Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1717
Gene name
LocationContig_139:5509..6191
Strand-
Gene length (bp)682
Transcript length (bp)366
Coding sequence length (bp)366
Protein length (aa) 122

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13616 Rotamase_3 PPIC-type PPIASE domain 1.7E-16 22 120
PF00639 Rotamase PPIC-type PPIASE domain 5.3E-15 41 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I665|PIN4_GIBZE Peptidyl-prolyl cis-trans isomerase PIN4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PIN4 PE=3 SV=2 22 121 5.0E-61
sp|Q5B5W1|PIN4_EMENI Peptidyl-prolyl cis-trans isomerase pin4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pin4 PE=3 SV=1 1 121 3.0E-55
sp|Q7RYY4|PIN4_NEUCR Peptidyl-prolyl cis-trans isomerase pin4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ppi-5 PE=3 SV=1 11 121 2.0E-53
sp|Q4WJM6|PIN4_ASPFU Peptidyl-prolyl cis-trans isomerase pin4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pin4 PE=3 SV=1 27 121 5.0E-46
sp|Q6P4K8|PIN4_XENTR Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Xenopus tropicalis GN=pin4 PE=2 SV=1 19 121 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I665|PIN4_GIBZE Peptidyl-prolyl cis-trans isomerase PIN4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PIN4 PE=3 SV=2 22 121 5.0E-61
sp|Q5B5W1|PIN4_EMENI Peptidyl-prolyl cis-trans isomerase pin4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pin4 PE=3 SV=1 1 121 3.0E-55
sp|Q7RYY4|PIN4_NEUCR Peptidyl-prolyl cis-trans isomerase pin4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ppi-5 PE=3 SV=1 11 121 2.0E-53
sp|Q4WJM6|PIN4_ASPFU Peptidyl-prolyl cis-trans isomerase pin4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pin4 PE=3 SV=1 27 121 5.0E-46
sp|Q6P4K8|PIN4_XENTR Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Xenopus tropicalis GN=pin4 PE=2 SV=1 19 121 3.0E-34
sp|A6QPY8|PIN4_BOVIN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Bos taurus GN=PIN4 PE=2 SV=1 19 121 1.0E-32
sp|Q9CWW6|PIN4_MOUSE Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Mus musculus GN=Pin4 PE=1 SV=1 19 121 2.0E-32
sp|Q9Y237|PIN4_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Homo sapiens GN=PIN4 PE=1 SV=1 19 121 3.0E-32
sp|Q503Y7|PIN4_DANRE Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Danio rerio GN=pin4 PE=2 SV=1 25 121 7.0E-32
sp|B5KFL3|PIN4_TAEGU Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Taeniopygia guttata GN=PIN4 PE=2 SV=1 22 121 1.0E-31
sp|Q9KDN4|PRSA_BACHD Foldase protein PrsA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prsA PE=3 SV=1 30 121 5.0E-13
sp|Q3SGF9|SURA_THIDA Chaperone SurA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=surA PE=3 SV=1 31 121 2.0E-11
sp|A4IKU2|PRSA_GEOTN Foldase protein PrsA OS=Geobacillus thermodenitrificans (strain NG80-2) GN=prsA PE=3 SV=1 30 117 3.0E-11
sp|Q5L289|PRSA_GEOKA Foldase protein PrsA OS=Geobacillus kaustophilus (strain HTA426) GN=prsA PE=3 SV=1 30 117 3.0E-11
sp|P24327|PRSA_BACSU Foldase protein PrsA OS=Bacillus subtilis (strain 168) GN=prsA PE=1 SV=1 30 115 5.0E-11
sp|Q8CXK4|PRSA_OCEIH Foldase protein PrsA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=prsA PE=3 SV=1 30 117 6.0E-11
sp|Q1LRA3|SURA_CUPMC Chaperone SurA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=surA PE=3 SV=1 13 121 6.0E-11
sp|Q929F4|PRSA2_LISIN Foldase protein PrsA 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prsA2 PE=3 SV=1 30 118 7.0E-11
sp|Q71XE6|PRSA2_LISMF Foldase protein PrsA 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prsA2 PE=3 SV=1 30 118 1.0E-10
sp|Q92H91|PLP_RICCN Parvulin-like PPIase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=plp PE=3 SV=1 19 121 2.0E-10
sp|Q68WG0|PLP_RICTY Parvulin-like PPIase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=plp PE=3 SV=2 25 121 2.0E-10
sp|Q9ZCX6|PLP_RICPR Parvulin-like PPIase OS=Rickettsia prowazekii (strain Madrid E) GN=plp PE=3 SV=1 25 121 2.0E-10
sp|C5D6L9|PRSA_GEOSW Foldase protein PrsA OS=Geobacillus sp. (strain WCH70) GN=prsA PE=3 SV=1 30 117 2.0E-10
sp|Q3JAF1|SURA_NITOC Chaperone SurA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=surA PE=3 SV=1 22 121 3.0E-10
sp|Q8Y557|PRSA2_LISMO Foldase protein PrsA 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prsA2 PE=3 SV=1 30 118 3.0E-10
sp|Q8Y759|PRSA1_LISMO Foldase protein PrsA 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prsA1 PE=3 SV=1 30 117 4.0E-10
sp|Q71ZM6|PRSA1_LISMF Foldase protein PrsA 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prsA1 PE=3 SV=1 30 117 4.0E-10
sp|Q4UKY0|PLP_RICFE Parvulin-like PPIase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=plp PE=3 SV=1 19 121 5.0E-10
sp|Q1GZC0|SURA_METFK Chaperone SurA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=surA PE=3 SV=1 31 121 5.0E-10
sp|Q60B78|SURA_METCA Chaperone SurA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=surA PE=3 SV=1 21 121 8.0E-10
sp|Q7NQB0|SURA_CHRVO Chaperone SurA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=surA PE=3 SV=1 19 121 1.0E-09
sp|Q81GY5|PRSA1_BACCR Foldase protein PrsA 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prsA1 PE=3 SV=1 30 117 1.0E-09
sp|Q2YBP3|SURA_NITMU Chaperone SurA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=surA PE=3 SV=1 31 121 1.0E-09
sp|Q92BR2|PRSA1_LISIN Foldase protein PrsA 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prsA1 PE=3 SV=1 29 117 3.0E-09
sp|Q8R760|PRSA_CALS4 Foldase protein PrsA OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=prsA PE=3 SV=1 33 119 3.0E-09
sp|Q2T116|SURA_BURTA Chaperone SurA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=surA PE=3 SV=1 31 121 3.0E-09
sp|Q81U45|PRSA1_BACAN Foldase protein PrsA 1 OS=Bacillus anthracis GN=prsA1 PE=1 SV=1 30 117 4.0E-09
sp|Q1RI35|PLP_RICBR Parvulin-like PPIase OS=Rickettsia bellii (strain RML369-C) GN=plp PE=3 SV=1 25 121 6.0E-09
sp|Q81GN0|PRSA2_BACCR Foldase protein PrsA 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prsA2 PE=3 SV=1 30 121 6.0E-09
sp|Q63X78|SURA_BURPS Chaperone SurA OS=Burkholderia pseudomallei (strain K96243) GN=surA PE=3 SV=2 31 121 7.0E-09
sp|Q3JVW8|SURA_BURP1 Chaperone SurA OS=Burkholderia pseudomallei (strain 1710b) GN=surA PE=3 SV=1 31 121 7.0E-09
sp|Q82W17|SURA_NITEU Chaperone SurA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=surA PE=3 SV=1 30 121 8.0E-09
sp|Q62MM4|SURA_BURMA Chaperone SurA OS=Burkholderia mallei (strain ATCC 23344) GN=surA PE=3 SV=1 31 121 1.0E-08
sp|Q7WG19|SURA_BORBR Chaperone SurA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=surA PE=3 SV=1 30 121 2.0E-08
sp|Q2S9C1|SURA_HAHCH Chaperone SurA OS=Hahella chejuensis (strain KCTC 2396) GN=surA PE=3 SV=1 6 121 2.0E-08
sp|Q7W4J5|SURA_BORPA Chaperone SurA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=surA PE=3 SV=1 30 121 2.0E-08
sp|Q5P7I9|SURA_AROAE Chaperone SurA OS=Aromatoleum aromaticum (strain EbN1) GN=surA PE=3 SV=2 19 121 2.0E-08
sp|Q7VU12|SURA_BORPE Chaperone SurA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=surA PE=3 SV=1 30 121 2.0E-08
sp|Q81TU1|PRSA2_BACAN Foldase protein PrsA 2 OS=Bacillus anthracis GN=prsA2 PE=1 SV=1 30 121 2.0E-08
sp|Q1QZ33|SURA_CHRSD Chaperone SurA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=surA PE=3 SV=1 32 121 3.0E-08
sp|Q8Y220|SURA_RALSO Chaperone SurA OS=Ralstonia solanacearum (strain GMI1000) GN=surA PE=3 SV=2 24 121 3.0E-08
sp|Q2KXA6|SURA_BORA1 Chaperone SurA OS=Bordetella avium (strain 197N) GN=surA PE=3 SV=1 31 121 4.0E-08
sp|Q475Q3|SURA_CUPPJ Chaperone SurA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=surA PE=3 SV=1 32 121 6.0E-08
sp|Q81CB1|PRSA4_BACCR Foldase protein PrsA 4 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prsA4 PE=3 SV=1 30 121 7.0E-08
sp|Q81QT1|PRSA3_BACAN Foldase protein PrsA 3 OS=Bacillus anthracis GN=prsA3 PE=1 SV=2 30 121 9.0E-08
sp|Q0PAS1|CBF2_CAMJE Putative peptidyl-prolyl cis-trans isomerase Cbf2 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cbf2 PE=1 SV=1 30 119 2.0E-07
sp|Q223E5|SURA_RHOFT Chaperone SurA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=surA PE=3 SV=1 33 121 2.0E-07
sp|A1VYV6|CBF2_CAMJJ Putative peptidyl-prolyl cis-trans isomerase Cbf2 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=cbf2 PE=3 SV=1 30 121 2.0E-07
sp|B1YK87|PRSA_EXIS2 Foldase protein PrsA OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=prsA PE=3 SV=1 30 121 2.0E-07
sp|Q81DT1|PRSA3_BACCR Foldase protein PrsA 3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prsA3 PE=3 SV=1 30 121 2.0E-07
sp|Q48NT5|SURA_PSE14 Chaperone SurA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=surA PE=3 SV=2 22 121 3.0E-07
sp|Q145L3|SURA_BURXL Chaperone SurA OS=Burkholderia xenovorans (strain LB400) GN=surA PE=3 SV=2 12 121 3.0E-07
sp|Q8EB95|SURA_SHEON Chaperone SurA OS=Shewanella oneidensis (strain MR-1) GN=surA PE=3 SV=1 23 121 4.0E-07
sp|Q121Q4|SURA_POLSJ Chaperone SurA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=surA PE=3 SV=1 31 121 4.0E-07
sp|Q1BTQ6|SURA_BURCA Chaperone SurA OS=Burkholderia cenocepacia (strain AU 1054) GN=surA PE=3 SV=1 12 121 5.0E-07
sp|Q0HS08|SURA_SHESR Chaperone SurA OS=Shewanella sp. (strain MR-7) GN=surA PE=3 SV=1 23 121 5.0E-07
sp|Q88A44|SURA_PSESM Chaperone SurA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=surA PE=3 SV=1 22 121 6.0E-07
sp|Q5QVN9|SURA_IDILO Chaperone SurA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=surA PE=3 SV=1 28 121 8.0E-07
sp|Q39D35|SURA_BURL3 Chaperone SurA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=surA PE=3 SV=1 12 121 8.0E-07
sp|Q479U4|SURA_DECAR Chaperone SurA OS=Dechloromonas aromatica (strain RCB) GN=surA PE=3 SV=1 18 121 9.0E-07
sp|Q5WZN0|SURA_LEGPL Chaperone SurA OS=Legionella pneumophila (strain Lens) GN=surA PE=3 SV=1 31 121 1.0E-06
sp|Q0AC82|SURA_ALKEH Chaperone SurA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=surA PE=3 SV=1 50 121 1.0E-06
sp|Q4ZMG7|SURA_PSEU2 Chaperone SurA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=surA PE=3 SV=2 22 121 1.0E-06
sp|Q5ZYR3|SURA_LEGPH Chaperone SurA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=surA PE=3 SV=2 31 121 1.0E-06
sp|Q5X877|SURA_LEGPA Chaperone SurA OS=Legionella pneumophila (strain Paris) GN=surA PE=3 SV=1 31 121 1.0E-06
sp|Q3K5T4|SURA_PSEPF Chaperone SurA OS=Pseudomonas fluorescens (strain Pf0-1) GN=surA PE=3 SV=1 19 121 2.0E-06
sp|Q88QT4|SURA_PSEPK Chaperone SurA OS=Pseudomonas putida (strain KT2440) GN=surA PE=3 SV=2 30 121 2.0E-06
sp|P0A266|PPIC_SALTI Peptidyl-prolyl cis-trans isomerase C OS=Salmonella typhi GN=ppiC PE=3 SV=2 34 121 3.0E-06
sp|P0A265|PPIC_SALTY Peptidyl-prolyl cis-trans isomerase C OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ppiC PE=3 SV=2 34 121 3.0E-06
sp|Q9I5U3|SURA_PSEAE Chaperone SurA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=surA PE=3 SV=2 19 121 4.0E-06
sp|Q4K4X7|SURA_PSEF5 Chaperone SurA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=surA PE=3 SV=2 19 121 4.0E-06
sp|Q21MS8|SURA_SACD2 Chaperone SurA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=surA PE=3 SV=1 21 121 4.0E-06
sp|B1KTE0|PRSA_CLOBM Foldase protein PrsA OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=prsA PE=3 SV=1 29 121 4.0E-06
sp|P0A9L5|PPIC_ECOLI Peptidyl-prolyl cis-trans isomerase C OS=Escherichia coli (strain K12) GN=ppiC PE=1 SV=2 34 120 6.0E-06
sp|P0A9L6|PPIC_ECOL6 Peptidyl-prolyl cis-trans isomerase C OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ppiC PE=3 SV=2 34 120 6.0E-06
sp|P0A9L7|PPIC_ECO57 Peptidyl-prolyl cis-trans isomerase C OS=Escherichia coli O157:H7 GN=ppiC PE=3 SV=2 34 120 6.0E-06
sp|Q0VMV4|SURA_ALCBS Chaperone SurA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=surA PE=3 SV=1 19 118 7.0E-06
sp|C3KW94|PRSA_CLOB6 Foldase protein PrsA OS=Clostridium botulinum (strain 657 / Type Ba4) GN=prsA PE=3 SV=1 29 121 7.0E-06
sp|Q0HLT0|SURA_SHESM Chaperone SurA OS=Shewanella sp. (strain MR-4) GN=surA PE=3 SV=1 23 121 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0016853 isomerase activity No
GO:0016859 cis-trans isomerase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1717
MGKNDKKAAGGDKAAGKAKDAGKAKGAQSINVRHILCEKHAKKEEALAKLNEGVKFDEVARSYSEDKARQGGSLG
WKNKGSLDPKFEEVAFALEPSTTSSPKIGEAKTGFGYHIIMVEGRK*
Coding >Hirsu2|1717
ATGGGGAAAAACGACAAGAAGGCCGCCGGCGGCGACAAGGCCGCGGGCAAAGCCAAGGACGCCGGCAAAGCCAAA
GGCGCGCAGTCCATCAACGTCCGCCACATCCTGTGTGAGAAACACGCAAAGAAGGAGGAGGCGCTGGCCAAGCTG
AACGAGGGCGTCAAGTTTGACGAAGTGGCCCGCTCCTATTCCGAGGACAAGGCCAGGCAAGGAGGCTCTCTCGGC
TGGAAGAACAAGGGCAGCCTGGACCCCAAGTTCGAGGAGGTCGCCTTTGCGCTGGAGCCGAGCACGACGAGCAGC
CCCAAGATCGGCGAGGCCAAGACCGGCTTCGGCTATCACATCATCATGGTCGAGGGCCGCAAGTAA
Transcript >Hirsu2|1717
ATGGGGAAAAACGACAAGAAGGCCGCCGGCGGCGACAAGGCCGCGGGCAAAGCCAAGGACGCCGGCAAAGCCAAA
GGCGCGCAGTCCATCAACGTCCGCCACATCCTGTGTGAGAAACACGCAAAGAAGGAGGAGGCGCTGGCCAAGCTG
AACGAGGGCGTCAAGTTTGACGAAGTGGCCCGCTCCTATTCCGAGGACAAGGCCAGGCAAGGAGGCTCTCTCGGC
TGGAAGAACAAGGGCAGCCTGGACCCCAAGTTCGAGGAGGTCGCCTTTGCGCTGGAGCCGAGCACGACGAGCAGC
CCCAAGATCGGCGAGGCCAAGACCGGCTTCGGCTATCACATCATCATGGTCGAGGGCCGCAAGTAA
Gene >Hirsu2|1717
ATGGGGAAAAACGACAAGAAGGCCGCCGGCGGCGACAAGGCCGCGGGCAAAGCCAAGGACGCCGGCAAAGCCAAA
GGCGCGCAGTCCATCAACGTCCGCCACATCCTGGTATAGCGCGAACCAAGCCCGTCCTCCTCCCTCCTCCCTCGT
CCTCTCCCTCCCGCGGTCGGATGACGTCAGTGATGCAATGCGATCGGCTCTCTGACGGTTCCTTCTCTCTGTCTC
TCTCTTGCTATGGCGCGCAGTGTGAGAAACACGCAAAGAAGGAGGAGGCGCTGGCCAAGCTGAACGAGGGCGTCA
AGTTTGACGAAGTGGCCCGCTCCTATTCCGAGGACAAGGCCAGGCAAGGTACTTGATACACGCACATGCATGCGC
GCGAAGACGACGGACCTCGCGCGCGCGAGTCGCGAGTCGCTCGGCCCCGACAGCGCTGACCCGACCCCCCCGTCG
TTTCCTCAGGAGGCTCTCTCGGCTGGAAGAACAAGGGCAGCCTGGACCCCAAGTTCGAGGAGGTCGCCTTTGCGC
TGGAGCCGAGCACGACGAGCAGCCCCAAGATCGGCGAGGCCAAGACCGGCTTCGGCTATCACATCATCATGGTAG
GTTGGCCCGACGCGCCATCAGTCCCGGGCGGACAAGCGGGTGCTCATGCCTTCTTACGATCAAGGTCGAGGGCCG
CAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail