Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1700
Gene name
LocationContig_1385:2348..3330
Strand+
Gene length (bp)982
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family 5.4E-26 96 277

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2W2H8|RL1_MAGSA 50S ribosomal protein L1 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplA PE=3 SV=1 55 283 3.0E-25
sp|A3Q972|RL1_SHELP 50S ribosomal protein L1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplA PE=3 SV=1 117 283 1.0E-23
sp|Q5E234|RL1_VIBF1 50S ribosomal protein L1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplA PE=3 SV=2 72 283 6.0E-23
sp|C3PMH4|RL1_RICAE 50S ribosomal protein L1 OS=Rickettsia africae (strain ESF-5) GN=rplA PE=3 SV=1 100 283 6.0E-23
sp|Q2NDY5|RL1_ERYLH 50S ribosomal protein L1 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplA PE=3 SV=1 73 283 9.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2W2H8|RL1_MAGSA 50S ribosomal protein L1 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplA PE=3 SV=1 55 283 3.0E-25
sp|A3Q972|RL1_SHELP 50S ribosomal protein L1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplA PE=3 SV=1 117 283 1.0E-23
sp|Q5E234|RL1_VIBF1 50S ribosomal protein L1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplA PE=3 SV=2 72 283 6.0E-23
sp|C3PMH4|RL1_RICAE 50S ribosomal protein L1 OS=Rickettsia africae (strain ESF-5) GN=rplA PE=3 SV=1 100 283 6.0E-23
sp|Q2NDY5|RL1_ERYLH 50S ribosomal protein L1 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplA PE=3 SV=1 73 283 9.0E-23
sp|Q15YB4|RL1_PSEA6 50S ribosomal protein L1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplA PE=3 SV=1 72 283 1.0E-22
sp|Q68XN1|RL1_RICTY 50S ribosomal protein L1 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplA PE=3 SV=1 105 283 1.0E-22
sp|C4K1P2|RL1_RICPU 50S ribosomal protein L1 OS=Rickettsia peacockii (strain Rustic) GN=rplA PE=3 SV=1 100 283 1.0E-22
sp|Q92J89|RL1_RICCN 50S ribosomal protein L1 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplA PE=3 SV=1 100 283 1.0E-22
sp|A1TYI7|RL1_MARHV 50S ribosomal protein L1 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplA PE=3 SV=1 97 283 1.0E-22
sp|B5FC91|RL1_VIBFM 50S ribosomal protein L1 OS=Vibrio fischeri (strain MJ11) GN=rplA PE=3 SV=1 72 283 2.0E-22
sp|A8GQW1|RL1_RICRS 50S ribosomal protein L1 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplA PE=3 SV=1 100 283 2.0E-22
sp|B0BWA6|RL1_RICRO 50S ribosomal protein L1 OS=Rickettsia rickettsii (strain Iowa) GN=rplA PE=3 SV=1 100 283 2.0E-22
sp|Q9ZE23|RL1_RICPR 50S ribosomal protein L1 OS=Rickettsia prowazekii (strain Madrid E) GN=rplA PE=3 SV=1 85 283 2.0E-22
sp|Q13TF9|RL1_BURXL 50S ribosomal protein L1 OS=Burkholderia xenovorans (strain LB400) GN=rplA PE=3 SV=1 92 283 3.0E-22
sp|Q47UV6|RL1_COLP3 50S ribosomal protein L1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplA PE=3 SV=1 72 273 3.0E-22
sp|B2T762|RL1_BURPP 50S ribosomal protein L1 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rplA PE=3 SV=1 92 283 3.0E-22
sp|B2JIH7|RL1_BURP8 50S ribosomal protein L1 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rplA PE=3 SV=1 92 283 4.0E-22
sp|Q4UKD1|RL1_RICFE 50S ribosomal protein L1 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rplA PE=3 SV=1 105 283 4.0E-22
sp|A0KRL4|RL1_SHESA 50S ribosomal protein L1 OS=Shewanella sp. (strain ANA-3) GN=rplA PE=3 SV=1 117 288 4.0E-22
sp|A4G9U8|RL1_HERAR 50S ribosomal protein L1 OS=Herminiimonas arsenicoxydans GN=rplA PE=3 SV=1 110 283 4.0E-22
sp|A8GMA4|RL1_RICAH 50S ribosomal protein L1 OS=Rickettsia akari (strain Hartford) GN=rplA PE=3 SV=1 105 283 5.0E-22
sp|Q0I0V1|RL1_HAES1 50S ribosomal protein L1 OS=Haemophilus somnus (strain 129Pt) GN=rplA PE=3 SV=1 72 283 5.0E-22
sp|Q7MGR5|RL1_VIBVY 50S ribosomal protein L1 OS=Vibrio vulnificus (strain YJ016) GN=rplA PE=3 SV=1 117 283 6.0E-22
sp|Q8DD23|RL1_VIBVU 50S ribosomal protein L1 OS=Vibrio vulnificus (strain CMCP6) GN=rplA PE=3 SV=1 117 283 6.0E-22
sp|Q82T72|RL1_NITEU 50S ribosomal protein L1 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplA PE=3 SV=2 73 283 9.0E-22
sp|A7MXE3|RL1_VIBCB 50S ribosomal protein L1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplA PE=3 SV=1 117 274 9.0E-22
sp|A1REA4|RL1_SHESW 50S ribosomal protein L1 OS=Shewanella sp. (strain W3-18-1) GN=rplA PE=3 SV=1 117 288 1.0E-21
sp|A4YBZ3|RL1_SHEPC 50S ribosomal protein L1 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplA PE=3 SV=1 117 288 1.0E-21
sp|B0UUZ5|RL1_HISS2 50S ribosomal protein L1 OS=Histophilus somni (strain 2336) GN=rplA PE=3 SV=1 72 283 2.0E-21
sp|Q0I0B5|RL1_SHESR 50S ribosomal protein L1 OS=Shewanella sp. (strain MR-7) GN=rplA PE=3 SV=1 117 283 2.0E-21
sp|Q0HNU7|RL1_SHESM 50S ribosomal protein L1 OS=Shewanella sp. (strain MR-4) GN=rplA PE=3 SV=1 117 283 2.0E-21
sp|B6IRP3|RL1_RHOCS 50S ribosomal protein L1 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplA PE=3 SV=1 73 283 2.0E-21
sp|Q8EK77|RL1_SHEON 50S ribosomal protein L1 OS=Shewanella oneidensis (strain MR-1) GN=rplA PE=3 SV=1 117 283 2.0E-21
sp|Q9CK86|RL1_PASMU 50S ribosomal protein L1 OS=Pasteurella multocida (strain Pm70) GN=rplA PE=3 SV=1 117 283 2.0E-21
sp|A8GYW6|RL1_SHEPA 50S ribosomal protein L1 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplA PE=3 SV=1 117 291 2.0E-21
sp|P44342|RL1_HAEIN 50S ribosomal protein L1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplA PE=3 SV=2 117 283 2.0E-21
sp|A5UH21|RL1_HAEIG 50S ribosomal protein L1 OS=Haemophilus influenzae (strain PittGG) GN=rplA PE=3 SV=1 117 283 2.0E-21
sp|Q4QN32|RL1_HAEI8 50S ribosomal protein L1 OS=Haemophilus influenzae (strain 86-028NP) GN=rplA PE=3 SV=1 117 283 2.0E-21
sp|Q87KQ1|RL1_VIBPA 50S ribosomal protein L1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplA PE=3 SV=1 117 274 2.0E-21
sp|Q2SU16|RL1_BURTA 50S ribosomal protein L1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rplA PE=3 SV=1 92 283 3.0E-21
sp|Q63Q00|RL1_BURPS 50S ribosomal protein L1 OS=Burkholderia pseudomallei (strain K96243) GN=rplA PE=3 SV=1 92 283 3.0E-21
sp|A3NEJ0|RL1_BURP6 50S ribosomal protein L1 OS=Burkholderia pseudomallei (strain 668) GN=rplA PE=3 SV=1 92 283 3.0E-21
sp|Q3JMQ0|RL1_BURP1 50S ribosomal protein L1 OS=Burkholderia pseudomallei (strain 1710b) GN=rplA PE=3 SV=1 92 283 3.0E-21
sp|A3P0C8|RL1_BURP0 50S ribosomal protein L1 OS=Burkholderia pseudomallei (strain 1106a) GN=rplA PE=3 SV=1 92 283 3.0E-21
sp|A1V8B5|RL1_BURMS 50S ribosomal protein L1 OS=Burkholderia mallei (strain SAVP1) GN=rplA PE=3 SV=1 92 283 3.0E-21
sp|Q62GJ4|RL1_BURMA 50S ribosomal protein L1 OS=Burkholderia mallei (strain ATCC 23344) GN=rplA PE=3 SV=1 92 283 3.0E-21
sp|A2S7G3|RL1_BURM9 50S ribosomal protein L1 OS=Burkholderia mallei (strain NCTC 10229) GN=rplA PE=3 SV=1 92 283 3.0E-21
sp|A3MRU2|RL1_BURM7 50S ribosomal protein L1 OS=Burkholderia mallei (strain NCTC 10247) GN=rplA PE=3 SV=1 92 283 3.0E-21
sp|Q1RHC7|RL1_RICBR 50S ribosomal protein L1 OS=Rickettsia bellii (strain RML369-C) GN=rplA PE=3 SV=1 110 283 4.0E-21
sp|A8GV21|RL1_RICB8 50S ribosomal protein L1 OS=Rickettsia bellii (strain OSU 85-389) GN=rplA PE=3 SV=1 110 283 4.0E-21
sp|Q5QWA8|RL1_IDILO 50S ribosomal protein L1 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplA PE=3 SV=1 67 283 4.0E-21
sp|A9KW92|RL1_SHEB9 50S ribosomal protein L1 OS=Shewanella baltica (strain OS195) GN=rplA PE=3 SV=1 117 275 4.0E-21
sp|A6WHR8|RL1_SHEB8 50S ribosomal protein L1 OS=Shewanella baltica (strain OS185) GN=rplA PE=3 SV=1 117 275 4.0E-21
sp|B8EBL5|RL1_SHEB2 50S ribosomal protein L1 OS=Shewanella baltica (strain OS223) GN=rplA PE=3 SV=1 117 275 4.0E-21
sp|A5U9X7|RL1_HAEIE 50S ribosomal protein L1 OS=Haemophilus influenzae (strain PittEE) GN=rplA PE=3 SV=1 117 283 4.0E-21
sp|A8EXK5|RL1_RICCK 50S ribosomal protein L1 OS=Rickettsia canadensis (strain McKiel) GN=rplA PE=3 SV=1 105 283 4.0E-21
sp|Q8XUZ5|RL1_RALSO 50S ribosomal protein L1 OS=Ralstonia solanacearum (strain GMI1000) GN=rplA PE=3 SV=1 92 283 4.0E-21
sp|Q089R4|RL1_SHEFN 50S ribosomal protein L1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplA PE=3 SV=1 117 291 5.0E-21
sp|Q39KH8|RL1_BURL3 50S ribosomal protein L1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rplA PE=3 SV=1 92 283 5.0E-21
sp|B4E5A9|RL1_BURCJ 50S ribosomal protein L1 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rplA PE=3 SV=1 92 283 5.0E-21
sp|B2UF70|RL1_RALPJ 50S ribosomal protein L1 OS=Ralstonia pickettii (strain 12J) GN=rplA PE=3 SV=1 92 283 6.0E-21
sp|B4RQV9|RL1_NEIG2 50S ribosomal protein L1 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rplA PE=3 SV=1 92 247 6.0E-21
sp|Q5F5R2|RL1_NEIG1 50S ribosomal protein L1 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rplA PE=3 SV=1 92 247 6.0E-21
sp|A0K3L4|RL1_BURCH 50S ribosomal protein L1 OS=Burkholderia cenocepacia (strain HI2424) GN=rplA PE=3 SV=1 92 283 6.0E-21
sp|B1JU11|RL1_BURCC 50S ribosomal protein L1 OS=Burkholderia cenocepacia (strain MC0-3) GN=rplA PE=3 SV=1 92 283 6.0E-21
sp|Q1BRT7|RL1_BURCA 50S ribosomal protein L1 OS=Burkholderia cenocepacia (strain AU 1054) GN=rplA PE=3 SV=1 92 283 6.0E-21
sp|B6ENR6|RL1_ALISL 50S ribosomal protein L1 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplA PE=3 SV=1 117 283 6.0E-21
sp|Q12SW9|RL1_SHEDO 50S ribosomal protein L1 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplA PE=3 SV=1 117 283 7.0E-21
sp|Q0BYA1|RL1_HYPNA 50S ribosomal protein L1 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rplA PE=3 SV=1 55 283 7.0E-21
sp|Q6LLV9|RL1_PHOPR 50S ribosomal protein L1 OS=Photobacterium profundum GN=rplA PE=3 SV=1 117 283 9.0E-21
sp|A9M3X7|RL1_NEIM0 50S ribosomal protein L1 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rplA PE=3 SV=1 92 284 1.0E-20
sp|B0TM22|RL1_SHEHH 50S ribosomal protein L1 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplA PE=3 SV=1 117 283 1.0E-20
sp|Q0BJ57|RL1_BURCM 50S ribosomal protein L1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rplA PE=3 SV=1 92 283 1.0E-20
sp|B1YRB9|RL1_BURA4 50S ribosomal protein L1 OS=Burkholderia ambifaria (strain MC40-6) GN=rplA PE=3 SV=1 92 283 1.0E-20
sp|A9ADI2|RL1_BURM1 50S ribosomal protein L1 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rplA PE=3 SV=1 92 283 2.0E-20
sp|P36248|RL1_LIBAS 50S ribosomal protein L1 OS=Liberibacter asiaticus GN=rplA PE=3 SV=1 47 283 2.0E-20
sp|B0U5Y0|RL1_XYLFM 50S ribosomal protein L1 OS=Xylella fastidiosa (strain M12) GN=rplA PE=3 SV=1 55 283 2.0E-20
sp|B2SQP8|RL1_XANOP 50S ribosomal protein L1 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rplA PE=3 SV=1 117 283 3.0E-20
sp|Q2NZX5|RL1_XANOM 50S ribosomal protein L1 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rplA PE=3 SV=1 117 283 3.0E-20
sp|A1KRG3|RL1_NEIMF 50S ribosomal protein L1 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rplA PE=3 SV=1 92 284 3.0E-20
sp|P66088|RL1_NEIMB 50S ribosomal protein L1 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rplA PE=3 SV=1 92 284 3.0E-20
sp|P66087|RL1_NEIMA 50S ribosomal protein L1 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rplA PE=3 SV=1 92 284 3.0E-20
sp|Q2II81|RL1_ANADE 50S ribosomal protein L1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplA PE=3 SV=1 72 283 3.0E-20
sp|Q9PA83|RL1_XYLFA 50S ribosomal protein L1 OS=Xylella fastidiosa (strain 9a5c) GN=rplA PE=3 SV=1 55 283 3.0E-20
sp|B9KFG4|RL1_CAMLR 50S ribosomal protein L1 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rplA PE=3 SV=1 92 247 3.0E-20
sp|Q3BWZ4|RL1_XANC5 50S ribosomal protein L1 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rplA PE=3 SV=1 117 283 4.0E-20
sp|Q8PNT3|RL1_XANAC 50S ribosomal protein L1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rplA PE=3 SV=1 117 283 4.0E-20
sp|Q8RTJ4|RL1_XANCP 50S ribosomal protein L1 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rplA PE=3 SV=1 117 283 4.0E-20
sp|B0RU92|RL1_XANCB 50S ribosomal protein L1 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rplA PE=3 SV=1 117 283 4.0E-20
sp|Q4URC9|RL1_XANC8 50S ribosomal protein L1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rplA PE=3 SV=1 117 283 4.0E-20
sp|A6Q1M0|RL1_NITSB 50S ribosomal protein L1 OS=Nitratiruptor sp. (strain SB155-2) GN=rplA PE=3 SV=1 93 284 4.0E-20
sp|Q83ET3|RL1_COXBU 50S ribosomal protein L1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplA PE=3 SV=1 73 283 5.0E-20
sp|A9NAL1|RL1_COXBR 50S ribosomal protein L1 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplA PE=3 SV=1 73 283 5.0E-20
sp|C1F3Y0|RL1_ACIC5 50S ribosomal protein L1 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=rplA PE=3 SV=1 94 288 5.0E-20
sp|A5V9F6|RL1_SPHWW 50S ribosomal protein L1 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplA PE=3 SV=1 65 283 5.0E-20
sp|A9KD42|RL1_COXBN 50S ribosomal protein L1 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplA PE=3 SV=1 73 283 5.0E-20
sp|B6J274|RL1_COXB2 50S ribosomal protein L1 OS=Coxiella burnetii (strain CbuG_Q212) GN=rplA PE=3 SV=1 73 283 5.0E-20
sp|B6J5B9|RL1_COXB1 50S ribosomal protein L1 OS=Coxiella burnetii (strain CbuK_Q154) GN=rplA PE=3 SV=1 73 283 5.0E-20
sp|Q87A29|RL1_XYLFT 50S ribosomal protein L1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rplA PE=3 SV=1 117 283 5.0E-20
sp|B2IA72|RL1_XYLF2 50S ribosomal protein L1 OS=Xylella fastidiosa (strain M23) GN=rplA PE=3 SV=1 117 283 5.0E-20
sp|B0VDG5|RL1_ACIBY 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain AYE) GN=rplA PE=3 SV=1 73 283 5.0E-20
sp|A3M1G0|RL1_ACIBT 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplA PE=3 SV=3 73 283 5.0E-20
sp|B7H1K1|RL1_ACIB3 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain AB307-0294) GN=rplA PE=3 SV=1 73 283 5.0E-20
sp|B0VLZ9|RL1_ACIBS 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain SDF) GN=rplA PE=3 SV=1 73 283 6.0E-20
sp|B7I357|RL1_ACIB5 50S ribosomal protein L1 OS=Acinetobacter baumannii (strain AB0057) GN=rplA PE=3 SV=1 73 283 6.0E-20
sp|A6W3A2|RL1_MARMS 50S ribosomal protein L1 OS=Marinomonas sp. (strain MWYL1) GN=rplA PE=3 SV=1 97 283 6.0E-20
sp|B9L7J3|RL1_NAUPA 50S ribosomal protein L1 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rplA PE=3 SV=1 93 250 8.0E-20
sp|Q3SLQ9|RL1_THIDA 50S ribosomal protein L1 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplA PE=3 SV=1 81 247 9.0E-20
sp|A6VKC8|RL1_ACTSZ 50S ribosomal protein L1 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplA PE=3 SV=1 117 242 1.0E-19
sp|B4UDT5|RL1_ANASK 50S ribosomal protein L1 OS=Anaeromyxobacter sp. (strain K) GN=rplA PE=3 SV=1 72 283 1.0E-19
sp|B8JB73|RL1_ANAD2 50S ribosomal protein L1 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplA PE=3 SV=1 72 283 1.0E-19
sp|Q0VSM5|RL1_ALCBS 50S ribosomal protein L1 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplA PE=3 SV=1 117 283 1.0E-19
sp|A3PAS1|RL1_PROM0 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9301) GN=rplA PE=3 SV=1 78 246 1.0E-19
sp|A2BNZ8|RL1_PROMS 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain AS9601) GN=rplA PE=3 SV=1 78 246 2.0E-19
sp|Q1GT68|RL1_SPHAL 50S ribosomal protein L1 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplA PE=3 SV=1 92 284 2.0E-19
sp|Q5GWS3|RL1_XANOR 50S ribosomal protein L1 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rplA PE=3 SV=1 117 283 2.0E-19
sp|Q31CX8|RL1_PROM9 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9312) GN=rplA PE=3 SV=1 78 246 2.0E-19
sp|Q65W45|RL1_MANSM 50S ribosomal protein L1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplA PE=3 SV=1 117 285 2.0E-19
sp|B8EMR8|RL1_METSB 50S ribosomal protein L1 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplA PE=3 SV=1 92 283 3.0E-19
sp|A4JAM9|RL1_BURVG 50S ribosomal protein L1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rplA PE=3 SV=1 92 283 3.0E-19
sp|Q9P6M9|RM01_SCHPO 54S ribosomal protein L1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl1 PE=3 SV=1 56 282 3.0E-19
sp|A8G2L0|RL1_PROM2 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9215) GN=rplA PE=3 SV=1 78 246 3.0E-19
sp|A8G1F8|RL1_SHESH 50S ribosomal protein L1 OS=Shewanella sediminis (strain HAW-EB3) GN=rplA PE=3 SV=1 117 291 3.0E-19
sp|Q160X4|RL1_ROSDO 50S ribosomal protein L1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplA PE=3 SV=1 78 282 4.0E-19
sp|Q7VDY6|RL1_PROMA 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rplA PE=3 SV=1 66 246 4.0E-19
sp|Q28UY1|RL1_JANSC 50S ribosomal protein L1 OS=Jannaschia sp. (strain CCS1) GN=rplA PE=3 SV=1 78 283 4.0E-19
sp|Q1D7U6|RL1_MYXXD 50S ribosomal protein L1 OS=Myxococcus xanthus (strain DK 1622) GN=rplA PE=3 SV=1 93 285 5.0E-19
sp|B0BSE7|RL1_ACTPJ 50S ribosomal protein L1 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplA PE=3 SV=1 117 283 5.0E-19
sp|A8EVZ7|RL1_ARCB4 50S ribosomal protein L1 OS=Arcobacter butzleri (strain RM4018) GN=rplA PE=3 SV=1 67 250 5.0E-19
sp|C0Q9Y2|RL1_DESAH 50S ribosomal protein L1 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rplA PE=3 SV=1 55 250 5.0E-19
sp|B1KMZ3|RL1_SHEWM 50S ribosomal protein L1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplA PE=3 SV=1 117 273 6.0E-19
sp|A1WVD2|RL1_HALHL 50S ribosomal protein L1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rplA PE=3 SV=1 91 283 6.0E-19
sp|A6LE84|RL1_PARD8 50S ribosomal protein L1 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rplA PE=3 SV=1 92 283 7.0E-19
sp|Q5LMQ0|RL1_RUEPO 50S ribosomal protein L1 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplA PE=3 SV=1 92 283 8.0E-19
sp|A1S208|RL1_SHEAM 50S ribosomal protein L1 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplA PE=3 SV=1 97 283 8.0E-19
sp|Q60A09|RL1_METCA 50S ribosomal protein L1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rplA PE=3 SV=1 117 283 9.0E-19
sp|Q0AF50|RL1_NITEC 50S ribosomal protein L1 OS=Nitrosomonas eutropha (strain C91) GN=rplA PE=3 SV=1 86 283 1.0E-18
sp|Q11HB0|RL1_CHESB 50S ribosomal protein L1 OS=Chelativorans sp. (strain BNC1) GN=rplA PE=3 SV=1 62 283 1.0E-18
sp|Q46HH0|RL1_PROMT 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain NATL2A) GN=rplA PE=3 SV=1 65 283 1.0E-18
sp|A2C033|RL1_PROM1 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain NATL1A) GN=rplA PE=3 SV=1 65 283 1.0E-18
sp|Q6FZL6|RL1_BARQU 50S ribosomal protein L1 OS=Bartonella quintana (strain Toulouse) GN=rplA PE=3 SV=1 62 250 1.0E-18
sp|B8F7D3|RL1_HAEPS 50S ribosomal protein L1 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplA PE=3 SV=1 117 283 1.0E-18
sp|B1Y7H6|RL1_LEPCP 50S ribosomal protein L1 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rplA PE=3 SV=1 110 247 1.0E-18
sp|A7HCI0|RL1_ANADF 50S ribosomal protein L1 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplA PE=3 SV=1 110 283 1.0E-18
sp|B4EYV2|RL1_PROMH 50S ribosomal protein L1 OS=Proteus mirabilis (strain HI4320) GN=rplA PE=3 SV=1 72 275 1.0E-18
sp|Q1IHH1|RL1_KORVE 50S ribosomal protein L1 OS=Koribacter versatilis (strain Ellin345) GN=rplA PE=3 SV=1 94 284 1.0E-18
sp|A2BUI0|RL1_PROM5 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9515) GN=rplA PE=3 SV=1 78 246 2.0E-18
sp|A5WH38|RL1_PSYWF 50S ribosomal protein L1 OS=Psychrobacter sp. (strain PRwf-1) GN=rplA PE=3 SV=1 73 285 2.0E-18
sp|B4SKV3|RL1_STRM5 50S ribosomal protein L1 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rplA PE=3 SV=1 117 283 2.0E-18
sp|C4K4F4|RL1_HAMD5 50S ribosomal protein L1 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplA PE=3 SV=1 72 274 2.0E-18
sp|Q39Y16|RL1_GEOMG 50S ribosomal protein L1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplA PE=3 SV=1 105 283 2.0E-18
sp|B2FQ35|RL1_STRMK 50S ribosomal protein L1 OS=Stenotrophomonas maltophilia (strain K279a) GN=rplA PE=3 SV=1 117 283 2.0E-18
sp|C5BHE1|RL1_EDWI9 50S ribosomal protein L1 OS=Edwardsiella ictaluri (strain 93-146) GN=rplA PE=3 SV=1 72 283 2.0E-18
sp|A4WVL9|RL1_RHOS5 50S ribosomal protein L1 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplA PE=3 SV=1 92 283 2.0E-18
sp|Q3ILQ3|RL1_PSEHT 50S ribosomal protein L1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplA PE=3 SV=1 117 275 2.0E-18
sp|B2IK52|RL1_BEII9 50S ribosomal protein L1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplA PE=3 SV=1 110 283 2.0E-18
sp|P66092|RL1_STAAW 50S ribosomal protein L1 OS=Staphylococcus aureus (strain MW2) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|A8YZN6|RL1_STAAT 50S ribosomal protein L1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|Q6GBU9|RL1_STAAS 50S ribosomal protein L1 OS=Staphylococcus aureus (strain MSSA476) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|P66091|RL1_STAAM 50S ribosomal protein L1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|A6QEJ0|RL1_STAAE 50S ribosomal protein L1 OS=Staphylococcus aureus (strain Newman) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|Q5HID7|RL1_STAAC 50S ribosomal protein L1 OS=Staphylococcus aureus (strain COL) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|Q2YSC3|RL1_STAAB 50S ribosomal protein L1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|A5IQ92|RL1_STAA9 50S ribosomal protein L1 OS=Staphylococcus aureus (strain JH9) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|Q2G0P0|RL1_STAA8 50S ribosomal protein L1 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|Q2FJA2|RL1_STAA3 50S ribosomal protein L1 OS=Staphylococcus aureus (strain USA300) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|A6TZ15|RL1_STAA2 50S ribosomal protein L1 OS=Staphylococcus aureus (strain JH1) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|A7WYW1|RL1_STAA1 50S ribosomal protein L1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplA PE=3 SV=1 55 246 2.0E-18
sp|Q7MA59|RL1_WOLSU 50S ribosomal protein L1 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rplA PE=3 SV=1 92 284 2.0E-18
sp|Q6GJD0|RL1_STAAR 50S ribosomal protein L1 OS=Staphylococcus aureus (strain MRSA252) GN=rplA PE=3 SV=1 55 246 3.0E-18
sp|Q134R4|RL1_RHOPS 50S ribosomal protein L1 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplA PE=3 SV=1 92 246 3.0E-18
sp|A5CW28|RL1_VESOH 50S ribosomal protein L1 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rplA PE=3 SV=1 73 251 3.0E-18
sp|Q88QP4|RL1_PSEPK 50S ribosomal protein L1 OS=Pseudomonas putida (strain KT2440) GN=rplA PE=3 SV=1 96 283 3.0E-18
sp|A5VXN7|RL1_PSEP1 50S ribosomal protein L1 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplA PE=3 SV=1 96 283 3.0E-18
sp|Q6G3X8|RL1_BARHE 50S ribosomal protein L1 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplA PE=3 SV=1 62 289 3.0E-18
sp|Q5HVZ2|RL1_CAMJR 50S ribosomal protein L1 OS=Campylobacter jejuni (strain RM1221) GN=rplA PE=3 SV=1 93 247 3.0E-18
sp|A1VYJ1|RL1_CAMJJ 50S ribosomal protein L1 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rplA PE=3 SV=1 93 247 3.0E-18
sp|Q9PI34|RL1_CAMJE 50S ribosomal protein L1 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rplA PE=3 SV=1 93 247 3.0E-18
sp|A7H4Q8|RL1_CAMJD 50S ribosomal protein L1 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rplA PE=3 SV=1 93 247 3.0E-18
sp|A8FKR0|RL1_CAMJ8 50S ribosomal protein L1 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rplA PE=3 SV=1 93 247 3.0E-18
sp|A7HWQ1|RL1_PARL1 50S ribosomal protein L1 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplA PE=3 SV=1 92 251 4.0E-18
sp|A9BDG6|RL1_PROM4 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9211) GN=rplA PE=3 SV=1 92 246 4.0E-18
sp|B3E7S5|RL1_GEOLS 50S ribosomal protein L1 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rplA PE=3 SV=1 74 283 4.0E-18
sp|B7JWT7|RL1_CYAP8 50S ribosomal protein L1 OS=Cyanothece sp. (strain PCC 8801) GN=rplA PE=3 SV=1 53 246 4.0E-18
sp|Q3J8Q4|RL1_NITOC 50S ribosomal protein L1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplA PE=3 SV=1 78 283 4.0E-18
sp|A0KQA8|RL1_AERHH 50S ribosomal protein L1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplA PE=3 SV=1 72 283 5.0E-18
sp|B9DKX1|RL1_STACT 50S ribosomal protein L1 OS=Staphylococcus carnosus (strain TM300) GN=rplA PE=3 SV=1 55 246 6.0E-18
sp|B9M6V5|RL1_GEODF 50S ribosomal protein L1 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplA PE=3 SV=1 73 283 6.0E-18
sp|A5F3P2|RL1_VIBC3 50S ribosomal protein L1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplA PE=3 SV=1 117 283 6.0E-18
sp|C1DKK2|RL1_AZOVD 50S ribosomal protein L1 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rplA PE=3 SV=1 97 283 6.0E-18
sp|C3LR57|RL1_VIBCM 50S ribosomal protein L1 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplA PE=3 SV=1 117 283 7.0E-18
sp|Q9KV33|RL1_VIBCH 50S ribosomal protein L1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplA PE=3 SV=1 117 283 7.0E-18
sp|A6LKQ6|RL1_THEM4 50S ribosomal protein L1 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplA PE=3 SV=1 92 283 7.0E-18
sp|A9H3T0|RL1_GLUDA 50S ribosomal protein L1 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplA PE=3 SV=1 92 251 7.0E-18
sp|A8LLK0|RL1_DINSH 50S ribosomal protein L1 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplA PE=3 SV=1 78 282 7.0E-18
sp|C4LBV5|RL1_TOLAT 50S ribosomal protein L1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rplA PE=3 SV=1 117 283 7.0E-18
sp|Q2LQ90|RL1_SYNAS 50S ribosomal protein L1 OS=Syntrophus aciditrophicus (strain SB) GN=rplA PE=3 SV=1 110 285 7.0E-18
sp|B1XSE9|RL1_POLNS 50S ribosomal protein L1 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rplA PE=3 SV=1 73 241 7.0E-18
sp|A7I3U2|RL1_CAMHC 50S ribosomal protein L1 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rplA PE=3 SV=1 92 250 8.0E-18
sp|C6C176|RL1_DESAD 50S ribosomal protein L1 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rplA PE=3 SV=1 55 285 8.0E-18
sp|Q31IZ2|RL1_THICR 50S ribosomal protein L1 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplA PE=3 SV=1 85 283 8.0E-18
sp|Q0ANP0|RL1_MARMM 50S ribosomal protein L1 OS=Maricaulis maris (strain MCS10) GN=rplA PE=3 SV=1 85 284 8.0E-18
sp|Q748Y3|RL1_GEOSL 50S ribosomal protein L1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rplA PE=3 SV=1 105 283 8.0E-18
sp|Q3ATP8|RL1_CHLCH 50S ribosomal protein L1 OS=Chlorobium chlorochromatii (strain CaD3) GN=rplA PE=3 SV=1 55 275 8.0E-18
sp|Q47LI2|RL1_THEFY 50S ribosomal protein L1 OS=Thermobifida fusca (strain YX) GN=rplA PE=3 SV=1 92 283 8.0E-18
sp|Q85G11|RK1_CYAME 50S ribosomal protein L1, chloroplastic OS=Cyanidioschyzon merolae GN=rpl1 PE=3 SV=1 78 253 9.0E-18
sp|Q8UE05|RL1_AGRFC 50S ribosomal protein L1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplA PE=3 SV=2 73 282 9.0E-18
sp|Q1IFX6|RL1_PSEE4 50S ribosomal protein L1 OS=Pseudomonas entomophila (strain L48) GN=rplA PE=3 SV=1 96 283 9.0E-18
sp|Q99W68|RL1_STAAN 50S ribosomal protein L1 OS=Staphylococcus aureus (strain N315) GN=rplA PE=1 SV=1 55 246 9.0E-18
sp|A5IJW6|RL1_THEP1 50S ribosomal protein L1 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rplA PE=3 SV=1 60 283 1.0E-17
sp|Q8CTT4|RL1_STAES 50S ribosomal protein L1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplA PE=3 SV=1 55 246 1.0E-17
sp|Q5HRL4|RL1_STAEQ 50S ribosomal protein L1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplA PE=3 SV=1 55 246 1.0E-17
sp|A1B012|RL1_PARDP 50S ribosomal protein L1 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplA PE=3 SV=1 92 283 1.0E-17
sp|Q5NPL0|RL1_ZYMMO 50S ribosomal protein L1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplA PE=3 SV=1 92 283 1.0E-17
sp|B5RFK4|RL1_SALG2 50S ribosomal protein L1 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplA PE=3 SV=1 72 283 1.0E-17
sp|P29393|RL1_THEMA 50S ribosomal protein L1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplA PE=3 SV=1 84 288 1.0E-17
sp|A1ALT1|RL1_PELPD 50S ribosomal protein L1 OS=Pelobacter propionicus (strain DSM 2379) GN=rplA PE=3 SV=1 81 283 1.0E-17
sp|Q4FLK9|RL1_PELUB 50S ribosomal protein L1 OS=Pelagibacter ubique (strain HTCC1062) GN=rplA PE=3 SV=1 93 247 1.0E-17
sp|Q6FF93|RL1_ACIAD 50S ribosomal protein L1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplA PE=3 SV=1 73 283 1.0E-17
sp|A5GAX8|RL1_GEOUR 50S ribosomal protein L1 OS=Geobacter uraniireducens (strain Rf4) GN=rplA PE=3 SV=1 105 283 1.0E-17
sp|A1JIH7|RL1_YERE8 50S ribosomal protein L1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplA PE=3 SV=1 72 283 1.0E-17
sp|A4SUV1|RL1_POLSQ 50S ribosomal protein L1 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rplA PE=3 SV=1 92 241 1.0E-17
sp|B0CAD0|RL1_ACAM1 50S ribosomal protein L1 OS=Acaryochloris marina (strain MBIC 11017) GN=rplA PE=3 SV=1 78 246 1.0E-17
sp|Q2IXS7|RL1_RHOP2 50S ribosomal protein L1 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplA PE=3 SV=1 54 246 1.0E-17
sp|Q1LSY0|RL1_BAUCH 50S ribosomal protein L1 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplA PE=3 SV=1 117 287 1.0E-17
sp|B0KK57|RL1_PSEPG 50S ribosomal protein L1 OS=Pseudomonas putida (strain GB-1) GN=rplA PE=3 SV=1 96 283 1.0E-17
sp|P56029|RL1_HELPY 50S ribosomal protein L1 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rplA PE=1 SV=1 55 284 2.0E-17
sp|Q1CS65|RL1_HELPH 50S ribosomal protein L1 OS=Helicobacter pylori (strain HPAG1) GN=rplA PE=3 SV=1 55 284 2.0E-17
sp|B6JN40|RL1_HELP2 50S ribosomal protein L1 OS=Helicobacter pylori (strain P12) GN=rplA PE=3 SV=1 55 284 2.0E-17
sp|A8F4F7|RL1_PSELT 50S ribosomal protein L1 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rplA PE=3 SV=1 62 283 2.0E-17
sp|B5Z8J8|RL1_HELPG 50S ribosomal protein L1 OS=Helicobacter pylori (strain G27) GN=rplA PE=3 SV=1 55 284 2.0E-17
sp|Q3K5X8|RL1_PSEPF 50S ribosomal protein L1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplA PE=3 SV=1 96 283 2.0E-17
sp|B1L938|RL1_THESQ 50S ribosomal protein L1 OS=Thermotoga sp. (strain RQ2) GN=rplA PE=3 SV=1 84 288 2.0E-17
sp|Q7V382|RL1_PROMP 50S ribosomal protein L1 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rplA PE=3 SV=1 92 283 2.0E-17
sp|B1JE12|RL1_PSEPW 50S ribosomal protein L1 OS=Pseudomonas putida (strain W619) GN=rplA PE=3 SV=1 93 283 2.0E-17
sp|A7MQP8|RL1_CROS8 50S ribosomal protein L1 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplA PE=3 SV=1 72 283 2.0E-17
sp|Q8YLJ7|RL1_NOSS1 50S ribosomal protein L1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplA PE=3 SV=1 114 246 2.0E-17
sp|Q5P342|RL1_AROAE 50S ribosomal protein L1 OS=Aromatoleum aromaticum (strain EbN1) GN=rplA PE=3 SV=1 92 280 2.0E-17
sp|A6TGN6|RL1_KLEP7 50S ribosomal protein L1 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplA PE=3 SV=1 72 283 2.0E-17
sp|B4R8K2|RL1_PHEZH 50S ribosomal protein L1 OS=Phenylobacterium zucineum (strain HLK1) GN=rplA PE=3 SV=1 74 283 2.0E-17
sp|P0A2A3|RL1_SALTY 50S ribosomal protein L1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|P0A2A4|RL1_SALTI 50S ribosomal protein L1 OS=Salmonella typhi GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|B4TQJ2|RL1_SALSV 50S ribosomal protein L1 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|B5BJQ0|RL1_SALPK 50S ribosomal protein L1 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|C0Q2R4|RL1_SALPC 50S ribosomal protein L1 OS=Salmonella paratyphi C (strain RKS4594) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|A9N0I9|RL1_SALPB 50S ribosomal protein L1 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|Q5PK96|RL1_SALPA 50S ribosomal protein L1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|B4T0Y6|RL1_SALNS 50S ribosomal protein L1 OS=Salmonella newport (strain SL254) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|B4TCS1|RL1_SALHS 50S ribosomal protein L1 OS=Salmonella heidelberg (strain SL476) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|B5QYD5|RL1_SALEP 50S ribosomal protein L1 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|B5FQJ6|RL1_SALDC 50S ribosomal protein L1 OS=Salmonella dublin (strain CT_02021853) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|Q57H72|RL1_SALCH 50S ribosomal protein L1 OS=Salmonella choleraesuis (strain SC-B67) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|B5F0W4|RL1_SALA4 50S ribosomal protein L1 OS=Salmonella agona (strain SL483) GN=rplA PE=3 SV=1 72 283 3.0E-17
sp|C3MAW8|RL1_RHISN 50S ribosomal protein L1 OS=Rhizobium sp. (strain NGR234) GN=rplA PE=3 SV=1 92 283 3.0E-17
sp|B6JER6|RL1_OLICO 50S ribosomal protein L1 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplA PE=3 SV=1 57 284 3.0E-17
sp|Q89J70|RL1_BRADU 50S ribosomal protein L1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplA PE=3 SV=1 57 282 3.0E-17
sp|A1T068|RL1_PSYIN 50S ribosomal protein L1 OS=Psychromonas ingrahamii (strain 37) GN=rplA PE=3 SV=1 117 284 3.0E-17
sp|P10054|RL1_PROVU 50S ribosomal protein L1 OS=Proteus vulgaris GN=rplA PE=3 SV=2 72 275 3.0E-17
sp|Q0I6K8|RL1_SYNS3 50S ribosomal protein L1 OS=Synechococcus sp. (strain CC9311) GN=rplA PE=3 SV=1 78 246 3.0E-17
sp|B6YQ00|RL1_AZOPC 50S ribosomal protein L1 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rplA PE=3 SV=1 92 284 3.0E-17
sp|Q211C5|RL1_RHOPB 50S ribosomal protein L1 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplA PE=3 SV=1 54 282 3.0E-17
sp|Q04599|RM01_YEAST 54S ribosomal protein L1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL1 PE=1 SV=1 41 283 3.0E-17
sp|B2UUW3|RL1_HELPS 50S ribosomal protein L1 OS=Helicobacter pylori (strain Shi470) GN=rplA PE=3 SV=1 55 284 3.0E-17
sp|B8FEU4|RL1_DESAA 50S ribosomal protein L1 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplA PE=3 SV=1 81 288 3.0E-17
sp|B3PW56|RL1_RHIE6 50S ribosomal protein L1 OS=Rhizobium etli (strain CIAT 652) GN=rplA PE=3 SV=1 59 282 3.0E-17
sp|Q2K9M7|RL1_RHIEC 50S ribosomal protein L1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rplA PE=3 SV=1 59 282 3.0E-17
sp|B9JVM5|RL1_AGRVS 50S ribosomal protein L1 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplA PE=3 SV=1 74 283 3.0E-17
sp|Q47JB3|RL1_DECAR 50S ribosomal protein L1 OS=Dechloromonas aromatica (strain RCB) GN=rplA PE=3 SV=1 97 247 3.0E-17
sp|B9KL80|RL1_RHOSK 50S ribosomal protein L1 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplA PE=3 SV=1 92 283 3.0E-17
sp|Q3J5T3|RL1_RHOS4 50S ribosomal protein L1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplA PE=3 SV=1 92 283 3.0E-17
sp|A3PGI6|RL1_RHOS1 50S ribosomal protein L1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplA1 PE=3 SV=1 92 283 3.0E-17
sp|A6U848|RL1_SINMW 50S ribosomal protein L1 OS=Sinorhizobium medicae (strain WSM419) GN=rplA PE=3 SV=1 92 283 4.0E-17
sp|Q8DM27|RL1_THEEB 50S ribosomal protein L1 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplA PE=3 SV=1 78 246 4.0E-17
sp|Q2NWR9|RL1_SODGM 50S ribosomal protein L1 OS=Sodalis glossinidius (strain morsitans) GN=rplA PE=3 SV=1 72 275 4.0E-17
sp|Q1MPU1|RL1_LAWIP 50S ribosomal protein L1 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rplA PE=3 SV=1 55 284 4.0E-17
sp|Q30X09|RL1_DESAG 50S ribosomal protein L1 OS=Desulfovibrio alaskensis (strain G20) GN=rplA PE=3 SV=1 92 251 4.0E-17
sp|B0TX07|RL1_FRAP2 50S ribosomal protein L1 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplA PE=3 SV=1 117 283 4.0E-17
sp|B5XYF8|RL1_KLEP3 50S ribosomal protein L1 OS=Klebsiella pneumoniae (strain 342) GN=rplA PE=3 SV=1 72 283 5.0E-17
sp|B1JJJ5|RL1_YERPY 50S ribosomal protein L1 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplA PE=3 SV=1 72 283 5.0E-17
sp|Q66FQ5|RL1_YERPS 50S ribosomal protein L1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplA PE=3 SV=1 72 283 5.0E-17
sp|A4TS32|RL1_YERPP 50S ribosomal protein L1 OS=Yersinia pestis (strain Pestoides F) GN=rplA PE=3 SV=1 72 283 5.0E-17
sp|Q1CN81|RL1_YERPN 50S ribosomal protein L1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplA PE=3 SV=1 72 283 5.0E-17
sp|A9R0H5|RL1_YERPG 50S ribosomal protein L1 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplA PE=3 SV=1 72 283 5.0E-17
sp|Q8ZAP2|RL1_YERPE 50S ribosomal protein L1 OS=Yersinia pestis GN=rplA PE=3 SV=1 72 283 5.0E-17
sp|B2K109|RL1_YERPB 50S ribosomal protein L1 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplA PE=3 SV=1 72 283 5.0E-17
sp|Q1C1T8|RL1_YERPA 50S ribosomal protein L1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplA PE=3 SV=1 72 283 5.0E-17
sp|A7FNI6|RL1_YERP3 50S ribosomal protein L1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplA PE=3 SV=1 72 283 5.0E-17
sp|A9MHF5|RL1_SALAR 50S ribosomal protein L1 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplA PE=3 SV=1 72 283 5.0E-17
sp|Q48D26|RL1_PSE14 50S ribosomal protein L1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplA PE=3 SV=1 93 283 5.0E-17
sp|B3ETZ3|RL1_AMOA5 50S ribosomal protein L1 OS=Amoebophilus asiaticus (strain 5a2) GN=rplA PE=3 SV=1 67 247 5.0E-17
sp|Q1MIF3|RL1_RHIL3 50S ribosomal protein L1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rplA PE=3 SV=1 73 282 5.0E-17
sp|Q1R0I5|RL1_CHRSD 50S ribosomal protein L1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplA PE=3 SV=1 117 283 5.0E-17
sp|B7UPD9|RL1_ECO27 50S ribosomal protein L1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplA PE=3 SV=1 72 275 5.0E-17
sp|Q4ZMN4|RL1_PSEU2 50S ribosomal protein L1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplA PE=3 SV=1 93 283 5.0E-17
sp|A9BR95|RL1_DELAS 50S ribosomal protein L1 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rplA PE=3 SV=1 92 284 5.0E-17
sp|Q6B906|RK1_GRATL 50S ribosomal protein L1, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rpl1 PE=3 SV=1 114 246 6.0E-17
sp|Q92QI0|RL1_RHIME 50S ribosomal protein L1 OS=Rhizobium meliloti (strain 1021) GN=rplA PE=3 SV=1 92 283 6.0E-17
sp|A8AKU2|RL1_CITK8 50S ribosomal protein L1 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rplA PE=3 SV=1 72 275 6.0E-17
sp|A5GWK1|RL1_SYNR3 50S ribosomal protein L1 OS=Synechococcus sp. (strain RCC307) GN=rplA PE=3 SV=1 78 246 6.0E-17
sp|A4VHM0|RL1_PSEU5 50S ribosomal protein L1 OS=Pseudomonas stutzeri (strain A1501) GN=rplA PE=3 SV=1 72 283 6.0E-17
sp|C4XIP2|RL1_DESMR 50S ribosomal protein L1 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rplA PE=3 SV=1 110 284 6.0E-17
sp|Q3YV00|RL1_SHISS 50S ribosomal protein L1 OS=Shigella sonnei (strain Ss046) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|Q83PC2|RL1_SHIFL 50S ribosomal protein L1 OS=Shigella flexneri GN=rplA PE=3 SV=2 72 275 7.0E-17
sp|Q0SY16|RL1_SHIF8 50S ribosomal protein L1 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|Q32AF6|RL1_SHIDS 50S ribosomal protein L1 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|Q31U13|RL1_SHIBS 50S ribosomal protein L1 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B2TWH0|RL1_SHIB3 50S ribosomal protein L1 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B7LUL8|RL1_ESCF3 50S ribosomal protein L1 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|Q1R5U9|RL1_ECOUT 50S ribosomal protein L1 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B1LNT6|RL1_ECOSM 50S ribosomal protein L1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B6I5J4|RL1_ECOSE 50S ribosomal protein L1 OS=Escherichia coli (strain SE11) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B7NFS4|RL1_ECOLU 50S ribosomal protein L1 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|P0A7L0|RL1_ECOLI 50S ribosomal protein L1 OS=Escherichia coli (strain K12) GN=rplA PE=1 SV=2 72 275 7.0E-17
sp|B1IUR3|RL1_ECOLC 50S ribosomal protein L1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|P0A7L1|RL1_ECOL6 50S ribosomal protein L1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplA PE=3 SV=2 72 275 7.0E-17
sp|Q0TA81|RL1_ECOL5 50S ribosomal protein L1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|A8A783|RL1_ECOHS 50S ribosomal protein L1 OS=Escherichia coli O9:H4 (strain HS) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B1XBY6|RL1_ECODH 50S ribosomal protein L1 OS=Escherichia coli (strain K12 / DH10B) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|C5A0S4|RL1_ECOBW 50S ribosomal protein L1 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B7M731|RL1_ECO8A 50S ribosomal protein L1 OS=Escherichia coli O8 (strain IAI1) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B7MR70|RL1_ECO81 50S ribosomal protein L1 OS=Escherichia coli O81 (strain ED1a) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B7NRR2|RL1_ECO7I 50S ribosomal protein L1 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B5Z080|RL1_ECO5E 50S ribosomal protein L1 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|P0A7L2|RL1_ECO57 50S ribosomal protein L1 OS=Escherichia coli O157:H7 GN=rplA PE=3 SV=2 72 275 7.0E-17
sp|B7LA77|RL1_ECO55 50S ribosomal protein L1 OS=Escherichia coli (strain 55989 / EAEC) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B7MIX0|RL1_ECO45 50S ribosomal protein L1 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|A7ZUJ7|RL1_ECO24 50S ribosomal protein L1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplA PE=3 SV=1 72 275 7.0E-17
sp|B3GYU5|RL1_ACTP7 50S ribosomal protein L1 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplA PE=3 SV=1 117 283 7.0E-17
sp|A3N317|RL1_ACTP2 50S ribosomal protein L1 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplA PE=3 SV=1 117 283 7.0E-17
sp|Q1GK53|RL1_RUEST 50S ribosomal protein L1 OS=Ruegeria sp. (strain TM1040) GN=rplA PE=3 SV=1 72 283 7.0E-17
sp|Q11QA2|RL1_CYTH3 50S ribosomal protein L1 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rplA PE=3 SV=1 55 283 7.0E-17
sp|A4SHU6|RL1_AERS4 50S ribosomal protein L1 OS=Aeromonas salmonicida (strain A449) GN=rplA PE=3 SV=1 72 283 7.0E-17
sp|B8DLM4|RL1_DESVM 50S ribosomal protein L1 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rplA PE=3 SV=1 92 250 8.0E-17
sp|A8G8E4|RL1_SERP5 50S ribosomal protein L1 OS=Serratia proteamaculans (strain 568) GN=rplA PE=3 SV=1 72 283 8.0E-17
sp|A0T0Q6|RK1_THAPS 50S ribosomal protein L1, chloroplastic OS=Thalassiosira pseudonana GN=rpl1 PE=3 SV=1 100 246 8.0E-17
sp|C3K2Y6|RL1_PSEFS 50S ribosomal protein L1 OS=Pseudomonas fluorescens (strain SBW25) GN=rplA PE=3 SV=1 93 283 8.0E-17
sp|Q4FQH0|RL1_PSYA2 50S ribosomal protein L1 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplA PE=3 SV=1 72 283 8.0E-17
sp|A6T3L6|RL1_JANMA 50S ribosomal protein L1 OS=Janthinobacterium sp. (strain Marseille) GN=rplA PE=3 SV=1 92 283 9.0E-17
sp|Q7VJ79|RL1_HELHP 50S ribosomal protein L1 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rplA PE=3 SV=1 92 284 9.0E-17
sp|B2VG93|RL1_ERWT9 50S ribosomal protein L1 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplA PE=3 SV=1 72 283 9.0E-17
sp|A7HLB6|RL1_FERNB 50S ribosomal protein L1 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rplA PE=3 SV=1 73 252 9.0E-17
sp|Q6N4R5|RL1_RHOPA 50S ribosomal protein L1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplA PE=1 SV=3 94 282 9.0E-17
sp|B8D6V3|RL1_BUCAT 50S ribosomal protein L1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplA PE=3 SV=1 97 280 1.0E-16
sp|B8D8J9|RL1_BUCA5 50S ribosomal protein L1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplA PE=3 SV=1 97 280 1.0E-16
sp|Q4K523|RL1_PSEF5 50S ribosomal protein L1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplA PE=3 SV=1 93 283 1.0E-16
sp|Q6A6K3|RL1_PROAC 50S ribosomal protein L1 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rplA PE=3 SV=1 92 283 1.0E-16
sp|Q7N9A7|RL1_PHOLL 50S ribosomal protein L1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplA PE=3 SV=1 72 283 1.0E-16
sp|P57149|RL1_BUCAI 50S ribosomal protein L1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplA PE=3 SV=1 97 280 1.0E-16
sp|B8E0K2|RL1_DICTD 50S ribosomal protein L1 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rplA PE=3 SV=1 92 248 1.0E-16
sp|Q3MA18|RL1_ANAVT 50S ribosomal protein L1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplA PE=3 SV=1 114 246 1.0E-16
sp|B7VM73|RL1_VIBTL 50S ribosomal protein L1 OS=Vibrio tasmaniensis (strain LGP32) GN=rplA PE=3 SV=1 117 292 1.0E-16
sp|P09764|RL1_SERMA 50S ribosomal protein L1 OS=Serratia marcescens GN=rplA PE=3 SV=2 72 283 1.0E-16
sp|A5GPD4|RL1_SYNPW 50S ribosomal protein L1 OS=Synechococcus sp. (strain WH7803) GN=rplA PE=3 SV=1 92 246 1.0E-16
sp|B3QC04|RL1_RHOPT 50S ribosomal protein L1 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplA PE=3 SV=1 94 282 1.0E-16
sp|B5ZYS4|RL1_RHILW 50S ribosomal protein L1 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rplA PE=3 SV=1 73 282 1.0E-16
sp|B5YEX9|RL1_DICT6 50S ribosomal protein L1 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rplA PE=3 SV=1 92 248 1.0E-16
sp|Q889Y1|RL1_PSESM 50S ribosomal protein L1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplA PE=3 SV=1 93 283 1.0E-16
sp|Q8KA67|RL1_BUCAP 50S ribosomal protein L1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplA PE=3 SV=1 97 283 1.0E-16
sp|O32614|RL1_HAEDU 50S ribosomal protein L1 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplA PE=3 SV=2 117 247 2.0E-16
sp|Q7MX30|RL1_PORGI 50S ribosomal protein L1 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rplA PE=3 SV=1 92 290 2.0E-16
sp|B2RL48|RL1_PORG3 50S ribosomal protein L1 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rplA PE=3 SV=1 92 290 2.0E-16
sp|Q1Q8P6|RL1_PSYCK 50S ribosomal protein L1 OS=Psychrobacter cryohalolentis (strain K5) GN=rplA PE=3 SV=1 72 283 2.0E-16
sp|O78413|RK1_GUITH 50S ribosomal protein L1, chloroplastic OS=Guillardia theta GN=rpl1 PE=3 SV=1 43 246 2.0E-16
sp|Q3AGT0|RL1_SYNSC 50S ribosomal protein L1 OS=Synechococcus sp. (strain CC9605) GN=rplA PE=3 SV=1 92 246 2.0E-16
sp|Q9LE95|RK1_SPIOL 50S ribosomal protein L1, chloroplastic OS=Spinacia oleracea GN=RPL1 PE=1 SV=1 114 283 2.0E-16
sp|Q9HWC6|RL1_PSEAE 50S ribosomal protein L1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplA PE=3 SV=1 72 283 2.0E-16
sp|Q02T90|RL1_PSEAB 50S ribosomal protein L1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplA PE=3 SV=1 72 283 2.0E-16
sp|B7V634|RL1_PSEA8 50S ribosomal protein L1 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplA PE=3 SV=1 72 283 2.0E-16
sp|A6UZH8|RL1_PSEA7 50S ribosomal protein L1 OS=Pseudomonas aeruginosa (strain PA7) GN=rplA PE=3 SV=1 72 283 2.0E-16
sp|Q5NID5|RL1_FRATT 50S ribosomal protein L1 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplA PE=3 SV=1 117 283 2.0E-16
sp|A0Q870|RL1_FRATN 50S ribosomal protein L1 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplA PE=3 SV=1 117 283 2.0E-16
sp|B2SFD3|RL1_FRATM 50S ribosomal protein L1 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplA PE=3 SV=1 117 283 2.0E-16
sp|A7NEC3|RL1_FRATF 50S ribosomal protein L1 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplA PE=3 SV=1 117 283 2.0E-16
sp|Q14JT8|RL1_FRAT1 50S ribosomal protein L1 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplA PE=3 SV=1 117 283 2.0E-16
sp|Q0BKC1|RL1_FRATO 50S ribosomal protein L1 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplA PE=3 SV=1 117 283 2.0E-16
sp|A1AX78|RL1_RUTMC 50S ribosomal protein L1 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rplA PE=3 SV=1 73 283 2.0E-16
sp|C1DAQ7|RL1_LARHH 50S ribosomal protein L1 OS=Laribacter hongkongensis (strain HLHK9) GN=rplA PE=3 SV=1 92 285 2.0E-16
sp|Q4L3J7|RL1_STAHJ 50S ribosomal protein L1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplA PE=3 SV=1 55 246 2.0E-16
sp|Q17VN3|RL1_HELAH 50S ribosomal protein L1 OS=Helicobacter acinonychis (strain Sheeba) GN=rplA PE=3 SV=1 92 284 2.0E-16
sp|Q2A1M4|RL1_FRATH 50S ribosomal protein L1 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplA PE=3 SV=1 117 283 2.0E-16
sp|C6DHR2|RL1_PECCP 50S ribosomal protein L1 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplA PE=3 SV=1 72 283 3.0E-16
sp|A8YTE3|RL1_LACH4 50S ribosomal protein L1 OS=Lactobacillus helveticus (strain DPC 4571) GN=rplA PE=3 SV=1 73 288 3.0E-16
sp|Q31QK4|RL1_SYNE7 50S ribosomal protein L1 OS=Synechococcus elongatus (strain PCC 7942) GN=rplA PE=3 SV=1 78 288 3.0E-16
sp|A4IW96|RL1_FRATW 50S ribosomal protein L1 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplA PE=3 SV=1 117 283 3.0E-16
sp|Q492B6|RL1_BLOPB 50S ribosomal protein L1 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplA PE=3 SV=1 98 285 3.0E-16
sp|Q7NQE3|RL1_CHRVO 50S ribosomal protein L1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rplA PE=3 SV=1 92 247 3.0E-16
sp|P49544|RK1_ODOSI 50S ribosomal protein L1, chloroplastic OS=Odontella sinensis GN=rpl1 PE=3 SV=1 114 251 3.0E-16
sp|B3WA08|RL1_LACCB 50S ribosomal protein L1 OS=Lactobacillus casei (strain BL23) GN=rplA PE=3 SV=1 55 246 3.0E-16
sp|Q035U9|RL1_LACC3 50S ribosomal protein L1 OS=Lactobacillus casei (strain ATCC 334) GN=rplA PE=3 SV=1 55 246 3.0E-16
sp|A4W5A4|RL1_ENT38 50S ribosomal protein L1 OS=Enterobacter sp. (strain 638) GN=rplA PE=3 SV=1 72 283 3.0E-16
sp|Q89B17|RL1_BUCBP 50S ribosomal protein L1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplA PE=3 SV=1 97 285 3.0E-16
sp|A4XZA0|RL1_PSEMY 50S ribosomal protein L1 OS=Pseudomonas mendocina (strain ymp) GN=rplA PE=3 SV=1 93 283 3.0E-16
sp|Q5N3N8|RL1_SYNP6 50S ribosomal protein L1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplA PE=3 SV=1 78 288 3.0E-16
sp|Q2GA44|RL1_NOVAD 50S ribosomal protein L1 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplA PE=3 SV=1 93 283 3.0E-16
sp|B8J1A5|RL1_DESDA 50S ribosomal protein L1 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rplA PE=3 SV=1 94 250 3.0E-16
sp|B8GV68|RL1_THISH 50S ribosomal protein L1 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplA PE=3 SV=1 92 283 4.0E-16
sp|A2SLG8|RL1_METPP 50S ribosomal protein L1 OS=Methylibium petroleiphilum (strain PM1) GN=rplA PE=3 SV=1 73 247 4.0E-16
sp|A8ZUU6|RL1_DESOH 50S ribosomal protein L1 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rplA PE=3 SV=1 97 291 4.0E-16
sp|Q6DAN3|RL1_PECAS 50S ribosomal protein L1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplA PE=3 SV=1 72 283 4.0E-16
sp|B8CNC2|RL1_SHEPW 50S ribosomal protein L1 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplA PE=3 SV=1 117 242 4.0E-16
sp|Q5FM22|RL1_LACAC 50S ribosomal protein L1 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rplA PE=3 SV=1 73 288 4.0E-16
sp|Q8A466|RL1_BACTN 50S ribosomal protein L1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rplA PE=3 SV=1 73 289 4.0E-16
sp|Q8G4T3|RL1_BIFLO 50S ribosomal protein L1 OS=Bifidobacterium longum (strain NCC 2705) GN=rplA PE=3 SV=1 100 251 5.0E-16
sp|B3DPT0|RL1_BIFLD 50S ribosomal protein L1 OS=Bifidobacterium longum (strain DJO10A) GN=rplA PE=3 SV=1 100 251 5.0E-16
sp|Q8F0R9|RL1_LEPIN 50S ribosomal protein L1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rplA PE=3 SV=1 83 247 5.0E-16
sp|Q72UB1|RL1_LEPIC 50S ribosomal protein L1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rplA PE=3 SV=1 83 247 5.0E-16
sp|A9IJ30|RL1_BORPD 50S ribosomal protein L1 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rplA PE=3 SV=1 92 247 5.0E-16
sp|A2CDE8|RL1_PROM3 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9303) GN=rplA PE=3 SV=2 65 292 5.0E-16
sp|Q7V478|RL1_PROMM 50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9313) GN=rplA PE=3 SV=1 65 292 5.0E-16
sp|Q9PK77|RL1_CHLMU 50S ribosomal protein L1 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rplA PE=3 SV=1 55 284 5.0E-16
sp|B9JDR8|RL1_AGRRK 50S ribosomal protein L1 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rplA PE=3 SV=1 73 282 5.0E-16
sp|B9KBJ8|RL1_THENN 50S ribosomal protein L1 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rplA PE=3 SV=1 92 283 5.0E-16
sp|Q0K603|RL1_CUPNH 50S ribosomal protein L1 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplA PE=3 SV=1 92 277 6.0E-16
sp|B7GNJ5|RL1_BIFLS 50S ribosomal protein L1 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rplA PE=3 SV=1 100 251 6.0E-16
sp|Q7U3T7|RL1_SYNPX 50S ribosomal protein L1 OS=Synechococcus sp. (strain WH8102) GN=rplA PE=3 SV=1 92 246 6.0E-16
sp|C5BPQ3|RL1_TERTT 50S ribosomal protein L1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplA PE=3 SV=1 61 283 6.0E-16
sp|A0T0C1|RK1_PHATC 50S ribosomal protein L1, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpl1 PE=3 SV=1 114 246 9.0E-16
sp|B3R7T9|RL1_CUPTR 50S ribosomal protein L1 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rplA PE=3 SV=1 92 283 1.0E-15
sp|A1T4H1|RL1_MYCVP 50S ribosomal protein L1 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rplA PE=3 SV=1 82 288 1.0E-15
sp|P48125|RK1_CYAPA 50S ribosomal protein L1, cyanelle OS=Cyanophora paradoxa GN=rpl1 PE=3 SV=1 114 246 1.0E-15
sp|A1TVT3|RL1_ACIAC 50S ribosomal protein L1 OS=Acidovorax citrulli (strain AAC00-1) GN=rplA PE=3 SV=1 76 284 1.0E-15
sp|B5ELW9|RL1_ACIF5 50S ribosomal protein L1 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rplA PE=3 SV=1 92 283 1.0E-15
sp|B7J456|RL1_ACIF2 50S ribosomal protein L1 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rplA PE=3 SV=1 92 283 1.0E-15
sp|Q1LI17|RL1_CUPMC 50S ribosomal protein L1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rplA PE=3 SV=1 92 277 1.0E-15
sp|P51338|RK1_PORPU 50S ribosomal protein L1, chloroplastic OS=Porphyra purpurea GN=rpl1 PE=3 SV=1 66 283 1.0E-15
sp|C0ZIG6|RL1_BREBN 50S ribosomal protein L1 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rplA PE=3 SV=1 55 277 1.0E-15
sp|C5CKF0|RL1_VARPS 50S ribosomal protein L1 OS=Variovorax paradoxus (strain S110) GN=rplA PE=3 SV=1 92 284 2.0E-15
sp|Q7W0S2|RL1_BORPE 50S ribosomal protein L1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplA PE=3 SV=1 92 247 2.0E-15
sp|Q7W2H2|RL1_BORPA 50S ribosomal protein L1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rplA PE=3 SV=1 92 247 2.0E-15
sp|Q7WRE2|RL1_BORBR 50S ribosomal protein L1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rplA PE=3 SV=1 92 247 2.0E-15
sp|Q2YB08|RL1_NITMU 50S ribosomal protein L1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rplA PE=3 SV=1 73 247 2.0E-15
sp|Q2L2N3|RL1_BORA1 50S ribosomal protein L1 OS=Bordetella avium (strain 197N) GN=rplA PE=3 SV=1 92 247 2.0E-15
sp|Q1XDE9|RK1_PYRYE 50S ribosomal protein L1, chloroplastic OS=Pyropia yezoensis GN=rpl1 PE=3 SV=1 66 283 2.0E-15
sp|C5CGE2|RL1_KOSOT 50S ribosomal protein L1 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rplA PE=3 SV=1 93 283 2.0E-15
sp|Q7NK78|RL1_GLOVI 50S ribosomal protein L1 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplA PE=3 SV=1 83 246 2.0E-15
sp|Q46WD1|RL1_CUPPJ 50S ribosomal protein L1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rplA PE=3 SV=1 92 277 2.0E-15
sp|A0ZZZ6|RL1_BIFAA 50S ribosomal protein L1 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rplA PE=3 SV=1 98 251 2.0E-15
sp|P36236|RL1_SYNY3 50S ribosomal protein L1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplA PE=3 SV=1 82 246 2.0E-15
sp|A1WCN2|RL1_ACISJ 50S ribosomal protein L1 OS=Acidovorax sp. (strain JS42) GN=rplA PE=3 SV=1 92 284 2.0E-15
sp|B9MH50|RL1_ACIET 50S ribosomal protein L1 OS=Acidovorax ebreus (strain TPSY) GN=rplA PE=3 SV=1 92 284 2.0E-15
sp|Q74L13|RL1_LACJO 50S ribosomal protein L1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplA PE=3 SV=1 73 288 2.0E-15
sp|Q01VA8|RL1_SOLUE 50S ribosomal protein L1 OS=Solibacter usitatus (strain Ellin6076) GN=rplA PE=3 SV=1 110 284 2.0E-15
sp|Q1WST3|RL1_LACS1 50S ribosomal protein L1 OS=Lactobacillus salivarius (strain UCC118) GN=rplA PE=3 SV=1 98 284 2.0E-15
sp|Q255E9|RL1_CHLFF 50S ribosomal protein L1 OS=Chlamydophila felis (strain Fe/C-56) GN=rplA PE=3 SV=1 61 246 2.0E-15
sp|Q30TQ0|RL1_SULDN 50S ribosomal protein L1 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rplA PE=3 SV=1 93 247 2.0E-15
sp|B2V7M3|RL1_SULSY 50S ribosomal protein L1 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rplA PE=3 SV=1 110 283 2.0E-15
sp|Q21SF4|RL1_RHOFT 50S ribosomal protein L1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rplA PE=3 SV=1 92 283 2.0E-15
sp|Q9LY66|RK1_ARATH 50S ribosomal protein L1, chloroplastic OS=Arabidopsis thaliana GN=RPL1 PE=1 SV=1 114 283 3.0E-15
sp|Q73SG1|RL1_MYCPA 50S ribosomal protein L1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rplA PE=3 SV=1 82 288 3.0E-15
sp|A0QL66|RL1_MYCA1 50S ribosomal protein L1 OS=Mycobacterium avium (strain 104) GN=rplA PE=3 SV=1 82 288 3.0E-15
sp|Q9CE47|RL1_LACLA 50S ribosomal protein L1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplA PE=3 SV=1 96 246 3.0E-15
sp|A5CC96|RL1_ORITB 50S ribosomal protein L1 OS=Orientia tsutsugamushi (strain Boryong) GN=rplA PE=3 SV=1 54 282 3.0E-15
sp|Q5FTX4|RL1_GLUOX 50S ribosomal protein L1 OS=Gluconobacter oxydans (strain 621H) GN=rplA PE=3 SV=1 73 251 3.0E-15
sp|B1HNL5|RL1_LYSSC 50S ribosomal protein L1 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplA PE=3 SV=1 55 246 3.0E-15
sp|B0SSI7|RL1_LEPBP 50S ribosomal protein L1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rplA PE=3 SV=1 92 247 3.0E-15
sp|B0SAG4|RL1_LEPBA 50S ribosomal protein L1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rplA PE=3 SV=1 92 247 3.0E-15
sp|Q98N69|RL1_RHILO 50S ribosomal protein L1 OS=Rhizobium loti (strain MAFF303099) GN=rplA PE=3 SV=1 73 283 3.0E-15
sp|Q38V06|RL1_LACSS 50S ribosomal protein L1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rplA PE=3 SV=1 55 246 4.0E-15
sp|Q04QI6|RL1_LEPBJ 50S ribosomal protein L1 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rplA PE=3 SV=1 79 247 4.0E-15
sp|Q054E5|RL1_LEPBL 50S ribosomal protein L1 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rplA PE=3 SV=1 79 247 4.0E-15
sp|B9MJX0|RL1_CALBD 50S ribosomal protein L1 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rplA PE=3 SV=1 84 285 4.0E-15
sp|A1WK52|RL1_VEREI 50S ribosomal protein L1 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rplA PE=3 SV=1 92 284 5.0E-15
sp|A6X0A6|RL1_OCHA4 50S ribosomal protein L1 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplA PE=3 SV=1 43 283 5.0E-15
sp|Q88YW9|RL1_LACPL 50S ribosomal protein L1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rplA PE=3 SV=1 51 246 5.0E-15
sp|B7KIR7|RL1_CYAP7 50S ribosomal protein L1 OS=Cyanothece sp. (strain PCC 7424) GN=rplA PE=3 SV=1 92 246 5.0E-15
sp|Q5SLP7|RL1_THET8 50S ribosomal protein L1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rplA PE=1 SV=3 92 283 6.0E-15
sp|B0B7N4|RL1_CHLT2 50S ribosomal protein L1 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rplA PE=3 SV=1 64 284 6.0E-15
sp|Q02WD3|RL1_LACLS 50S ribosomal protein L1 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rplA PE=3 SV=1 96 246 6.0E-15
sp|A2RNF3|RL1_LACLM 50S ribosomal protein L1 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rplA PE=3 SV=1 96 246 6.0E-15
sp|Q9ZK21|RL1_HELPJ 50S ribosomal protein L1 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rplA PE=3 SV=1 55 284 7.0E-15
sp|P27150|RL1_THETH 50S ribosomal protein L1 OS=Thermus thermophilus GN=rplA PE=1 SV=3 92 283 7.0E-15
sp|Q72GV9|RL1_THET2 50S ribosomal protein L1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rplA PE=1 SV=3 92 283 7.0E-15
sp|A0RQI8|RL1_CAMFF 50S ribosomal protein L1 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rplA PE=3 SV=1 92 250 8.0E-15
sp|B3CV58|RL1_ORITI 50S ribosomal protein L1 OS=Orientia tsutsugamushi (strain Ikeda) GN=rplA PE=3 SV=1 54 283 8.0E-15
sp|Q2S902|RL1_HAHCH 50S ribosomal protein L1 OS=Hahella chejuensis (strain KCTC 2396) GN=rplA PE=3 SV=1 97 285 8.0E-15
sp|B1VAM9|RL1_PHYAS 50S ribosomal protein L1 OS=Phytoplasma australiense GN=rplA PE=3 SV=1 72 250 8.0E-15
sp|Q045W0|RL1_LACGA 50S ribosomal protein L1 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rplA PE=3 SV=1 73 288 9.0E-15
sp|Q5WZM2|RL1_LEGPL 50S ribosomal protein L1 OS=Legionella pneumophila (strain Lens) GN=rplA PE=3 SV=1 97 283 9.0E-15
sp|Q5ZYQ3|RL1_LEGPH 50S ribosomal protein L1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplA PE=3 SV=1 97 283 9.0E-15
sp|A5IHS4|RL1_LEGPC 50S ribosomal protein L1 OS=Legionella pneumophila (strain Corby) GN=rplA PE=3 SV=1 97 283 9.0E-15
sp|Q5X869|RL1_LEGPA 50S ribosomal protein L1 OS=Legionella pneumophila (strain Paris) GN=rplA PE=3 SV=1 97 283 9.0E-15
sp|A0QS46|RL1_MYCS2 50S ribosomal protein L1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rplA PE=1 SV=1 82 288 1.0E-14
sp|B0BBU9|RL1_CHLTB 50S ribosomal protein L1 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rplA PE=3 SV=1 64 284 1.0E-14
sp|Q8G066|RL1_BRUSU 50S ribosomal protein L1 OS=Brucella suis biovar 1 (strain 1330) GN=rplA PE=3 SV=1 43 283 1.0E-14
sp|A5VR18|RL1_BRUO2 50S ribosomal protein L1 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rplA PE=3 SV=1 43 283 1.0E-14
sp|C0RJL4|RL1_BRUMB 50S ribosomal protein L1 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplA PE=3 SV=1 43 283 1.0E-14
sp|A9M5R3|RL1_BRUC2 50S ribosomal protein L1 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rplA PE=3 SV=1 43 283 1.0E-14
sp|Q57CP5|RL1_BRUAB 50S ribosomal protein L1 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplA PE=3 SV=1 43 283 1.0E-14
sp|Q2YM12|RL1_BRUA2 50S ribosomal protein L1 OS=Brucella abortus (strain 2308) GN=rplA PE=3 SV=1 43 283 1.0E-14
sp|B2S690|RL1_BRUA1 50S ribosomal protein L1 OS=Brucella abortus (strain S19) GN=rplA PE=3 SV=1 43 283 1.0E-14
sp|B9E8Q9|RL1_MACCJ 50S ribosomal protein L1 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rplA PE=3 SV=1 55 246 1.0E-14
sp|Q250P7|RL1_DESHY 50S ribosomal protein L1 OS=Desulfitobacterium hafniense (strain Y51) GN=rplA PE=3 SV=1 92 283 1.0E-14
sp|B8G1V1|RL1_DESHD 50S ribosomal protein L1 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplA PE=3 SV=1 92 283 1.0E-14
sp|Q2GJ65|RL1_ANAPZ 50S ribosomal protein L1 OS=Anaplasma phagocytophilum (strain HZ) GN=rplA PE=3 SV=1 97 285 1.0E-14
sp|A1USC5|RL1_BARBK 50S ribosomal protein L1 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rplA PE=3 SV=1 48 283 1.0E-14
sp|A5FZX4|RL1_ACICJ 50S ribosomal protein L1 OS=Acidiphilium cryptum (strain JF-5) GN=rplA PE=3 SV=1 61 251 1.0E-14
sp|A1VAJ9|RL1_DESVV 50S ribosomal protein L1 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rplA PE=3 SV=1 55 283 1.0E-14
sp|Q727D0|RL1_DESVH 50S ribosomal protein L1 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rplA PE=3 SV=1 55 283 1.0E-14
sp|Q7VRP4|RL1_BLOFL 50S ribosomal protein L1 OS=Blochmannia floridanus GN=rplA PE=3 SV=1 72 247 1.0E-14
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1421 0.1157 0.0453 0.0412 0.898 0.3289 0.0358 0.0247 0.0424 0.0094

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4931
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7001
Ophiocordyceps australis map64 (Brazil) OphauB2|1934
Ophiocordyceps camponoti-floridani Ophcf2|03111
Ophiocordyceps camponoti-rufipedis Ophun1|4750
Ophiocordyceps kimflemingae Ophio5|8102
Ophiocordyceps subramaniannii Hirsu2|1700 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1700
MAPIDRCLASMARLSLSPTSFSQAARPSATSIPRFLVPALLQSRQASKVREKPKMERKGYKRRDLSKAQFPQFSL
CYAMRVLRANEVGHPPSSSKYDLCITLKTRRVGPMISDTIRLPHPLGTEWRIAVICPEDSEIAEAATAAGAVAVG
EESIFAAVREGDVTFDRLICHESSERALQKAMLGKILGPKGLMPHRRNGTVTKNVVHAIKNSADEMGYREHVGVI
RVAIGRLSFTPQQLKANIQALVGQVKSKCEELSTSVGAPKRVHEVILSSTHGSALSLNSLVRDEEKDLPMEAVTG
PI*
Coding >Hirsu2|1700
ATGGCTCCAATCGACCGTTGCCTGGCCTCCATGGCCAGGCTGAGCCTCTCGCCGACGTCGTTTTCACAGGCGGCG
CGGCCGTCGGCGACGTCGATACCTCGTTTTCTGGTCCCGGCCCTGCTGCAGAGCCGGCAGGCGTCCAAGGTCAGG
GAGAAGCCGAAGATGGAGCGCAAGGGCTACAAACGGCGTGATCTCTCCAAAGCTCAGTTTCCTCAGTTTTCTCTC
TGCTACGCTATGAGAGTCCTTCGCGCGAACGAGGTCGGGCATCCGCCGTCCTCCAGCAAGTACGACCTGTGCATC
ACGCTCAAGACGCGCCGCGTCGGCCCCATGATCAGCGACACCATACGGCTCCCGCACCCCCTCGGGACCGAGTGG
CGGATCGCCGTCATCTGCCCCGAGGACAGCGAGATAGCCGAGGCGGCCACGGCGGCGGGAGCCGTCGCCGTCGGC
GAAGAGAGCATCTTCGCGGCCGTGCGAGAGGGAGACGTCACGTTCGACCGCCTCATCTGCCACGAGTCGAGCGAG
CGTGCCCTCCAAAAGGCCATGCTCGGCAAGATCCTGGGCCCCAAGGGCCTGATGCCTCACAGGCGAAACGGCACG
GTGACGAAGAACGTGGTGCACGCGATCAAGAATTCGGCCGACGAGATGGGCTATCGCGAGCATGTGGGCGTCATC
CGCGTGGCCATCGGACGGCTGAGCTTCACGCCGCAGCAGCTCAAGGCCAACATCCAAGCATTGGTCGGGCAGGTC
AAGTCGAAGTGTGAAGAGCTCTCGACGTCGGTGGGAGCGCCCAAGAGGGTGCACGAGGTGATTCTAAGCTCGACG
CACGGCTCTGCTCTCAGCTTGAACAGCCTGGTGAGGGACGAAGAGAAGGACCTCCCGATGGAGGCCGTTACCGGC
CCCATCTAG
Transcript >Hirsu2|1700
ATGGCTCCAATCGACCGTTGCCTGGCCTCCATGGCCAGGCTGAGCCTCTCGCCGACGTCGTTTTCACAGGCGGCG
CGGCCGTCGGCGACGTCGATACCTCGTTTTCTGGTCCCGGCCCTGCTGCAGAGCCGGCAGGCGTCCAAGGTCAGG
GAGAAGCCGAAGATGGAGCGCAAGGGCTACAAACGGCGTGATCTCTCCAAAGCTCAGTTTCCTCAGTTTTCTCTC
TGCTACGCTATGAGAGTCCTTCGCGCGAACGAGGTCGGGCATCCGCCGTCCTCCAGCAAGTACGACCTGTGCATC
ACGCTCAAGACGCGCCGCGTCGGCCCCATGATCAGCGACACCATACGGCTCCCGCACCCCCTCGGGACCGAGTGG
CGGATCGCCGTCATCTGCCCCGAGGACAGCGAGATAGCCGAGGCGGCCACGGCGGCGGGAGCCGTCGCCGTCGGC
GAAGAGAGCATCTTCGCGGCCGTGCGAGAGGGAGACGTCACGTTCGACCGCCTCATCTGCCACGAGTCGAGCGAG
CGTGCCCTCCAAAAGGCCATGCTCGGCAAGATCCTGGGCCCCAAGGGCCTGATGCCTCACAGGCGAAACGGCACG
GTGACGAAGAACGTGGTGCACGCGATCAAGAATTCGGCCGACGAGATGGGCTATCGCGAGCATGTGGGCGTCATC
CGCGTGGCCATCGGACGGCTGAGCTTCACGCCGCAGCAGCTCAAGGCCAACATCCAAGCATTGGTCGGGCAGGTC
AAGTCGAAGTGTGAAGAGCTCTCGACGTCGGTGGGAGCGCCCAAGAGGGTGCACGAGGTGATTCTAAGCTCGACG
CACGGCTCTGCTCTCAGCTTGAACAGCCTGGTGAGGGACGAAGAGAAGGACCTCCCGATGGAGGCCGTTACCGGC
CCCATCTAG
Gene >Hirsu2|1700
ATGGCTCCAATCGACCGTTGCCTGGCCTCCATGGCCAGGCTGAGCCTCTCGCCGACGTCGTTTTCACAGGCGGCG
CGGCCGTCGGCGACGTCGATACCTCGTTTTCTGGTCCCGGCCCTGCTGCAGAGCCGGCAGGCGTCCAAGGTCAGG
GAGAAGCCGAAGATGGAGCGCAAGGGCTACAAACGGCGTGATCTCTCCAAAGCTCAGTTTCCTCAGTTTTCTCTC
TGCTACGCTATGAGGTGAGGAACTTGTCCCGGGCGCCGAAAGACTTGCCCTCCCCCCCGGGGGTCGTTACTGATA
GATCTCGCACAGAGTCCTTCGCGCGAACGAGGTCGGGCATCCGCCGTCCTCCAGCAAGTACGACCTGTGCATCAC
GCTCAAGACGCGCCGCGTCGGCCCCATGATCAGCGACACCATACGGCTCCCGCACCCCCTCGGGACCGAGTGGCG
GATCGCCGTCATCTGCCCCGAGGACAGCGAGATAGCCGAGGCGGCCACGGCGGCGGGAGCCGTCGCCGTCGGCGA
AGAGAGCATCTTCGCGGCCGTGCGAGAGGGAGACGTCACGTTCGACCGCCTCATCTGCCACGAGTCGAGCGAGCG
TGCCCTCCAAAAGGCCATGCTCGGCAAGATCCTGGGCCCCAAGGGCCTGATGCCTCACAGGCGAAACGGCACGGT
GACGAAGAACGTGGTGCACGCGATCAAGAATTCGGCCGACGAGATGGGCTATCGCGAGCATGTGGGCGTCATCCG
CGTGGCCATCGGACGGCTGAGCTTCACGCCGCAGCAGCTCAAGGCCAACATCCAAGCATTGGTCGGGCAGGTCAA
GTCGAAGTGTGAAGAGCTCTCGACGTCGGTGGGAGCGCCCAAGAGGGTGCACGAGGTGATTCTAAGCTCGACGCA
CGGCTCTGCTCTCAGCTTGAACAGCCTGGTGAGGGACGAAGAGAAGGACCTCCCGATGGAGGCCGTTACCGGCCC
CATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail