCCGAC
CGGAGAGCCTTCTTGAAGGAGCTGAGACGCCCGTTCCTCGACAACCTCCGCCGAACCCAAATCTGCAAGCGCATC
AACGAGAAGTGTCGCAAAGCCAAGACCTGCCCCTACTGCGGCTCCGTCAATGGCCAGATTCGCAAGGTCGGCGTC
CTCAAGCTCGCCCACGACAAGTTCGTCACCTACAATAAGTCGACCGCCATCAAAAAGGTGCCGCCCGAGGGCAAG
ATCCGCTTCGACAACTCCTTCGCCACAGCCAAGAGCGAGAACCCCGAGCTGGAGAAGCACCTCCGCAAGGCCATG
GAGGACCTCAACCCGCTGCGAGTCCTCAACCTCTTCAAGATGATCAGCCCCTCGGACTGCGAGCTGCTCGGCCTC
GATCCCGCCGAGGGCCGCCCCGAGATGTTCATCTGGCAGTTCGTGCCGGCGCCCCCCGTCTGCATCCGACCCTCG
GTCGCCCAGGATAATGCCAGCAACGAGGACGACATCACCACCAAGCTCGCCGACATCGTCTGGGTCAGCGGCATG
ATCCGCTCCGCCCTGCAAAAGGGCTCCCCGATCCAGACCATCATGGAGCAGTGGGAGTATCTCCAGACCCAGATC
GCCATGTACGTCAACAGCGACGTCCCCGGCCTGCAGCAGCCAGGCTTCGGCAAGCCTTCGCGAGGCTTCTGCCAG
CGCCTCAAGGGGAAGCAGGGCCGCTTCCGTGGCAACCTGTCCGGCAAGCGAGTCGACTTCTCCGGCCGCACCGTC
ATCTCCCCCGATCCCAACCTGGGCATCGACCAAGTCGCCGTCCCCGAGCTCGTCGCCAAGAACCTCACCTACCCC
GAGCGTGTCAATCGCCAAAACATCGAGAAACTCCGCCAGTGCGTCATCAACGGCTGCGGCGTCTGGCCCGGCGCC
CAGAGCGTCATGAAGAGGGACGGCGACACCCACGACAAGTTCAACCTGAGATTCGGCGACAGGGAGCGCATCGCA
CGAGATCTGAGGATCGGCGACATCGTCGAGCGCCATCTCGAGGACGGCGACGTCGTCCTCTTCAACCGCCAGCCC
TCCCTCCACAAGCTCAGCATCATGAGCCACCTCGTCAAGGTCCGCCCGTGGAGGACGTTTCGACTCAACGAGTGC
GTCTGCAACCCCTACAATGCCGACTTCGACGGCGATGAGATGAACCTCCACGTCCCCCAGACCGAGGAGGCCAGG
GCCGAGGCCATCAACCTGATGGGCGTCAAGTACAACCTCGCGACGCCCAAGAACGGGGAGCCCATCATTGCCGCG
ACGCAGGACTTCATCACGGCGGCCTTCCTGCTCAGCAGCAAGGACCGCTTCTTCGACCGCAAGACCTTCACCTTC
ATCTGCATGCACATGATGGACGGCAGGACGCCGCTCGACCTGCCGCCGCCCGCCATCATCGCCCCCCGCTGCCTG
TGGACGGGCAAGCAGGTCTTCAGCGTGCTGATGCGCCCCAACAAGAAGTCGCCCGTCAAGGTCAACCTCGACGCC
AAGTGCCGAGCGTACAAGGCGCGCCCGGGCCAGTGTCCCGACATGGACCCCAACGACGGCTGGCTCGTGGTCCGA
AACTCGGAGGTCATGTGCGGCCGCATGGACAAGTCGACCGTCGGGTCCGGCAAGAAGGACTCCATCTTCTACGTC
ATCATGCGCGACTTCGGACCGGACGAGGCCGTCGTCGCCATGAACCGGCTGGCCAAGCTGTGCGCCAGGCAGCTC
ACCAACAGGGGCTTCTCCATAGGCGTAGGCGACGTGTTCCCGACGCAGTCGCTCAACGCGGAAAAGGAGAGCCTC
GTCTCCATCGCCTACAAGCAGTGCGACGATCTCATCGAGACGTTCAAGCAGGGCAAGCTCGACAAGGCCCCCGGC
TGCAACATGGAGCAGACGCTGGAGAACCTCATCTCCGGCATCCTCAGCAAGGTCCGGCAGCAGGCCGGCACCTAC
TGCATCGACACGCTGAGCCGCAACAACGCGCCCCTCATCATGGCCAAGTCCGGGTCCAAGGGCTCGGACATCAAC
GTCGCCCAGATGGTGGCCGTCGTCGGACAGCAGATCATCGGCGGGCAGCGAGTCCCCGATGGCTTCCAGGACCGC
AGTCTGCCGCACTTCCACAAGAATGCCCGCCAGCCTCCCTCCAAGGGCTTCGTCAAGAACAGCTTCTACTCCGGC
CTCTTCCCCACCGAGTTCCTCTTCCACGCCATCTCCGGCCGCGAGGGTCTGGTCGATACGGCCGTCAAGACGGCA
GAGACGGGCTACATGTCGCGAAGGCTGATGAAGTCGCTCGAGGACCTGTCGACGCAGTACGACGATACGGTCCGG
ACGTCGGGCGGCGGCATCGTGCAGTTCCAGTTCGGCGCGGACAAGCTGGACCCCGTCGACATGGAGGGCTCCGCC
GAGCCGGTCCATTTCCAGCGGACCTGGACCCACGCCGAGAACCTGACGTGGGACAACGAAGAGGCGGCCATGGCG
CCGGGCGAGATCAGGGCGTTTTGCGACGCGATGCTTGCGGTGGAGCGCAAGCGGTTCCCGCGCCGAGGCCTGCTC
CACGGCGAGGAGCTGGCGTACGACGACGGGAGCGACTACGCCATCGACGAGCACGAGAGCGCGCGCCGATTCCTG
ACGACGATCGAGCGCCACGTCGACGGCCTGGCCTCGAAGCTGGAGCGGGTGCTGGGGCTGGCCGGCGTCGAGGCC
GGCGCGACGGTGCCGGCGGCGGCGCAGGCCCACGCCGACCGGACGGCCAAGGTGACGGCGACGACGCTGCGGCTG
TTCATCAAGATGTGCCTGGAGAAGTACAAGAAGGCGCACGTGGAGCCGGGGCACGCGGTCGGGGCCGTGGGCGCG
CAGTCGATCGGCGAGCCCGGCACGCAGATGACGCTCAAGACGTTCCACTTCGCCGGCGTCGCAGGCATGAGCATC
ACGCAGGGCGTGCCGCGAATCAAGGAGATCATCGACGCGTCCAAGTCGATCAGCACGCCCGTCATCACCTGCCCG
CTGCTGAACAACGAGCAGATCGAGGCGGCCAAGGTGGTCAAGGGGCGGATCGAGAAGACGTACATCTCGGACGTG
CTGCACTTCATCGAGGACGAGTGGCGGGCCGAGGAGGGCAACGTGGTGCTGCAGATCGACAAGGACGCGCTGTCG
GACATGCACCTGGGCATCGGCGTGCACGACATCGCCGAGGCCATCTGCAGGCAGCGCAAGCTGAAGCTGCAGCGC
GACGACCTGTCCATATACGGCGATAGGATCGTGGTGCGGGTGCGCGACGCCAGCGAGATGCCGGCGAAGCGGACG
ACGCGCAGCAAGGGCGGGGCCGACGACGGCGGCGACATGCTGCTGCGGGCCAACTTCCTCCGGCGCGGGCTGCCG
ATGGTGCCCATCTCGGGGTACGCCGAGGCGACGCGGGCCATCATCCAGACGTCGGAGCAGAACACGCACACGGTG
CTGGTCGAGGGCTACGGGCTGCGGGAGTGCATGACGACGGAGGGCGTCATCGGGACCCGGGCGCGCTCCAACCAC
GTGCTCGAGTGCCAGGCGATCCTGGGCATCGAGGCGGCGCGGACGACCATCGCCAACGAGATCGGCGAGGTCATG
GGCGACATGGGCATCGACCCGCGGCACATGCAGCTGCTGGCCGACGTCATGACGTACAAGGGCGAGGTGCTGGGC
ATCACGCGCTTCGGCCTGTCCAAGATGCGCGACAGCGTGCTGCAGCTGGCCTCGTTCGAGAAGACGCCCGACCAC
CTGTTCGACGCCGCGGCCGGCATGAAGACGGACCAGATCGAGGGCGTCAGCGAGTGCATCATCATGGGCCAGACG
ATGCGCGTCGGCACCGGCGCCTTCCACCTCGTCCGCCGCATGGGCATCCGGCCCCACGACCTGCGGCCCAAGCCG
ACCCTCTTCGAGGACGCCTGGGCCGCCGAGCTGGCCCTCAAGCGGGCCGCGCGCCGGGCCGCCGCCAGGCCGGAC
CGCGCCTGA
Transcript >Hirsu2|172
ATGGCGACCGCCGAATCCGTCAAGCAGCAGATCGTCGACAAGCTGCCAAAGCGCTTCAGGGGCATCAAGTTTGGC
ATCCAGTCCAACCAAGATATCGCCAATCAGGCCGTTCTCGAAGTCTGCGATCGACTGCTCTACGACATCGAGAAG
AACCGTGCCCCCTACCGCCACGGACCTCTTGATCCTCGCCTTGGTACGTCGAGCAAGATTGGCCGATGCGCCACC
TGCCAGGATGCTCTCAAGGACTGCATCGGCCACTTTGGCCATGTCAGGCTTCCCCTGCCGGCCTTCCACATCGGC
TACCTGCGATTCGTCATGTCCATCCTACAAGATATCTGCAAGGATTGTGGCCGCGTCTTGCTCGAGGAGCCCGAC
CGGAGAGCCTTCTTGAAGGAGCTGAGACGCCCGTTCCTCGACAACCTCCGCCGAACCCAAATCTGCAAGCGCATC
AACGAGAAGTGTCGCAAAGCCAAGACCTGCCCCTACTGCGGCTCCGTCAATGGCCAGATTCGCAAGGTCGGCGTC
CTCAAGCTCGCCCACGACAAGTTCGTCACCTACAATAAGTCGACCGCCATCAAAAAGGTGCCGCCCGAGGGCAAG
ATCCGCTTCGACAACTCCTTCGCCACAGCCAAGAGCGAGAACCCCGAGCTGGAGAAGCACCTCCGCAAGGCCATG
GAGGACCTCAACCCGCTGCGAGTCCTCAACCTCTTCAAGATGATCAGCCCCTCGGACTGCGAGCTGCTCGGCCTC
GATCCCGCCGAGGGCCGCCCCGAGATGTTCATCTGGCAGTTCGTGCCGGCGCCCCCCGTCTGCATCCGACCCTCG
GTCGCCCAGGATAATGCCAGCAACGAGGACGACATCACCACCAAGCTCGCCGACATCGTCTGGGTCAGCGGCATG
ATCCGCTCCGCCCTGCAAAAGGGCTCCCCGATCCAGACCATCATGGAGCAGTGGGAGTATCTCCAGACCCAGATC
GCCATGTACGTCAACAGCGACGTCCCCGGCCTGCAGCAGCCAGGCTTCGGCAAGCCTTCGCGAGGCTTCTGCCAG
CGCCTCAAGGGGAAGCAGGGCCGCTTCCGTGGCAACCTGTCCGGCAAGCGAGTCGACTTCTCCGGCCGCACCGTC
ATCTCCCCCGATCCCAACCTGGGCATCGACCAAGTCGCCGTCCCCGAGCTCGTCGCCAAGAACCTCACCTACCCC
GAGCGTGTCAATCGCCAAAACATCGAGAAACTCCGCCAGTGCGTCATCAACGGCTGCGGCGTCTGGCCCGGCGCC
CAGAGCGTCATGAAGAGGGACGGCGACACCCACGACAAGTTCAACCTGAGATTCGGCGACAGGGAGCGCATCGCA
CGAGATCTGAGGATCGGCGACATCGTCGAGCGCCATCTCGAGGACGGCGACGTCGTCCTCTTCAACCGCCAGCCC
TCCCTCCACAAGCTCAGCATCATGAGCCACCTCGTCAAGGTCCGCCCGTGGAGGACGTTTCGACTCAACGAGTGC
GTCTGCAACCCCTACAATGCCGACTTCGACGGCGATGAGATGAACCTCCACGTCCCCCAGACCGAGGAGGCCAGG
GCCGAGGCCATCAACCTGATGGGCGTCAAGTACAACCTCGCGACGCCCAAGAACGGGGAGCCCATCATTGCCGCG
ACGCAGGACTTCATCACGGCGGCCTTCCTGCTCAGCAGCAAGGACCGCTTCTTCGACCGCAAGACCTTCACCTTC
ATCTGCATGCACATGATGGACGGCAGGACGCCGCTCGACCTGCCGCCGCCCGCCATCATCGCCCCCCGCTGCCTG
TGGACGGGCAAGCAGGTCTTCAGCGTGCTGATGCGCCCCAACAAGAAGTCGCCCGTCAAGGTCAACCTCGACGCC
AAGTGCCGAGCGTACAAGGCGCGCCCGGGCCAGTGTCCCGACATGGACCCCAACGACGGCTGGCTCGTGGTCCGA
AACTCGGAGGTCATGTGCGGCCGCATGGACAAGTCGACCGTCGGGTCCGGCAAGAAGGACTCCATCTTCTACGTC
ATCATGCGCGACTTCGGACCGGACGAGGCCGTCGTCGCCATGAACCGGCTGGCCAAGCTGTGCGCCAGGCAGCTC
ACCAACAGGGGCTTCTCCATAGGCGTAGGCGACGTGTTCCCGACGCAGTCGCTCAACGCGGAAAAGGAGAGCCTC
GTCTCCATCGCCTACAAGCAGTGCGACGATCTCATCGAGACGTTCAAGCAGGGCAAGCTCGACAAGGCCCCCGGC
TGCAACATGGAGCAGACGCTGGAGAACCTCATCTCCGGCATCCTCAGCAAGGTCCGGCAGCAGGCCGGCACCTAC
TGCATCGACACGCTGAGCCGCAACAACGCGCCCCTCATCATGGCCAAGTCCGGGTCCAAGGGCTCGGACATCAAC
GTCGCCCAGATGGTGGCCGTCGTCGGACAGCAGATCATCGGCGGGCAGCGAGTCCCCGATGGCTTCCAGGACCGC
AGTCTGCCGCACTTCCACAAGAATGCCCGCCAGCCTCCCTCCAAGGGCTTCGTCAAGAACAGCTTCTACTCCGGC
CTCTTCCCCACCGAGTTCCTCTTCCACGCCATCTCCGGCCGCGAGGGTCTGGTCGATACGGCCGTCAAGACGGCA
GAGACGGGCTACATGTCGCGAAGGCTGATGAAGTCGCTCGAGGACCTGTCGACGCAGTACGACGATACGGTCCGG
ACGTCGGGCGGCGGCATCGTGCAGTTCCAGTTCGGCGCGGACAAGCTGGACCCCGTCGACATGGAGGGCTCCGCC
GAGCCGGTCCATTTCCAGCGGACCTGGACCCACGCCGAGAACCTGACGTGGGACAACGAAGAGGCGGCCATGGCG
CCGGGCGAGATCAGGGCGTTTTGCGACGCGATGCTTGCGGTGGAGCGCAAGCGGTTCCCGCGCCGAGGCCTGCTC
CACGGCGAGGAGCTGGCGTACGACGACGGGAGCGACTACGCCATCGACGAGCACGAGAGCGCGCGCCGATTCCTG
ACGACGATCGAGCGCCACGTCGACGGCCTGGCCTCGAAGCTGGAGCGGGTGCTGGGGCTGGCCGGCGTCGAGGCC
GGCGCGACGGTGCCGGCGGCGGCGCAGGCCCACGCCGACCGGACGGCCAAGGTGACGGCGACGACGCTGCGGCTG
TTCATCAAGATGTGCCTGGAGAAGTACAAGAAGGCGCACGTGGAGCCGGGGCACGCGGTCGGGGCCGTGGGCGCG
CAGTCGATCGGCGAGCCCGGCACGCAGATGACGCTCAAGACGTTCCACTTCGCCGGCGTCGCAGGCATGAGCATC
ACGCAGGGCGTGCCGCGAATCAAGGAGATCATCGACGCGTCCAAGTCGATCAGCACGCCCGTCATCACCTGCCCG
CTGCTGAACAACGAGCAGATCGAGGCGGCCAAGGTGGTCAAGGGGCGGATCGAGAAGACGTACATCTCGGACGTG
CTGCACTTCATCGAGGACGAGTGGCGGGCCGAGGAGGGCAACGTGGTGCTGCAGATCGACAAGGACGCGCTGTCG
GACATGCACCTGGGCATCGGCGTGCACGACATCGCCGAGGCCATCTGCAGGCAGCGCAAGCTGAAGCTGCAGCGC
GACGACCTGTCCATATACGGCGATAGGATCGTGGTGCGGGTGCGCGACGCCAGCGAGATGCCGGCGAAGCGGACG
ACGCGCAGCAAGGGCGGGGCCGACGACGGCGGCGACATGCTGCTGCGGGCCAACTTCCTCCGGCGCGGGCTGCCG
ATGGTGCCCATCTCGGGGTACGCCGAGGCGACGCGGGCCATCATCCAGACGTCGGAGCAGAACACGCACACGGTG
CTGGTCGAGGGCTACGGGCTGCGGGAGTGCATGACGACGGAGGGCGTCATCGGGACCCGGGCGCGCTCCAACCAC
GTGCTCGAGTGCCAGGCGATCCTGGGCATCGAGGCGGCGCGGACGACCATCGCCAACGAGATCGGCGAGGTCATG
GGCGACATGGGCATCGACCCGCGGCACATGCAGCTGCTGGCCGACGTCATGACGTACAAGGGCGAGGTGCTGGGC
ATCACGCGCTTCGGCCTGTCCAAGATGCGCGACAGCGTGCTGCAGCTGGCCTCGTTCGAGAAGACGCCCGACCAC
CTGTTCGACGCCGCGGCCGGCATGAAGACGGACCAGATCGAGGGCGTCAGCGAGTGCATCATCATGGGCCAGACG
ATGCGCGTCGGCACCGGCGCCTTCCACCTCGTCCGCCGCATGGGCATCCGGCCCCACGACCTGCGGCCCAAGCCG
ACCCTCTTCGAGGACGCCTGGGCCGCCGAGCTGGCCCTCAAGCGGGCCGCGCGCCGGGCCGCCGCCAGGCCGGAC
CGCGCCTGA
Gene >Hirsu2|172
ATGGCGACCGCCGAATCCGTCAAGCAGCAGATCGTCGACAAGCTGCCAAAGCGCTTCAGGGGCATCAAGTTTGGC
ATCCAGTCCGTGTCCCCGCCGCCTCGCCTTTCCCACCTCATCAGACCCTGCCTTCAGCCCTACTGACTTCTATTC
CCCCCCCTCGGCGCCAGGTCCAACCAAGATATCGCCAATCAGGCCGTTCTCGAAGTCTGCGATCGACTGCTCTAC
GACATCGAGAAGAACCGTGCCCCCTACCGCCACGGACCTCTTGATCCTCGCCTTGTCAGCCCTCTCTTCCTCTTC
CTCGGCCGCCGCTTCGGCCTGCTGACTGCTCGCCTCTCTTGCAGGGTACGTCGAGCAAGATTGGCCGATGCGCCA
CCTGCCAGGATGCTCTCAAGGACTGCATCGGCCACTTTGGCCATGTCAGGCTTCCCCTGCCGGCCTTCCACATCG
GCTACCTGCGATTCGTCATGTCCATCCTACAAGATATCTGCAAGGTAGGCAGAGGCACGCACTCTTGCACCTCCG
CCGGCTCCCAGCCCCCCAGATCCTGCCCACTGACGCGGCCGTCGCTCAGGATTGTGGCCGCGTCTTGCTCGAGGA
GCCCGACCGGAGAGCCTTCTTGAAGGAGCTGAGACGCCCGTTCCTCGACAACCTCCGCCGAACCCAAATCTGCAA
GCGCATCAACGAGAAGTGTCGCAAAGCCAAGACCTGCCCCTACTGCGGCTCCGTCAATGGCCAGATTCGCAAGGT
CGGCGTCCTCAAGCTCGCCCACGACAAGTTCGTCACCTACAATAAGTCGACCGCCATCAAAAAGGTGCCGCCCGA
GGGCAAGATCCGCTTCGACAACTCCTTCGCCACAGCCAAGAGCGAGAACCCCGAGCTGGAGAAGCACCTCCGCAA
GGCCATGGAGGACCTCAACCCGCTGCGAGTCCTCAACCTCTTCAAGATGATCAGCCCCTCGGACTGCGAGCTGCT
CGGCCTCGATCCCGCCGAGGGCCGCCCCGAGATGTTCATCTGGCAGTTCGTGCCGGCGCCCCCCGTCTGCATCCG
ACCCTCGGTCGCCCAGGATAATGCCAGCAACGAGGACGACATCACCACCAAGCTCGCCGACATCGTCTGGGTCAG
CGGCATGATCCGCTCCGCCCTGCAAAAGGGCTCCCCGATCCAGACCATCATGGAGCAGTGGGAGTATCTCCAGAC
CCAGATCGCCATGTACGTCAACAGCGACGTCCCCGGCCTGCAGCAGCCAGGCTTCGGCAAGCCTTCGCGAGGCTT
CTGCCAGCGCCTCAAGGGGAAGCAGGGCCGCTTCCGTGGCAACCTGTCCGGCAAGCGAGTCGACTTCTCCGGCCG
CACCGTCATCTCCCCCGATCCCAACCTGGGCATCGACCAAGTCGCCGTCCCCGAGCTCGTCGCCAAGAACCTCAC
CTACCCCGAGCGTGTCAATCGCCAAAACATCGAGAAACTCCGCCAGTGCGTCATCAACGGCTGCGGCGTCTGGCC
CGGCGCCCAGAGCGTCATGAAGAGGGACGGCGACACCCACGACAAGTTCAACCTGAGATTCGGCGACAGGGAGCG
CATCGCACGAGATCTGAGGATCGGCGACATCGTCGAGCGCCATCTCGAGGACGGCGACGTCGTCCTCTTCAACCG
CCAGCCCTCCCTCCACAAGCTCAGCATCATGAGCCACCTCGTCAAGGTCCGCCCGTGGAGGACGTTTCGACTCAA
CGAGTGCGTCTGCAACCCCTACAATGCCGACTTCGACGGCGATGAGATGAACCTCCACGTCCCCCAGACCGAGGA
GGCCAGGGCCGAGGCCATCAACCTGATGGGCGTCAAGTACAACCTCGCGACGCCCAAGAACGGGGAGCCCATCAT
TGCCGCGACGCAGGACTTCATCACGGCGGCCTTCCTGCTCAGCAGCAAGGACCGCTTCTTCGACCGCAAGACCTT
CACCTTCATCTGCATGCACATGATGGACGGCAGGACGCCGCTCGACCTGCCGCCGCCCGCCATCATCGCCCCCCG
CTGCCTGTGGACGGGCAAGCAGGTCTTCAGCGTGCTGATGCGCCCCAACAAGAAGTCGCCCGTCAAGGTCAACCT
CGACGCCAAGTGCCGAGCGTACAAGGCGCGCCCGGGCCAGTGTCCCGACATGGACCCCAACGACGGCTGGCTCGT
GGTCCGAAACTCGGAGGTCATGTGCGGCCGCATGGACAAGTCGACCGTCGGGTCCGGCAAGAAGGACTCCATCTT
CTACGTCATCATGCGCGACTTCGGACCGGACGAGGCCGTCGTCGCCATGAACCGGCTGGCCAAGCTGTGCGCCAG
GCAGCTCACCAACAGGGGCTTCTCCATAGGCGTAGGCGACGTGTTCCCGACGCAGTCGCTCAACGCGGAAAAGGA
GAGCCTCGTCTCCATCGCCTACAAGCAGTGCGACGATCTCATCGAGACGTTCAAGCAGGGCAAGCTCGACAAGGC
CCCCGGCTGCAACATGGAGCAGACGCTGGAGAACCTCATCTCCGGCATCCTCAGCAAGGTCCGGCAGCAGGCCGG
CACCTACTGCATCGACACGCTGAGCCGCAACAACGCGCCCCTCATCATGGCCAAGTCCGGGTCCAAGGGCTCGGA
CATCAACGTCGCCCAGATGGTGGCCGTCGTCGGACAGCAGATCATCGGCGGGCAGCGAGTCCCCGATGGCTTCCA
GGACCGCAGTCTGCCGCACTTCCACAAGAATGCCCGCCAGCCTCCCTCCAAGGGCTTCGTCAAGAACAGCTTCTA
CTCCGGCCTCTTCCCCACCGAGTTCCTCTTCCACGCCATCTCCGGCCGCGAGGGTCTGGTCGATACGGCCGTCAA
GACGGCAGAGACGGGCTACATGTCGCGAAGGCTGATGAAGTCGCTCGAGGACCTGTCGACGCAGTACGACGATAC
GGTCCGGACGTCGGGCGGCGGCATCGTGCAGTTCCAGTTCGGCGCGGACAAGCTGGACCCCGTCGACATGGAGGG
CTCCGCCGAGCCGGTCCATTTCCAGCGGACCTGGACCCACGCCGAGAACCTGACGTGGGACAACGAAGAGGCGGC
CATGGCGCCGGGCGAGATCAGGGCGTTTTGCGACGCGATGCTTGCGGTGGAGCGCAAGCGGTTCCCGCGCCGAGG
CCTGCTCCACGGCGAGGAGCTGGCGTACGACGACGGGAGCGACTACGCCATCGACGAGCACGAGAGCGCGCGCCG
ATTCCTGACGACGATCGAGCGCCACGTCGACGGCCTGGCCTCGAAGCTGGAGCGGGTGCTGGGGCTGGCCGGCGT
CGAGGCCGGCGCGACGGTGCCGGCGGCGGCGCAGGCCCACGCCGACCGGACGGCCAAGGTGACGGCGACGACGCT
GCGGCTGTTCATCAAGATGTGCCTGGAGAAGTACAAGAAGGCGCACGTGGAGCCGGGGCACGCGGTCGGGGCCGT
GGGCGCGCAGTCGATCGGCGAGCCCGGCACGCAGATGACGCTCAAGACGTTCCACTTCGCCGGCGTCGCAGGCAT
GAGCATCACGCAGGGCGTGCCGCGAATCAAGGAGATCATCGACGCGTCCAAGTCGATCAGCACGCCCGTCATCAC
CTGCCCGCTGCTGAACAACGAGCAGATCGAGGCGGCCAAGGTGGTCAAGGGGCGGATCGAGAAGACGTACATCTC
GGACGTGCTGCACTTCATCGAGGACGAGTGGCGGGCCGAGGAGGGCAACGTGGTGCTGCAGATCGACAAGGACGC
GCTGTCGGACATGCACCTGGGCATCGGCGTGCACGACATCGCCGAGGCCATCTGCAGGCAGCGCAAGCTGAAGCT
GCAGCGCGACGACCTGTCCATATACGGCGATAGGATCGTGGTGCGGGTGCGCGACGCCAGCGAGATGCCGGCGAA
GCGGACGACGCGCAGCAAGGGCGGGGCCGACGACGGCGGCGACATGCTGCTGCGGGCCAACTTCCTCCGGCGCGG
GCTGCCGATGGTGCCCATCTCGGGGTACGCCGAGGCGACGCGGGCCATCATCCAGACGTCGGAGCAGAACACGCA
CACGGTGCTGGTCGAGGGCTACGGGCTGCGGGAGTGCATGACGACGGAGGGCGTCATCGGGACCCGGGCGCGCTC
CAACCACGTGCTCGAGTGCCAGGCGATCCTGGGCATCGAGGCGGCGCGGACGACCATCGCCAACGAGATCGGCGA
GGTCATGGGCGACATGGGCATCGACCCGCGGCACATGCAGCTGCTGGCCGACGTCATGACGTACAAGGGCGAGGT
GCTGGGCATCACGCGCTTCGGCCTGTCCAAGATGCGCGACAGCGTGCTGCAGCTGGCCTCGTTCGAGAAGACGCC
CGACCACCTGTTCGACGCCGCGGCCGGCATGAAGACGGACCAGATCGAGGGCGTCAGCGAGTGCATCATCATGGG
CCAGACGATGCGCGTCGGCACCGGCGCCTTCCACCTCGTCCGCCGCATGGGCATCCGGCCCCACGACCTGCGGCC
CAAGCCGACCCTCTTCGAGGACGCCTGGGCCGCCGAGCTGGCCCTCAAGCGGGCCGCGCGCCGGGCCGCCGCCAG
GCCGGACCGCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail