Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1699
Gene name
LocationContig_1385:52..2015
Strand-
Gene length (bp)1963
Transcript length (bp)1893
Coding sequence length (bp)1893
Protein length (aa) 631

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain 5.2E-102 114 419
PF03950 tRNA-synt_1c_C tRNA synthetases class I (E and Q), anti-codon binding domain 1.7E-36 423 600

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13775|SYEC_SCHPO Probable glutamate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gus1 PE=1 SV=1 10 628 0.0E+00
sp|P46655|SYEC_YEAST Glutamate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUS1 PE=1 SV=3 16 628 0.0E+00
sp|O82462|SYEC_ARATH Glutamate--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At5g26707 PE=1 SV=1 27 630 4.0E-177
sp|Q8CGC7|SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus GN=Eprs PE=1 SV=4 1 628 5.0E-161
sp|Q54KB8|SYEC_DICDI Probable glutamate--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=gluS PE=2 SV=1 24 626 1.0E-160
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13775|SYEC_SCHPO Probable glutamate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gus1 PE=1 SV=1 10 628 0.0E+00
sp|P46655|SYEC_YEAST Glutamate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUS1 PE=1 SV=3 16 628 0.0E+00
sp|O82462|SYEC_ARATH Glutamate--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At5g26707 PE=1 SV=1 27 630 4.0E-177
sp|Q8CGC7|SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus GN=Eprs PE=1 SV=4 1 628 5.0E-161
sp|Q54KB8|SYEC_DICDI Probable glutamate--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=gluS PE=2 SV=1 24 626 1.0E-160
sp|P07814|SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens GN=EPRS PE=1 SV=5 1 628 1.0E-160
sp|P28668|SYEP_DROME Bifunctional glutamate/proline--tRNA ligase OS=Drosophila melanogaster GN=Aats-glupro PE=1 SV=2 39 628 3.0E-145
sp|Q8SSE4|SYEC_ENCCU Probable glutamate--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_1210 PE=3 SV=1 68 600 3.0E-139
sp|A9CSZ1|SYEC_ENTBH Probable glutamate--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22577 PE=3 SV=1 75 604 4.0E-126
sp|C4VBI7|SYEC_NOSCE Probable glutamate--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_102160 PE=3 SV=1 115 600 2.0E-117
sp|P57847|SYQ_PASMU Glutamine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=glnS PE=3 SV=1 113 600 4.0E-92
sp|Q0SVB1|SYQ_CLOPS Glutamine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=glnS PE=3 SV=1 114 600 3.0E-91
sp|A6VP11|SYQ_ACTSZ Glutamine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=glnS PE=3 SV=1 113 600 1.0E-90
sp|Q4QK64|SYQ_HAEI8 Glutamine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=glnS PE=3 SV=1 85 600 2.0E-90
sp|Q0TTG1|SYQ_CLOP1 Glutamine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=glnS PE=3 SV=1 114 600 2.0E-90
sp|Q7MMQ4|SYQ_VIBVY Glutamine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=glnS PE=3 SV=1 113 600 2.0E-90
sp|Q8XMP3|SYQ_CLOPE Glutamine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=glnS PE=3 SV=1 114 600 3.0E-90
sp|P43831|SYQ_HAEIN Glutamine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glnS PE=3 SV=1 85 600 5.0E-90
sp|Q66DC5|SYQ_YERPS Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glnS PE=3 SV=1 113 600 9.0E-90
sp|A4TNX8|SYQ_YERPP Glutamine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=glnS PE=3 SV=1 113 600 9.0E-90
sp|Q1CKN4|SYQ_YERPN Glutamine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=glnS PE=3 SV=1 113 600 9.0E-90
sp|A9R7G5|SYQ_YERPG Glutamine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=glnS PE=3 SV=1 113 600 9.0E-90
sp|Q8ZDD9|SYQ_YERPE Glutamine--tRNA ligase OS=Yersinia pestis GN=glnS PE=3 SV=1 113 600 9.0E-90
sp|B2K8A4|SYQ_YERPB Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=glnS PE=3 SV=1 113 600 9.0E-90
sp|Q1C540|SYQ_YERPA Glutamine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=glnS PE=3 SV=1 113 600 9.0E-90
sp|A7FKU1|SYQ_YERP3 Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=glnS PE=3 SV=1 113 600 9.0E-90
sp|B1JG85|SYQ_YERPY Glutamine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=glnS PE=3 SV=1 113 600 1.0E-89
sp|B5XZG7|SYQ_KLEP3 Glutamine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=glnS PE=3 SV=1 114 600 8.0E-89
sp|A7MQT2|SYQ_CROS8 Glutamine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=glnS PE=3 SV=1 114 600 9.0E-89
sp|A6T6C3|SYQ_KLEP7 Glutamine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=glnS PE=3 SV=1 114 600 2.0E-88
sp|A7MT45|SYQ_VIBCB Glutamine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=glnS PE=3 SV=1 113 600 2.0E-88
sp|Q87RG4|SYQ_VIBPA Glutamine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glnS PE=3 SV=1 113 600 2.0E-88
sp|A1JQH0|SYQ_YERE8 Glutamine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=glnS PE=3 SV=1 113 600 2.0E-88
sp|Q324M4|SYQ_SHIBS Glutamine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=glnS PE=3 SV=1 114 600 3.0E-88
sp|Q6LTD1|SYQ_PHOPR Glutamine--tRNA ligase OS=Photobacterium profundum GN=glnS PE=3 SV=1 112 600 4.0E-88
sp|Q1REN7|SYQ_ECOUT Glutamine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=glnS PE=3 SV=1 114 600 4.0E-88
sp|Q8FJW4|SYQ_ECOL6 Glutamine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glnS PE=3 SV=3 114 600 4.0E-88
sp|Q0TK03|SYQ_ECOL5 Glutamine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glnS PE=3 SV=1 114 600 4.0E-88
sp|A1A8U7|SYQ_ECOK1 Glutamine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=glnS PE=3 SV=1 114 600 4.0E-88
sp|B7MPI5|SYQ_ECO81 Glutamine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=glnS PE=3 SV=1 114 600 4.0E-88
sp|B7MFU7|SYQ_ECO45 Glutamine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glnS PE=3 SV=1 114 600 4.0E-88
sp|B7UKW1|SYQ_ECO27 Glutamine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glnS PE=3 SV=1 114 600 4.0E-88
sp|Q83LY4|SYQ_SHIFL Glutamine--tRNA ligase OS=Shigella flexneri GN=glnS PE=3 SV=1 114 600 4.0E-88
sp|Q0T6S8|SYQ_SHIF8 Glutamine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=glnS PE=3 SV=1 114 600 4.0E-88
sp|Q32IQ0|SYQ_SHIDS Glutamine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glnS PE=3 SV=1 114 600 7.0E-88
sp|B2TU51|SYQ_SHIB3 Glutamine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glnS PE=3 SV=1 114 600 8.0E-88
sp|B6EHL7|SYQ_ALISL Glutamine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=glnS PE=3 SV=1 113 600 9.0E-88
sp|B5YQM4|SYQ_ECO5E Glutamine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glnS PE=3 SV=1 114 600 1.0E-87
sp|Q8X9H8|SYQ_ECO57 Glutamine--tRNA ligase OS=Escherichia coli O157:H7 GN=glnS PE=3 SV=3 114 600 1.0E-87
sp|Q3Z4C0|SYQ_SHISS Glutamine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=glnS PE=3 SV=1 114 600 1.0E-87
sp|B6HYN9|SYQ_ECOSE Glutamine--tRNA ligase OS=Escherichia coli (strain SE11) GN=glnS PE=3 SV=1 114 600 1.0E-87
sp|P00962|SYQ_ECOLI Glutamine--tRNA ligase OS=Escherichia coli (strain K12) GN=glnS PE=1 SV=3 114 600 1.0E-87
sp|B1IY48|SYQ_ECOLC Glutamine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glnS PE=3 SV=1 114 600 1.0E-87
sp|A7ZXU0|SYQ_ECOHS Glutamine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=glnS PE=3 SV=1 114 600 1.0E-87
sp|B1X6L3|SYQ_ECODH Glutamine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=glnS PE=3 SV=1 114 600 1.0E-87
sp|C4ZWF6|SYQ_ECOBW Glutamine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glnS PE=3 SV=1 114 600 1.0E-87
sp|B7M5J8|SYQ_ECO8A Glutamine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=glnS PE=3 SV=1 114 600 1.0E-87
sp|B7L9L7|SYQ_ECO55 Glutamine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=glnS PE=3 SV=1 114 600 1.0E-87
sp|A7ZJ63|SYQ_ECO24 Glutamine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glnS PE=3 SV=1 114 600 1.0E-87
sp|B7LKT3|SYQ_ESCF3 Glutamine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=glnS PE=3 SV=1 114 600 2.0E-87
sp|B1LLC4|SYQ_ECOSM Glutamine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glnS PE=3 SV=1 114 600 2.0E-87
sp|B7N9S6|SYQ_ECOLU Glutamine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=glnS PE=3 SV=1 114 600 2.0E-87
sp|B7NMN1|SYQ_ECO7I Glutamine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glnS PE=3 SV=1 114 600 2.0E-87
sp|C6DBY6|SYQ_PECCP Glutamine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=glnS PE=3 SV=1 114 601 2.0E-87
sp|B5FC12|SYQ_VIBFM Glutamine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=glnS PE=3 SV=1 113 600 2.0E-87
sp|Q5E6P2|SYQ_VIBF1 Glutamine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glnS PE=3 SV=1 113 600 2.0E-87
sp|B4EV71|SYQ_PROMH Glutamine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=glnS PE=3 SV=1 113 601 3.0E-87
sp|A4W846|SYQ_ENT38 Glutamine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=glnS PE=3 SV=1 114 600 5.0E-87
sp|Q6D7J7|SYQ_PECAS Glutamine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glnS PE=3 SV=1 114 601 5.0E-87
sp|A8GB43|SYQ_SERP5 Glutamine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=glnS PE=3 SV=1 112 600 6.0E-87
sp|Q57RP8|SYQ_SALCH Glutamine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=glnS PE=3 SV=1 114 600 7.0E-87
sp|Q7N743|SYQ_PHOLL Glutamine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=glnS PE=3 SV=1 113 600 9.0E-87
sp|Q8ZQX5|SYQ_SALTY Glutamine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glnS PE=3 SV=3 114 600 1.0E-86
sp|B5BCC3|SYQ_SALPK Glutamine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=glnS PE=3 SV=1 114 600 1.0E-86
sp|C0PWA7|SYQ_SALPC Glutamine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=glnS PE=3 SV=1 114 600 1.0E-86
sp|Q5PCH8|SYQ_SALPA Glutamine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glnS PE=3 SV=1 114 600 1.0E-86
sp|B4TB84|SYQ_SALHS Glutamine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=glnS PE=3 SV=1 114 600 1.0E-86
sp|B5R651|SYQ_SALG2 Glutamine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=glnS PE=3 SV=1 114 600 1.0E-86
sp|B5QWD0|SYQ_SALEP Glutamine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=glnS PE=3 SV=1 114 600 1.0E-86
sp|B5FNC1|SYQ_SALDC Glutamine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=glnS PE=3 SV=1 114 600 1.0E-86
sp|B5EZC3|SYQ_SALA4 Glutamine--tRNA ligase OS=Salmonella agona (strain SL483) GN=glnS PE=3 SV=1 114 600 1.0E-86
sp|B4TQ00|SYQ_SALSV Glutamine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=glnS PE=3 SV=1 114 600 1.0E-86
sp|B0U6D0|SYQ_XYLFM Glutamine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=glnS PE=3 SV=1 110 601 2.0E-86
sp|Q2NUP0|SYQ_SODGM Glutamine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=glnS PE=3 SV=1 113 600 2.0E-86
sp|B4SYN9|SYQ_SALNS Glutamine--tRNA ligase OS=Salmonella newport (strain SL254) GN=glnS PE=3 SV=1 114 600 3.0E-86
sp|Q87DU6|SYQ_XYLFT Glutamine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=glnS PE=3 SV=1 110 601 3.0E-86
sp|A5N6Y3|SYQ_CLOK5 Glutamine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glnS PE=3 SV=1 104 600 4.0E-86
sp|Q188C8|SYQ_PEPD6 Glutamine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=glnS PE=3 SV=1 104 600 4.0E-86
sp|Q7VLM3|SYQ_HAEDU Glutamine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=glnS PE=3 SV=1 113 600 5.0E-86
sp|Q8Z8F8|SYQ_SALTI Glutamine--tRNA ligase OS=Salmonella typhi GN=glnS PE=3 SV=3 114 600 5.0E-86
sp|A8AJD6|SYQ_CITK8 Glutamine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glnS PE=3 SV=1 114 600 7.0E-86
sp|A9MUG5|SYQ_SALPB Glutamine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glnS PE=3 SV=1 114 600 3.0E-85
sp|Q7NX86|SYQ_CHRVO Glutamine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=glnS PE=3 SV=1 113 601 1.0E-84
sp|Q1QMM1|SYQ_NITHX Glutamine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=glnS PE=3 SV=1 112 601 1.0E-84
sp|Q15TT6|SYQ_PSEA6 Glutamine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=glnS PE=3 SV=1 112 601 2.0E-84
sp|B7VIH6|SYQ_VIBTL Glutamine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=glnS PE=3 SV=1 110 600 2.0E-84
sp|P57000|SYQ_NEIMA Glutamine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=glnS PE=3 SV=1 112 601 3.0E-84
sp|C3LTP5|SYQ_VIBCM Glutamine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=glnS PE=3 SV=1 114 600 3.0E-84
sp|Q9KTA6|SYQ_VIBCH Glutamine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glnS PE=3 SV=1 114 600 3.0E-84
sp|A9MKA7|SYQ_SALAR Glutamine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=glnS PE=3 SV=1 114 600 3.0E-84
sp|A5F2T1|SYQ_VIBC3 Glutamine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=glnS PE=3 SV=1 114 600 4.0E-84
sp|Q89KR6|SYQ_BRADU Glutamine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glnS PE=3 SV=1 108 601 5.0E-84
sp|C4K4J9|SYQ_HAMD5 Glutamine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=glnS PE=3 SV=1 108 601 6.0E-84
sp|Q87YQ1|SYQ_PSESM Glutamine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glnS PE=3 SV=1 114 610 7.0E-84
sp|Q9PDP1|SYQ_XYLFA Glutamine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=glnS PE=3 SV=1 110 601 1.0E-83
sp|Q1LQ72|SYQ_CUPMC Glutamine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=glnS PE=3 SV=1 114 601 3.0E-83
sp|B2VBN3|SYQ_ERWT9 Glutamine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=glnS PE=3 SV=1 108 600 6.0E-83
sp|C5BGA4|SYQ_EDWI9 Glutamine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=glnS PE=3 SV=1 113 600 2.0E-82
sp|Q7UX42|SYQ_RHOBA Glutamine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=glnS PE=3 SV=1 113 605 2.0E-82
sp|A4XVG2|SYQ_PSEMY Glutamine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=glnS PE=3 SV=1 114 600 3.0E-82
sp|Q8Y199|SYQ_RALSO Glutamine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=glnS PE=3 SV=1 114 601 3.0E-82
sp|P56927|SYQ_NEIMB Glutamine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=glnS PE=3 SV=1 108 601 3.0E-82
sp|Q5F7G0|SYQ_NEIG1 Glutamine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=glnS PE=3 SV=2 112 601 5.0E-82
sp|B1XW11|SYQ_POLNS Glutamine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=glnS PE=3 SV=1 113 610 6.0E-82
sp|B2U846|SYQ_RALPJ Glutamine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=glnS PE=3 SV=1 114 601 7.0E-82
sp|Q7W4T0|SYQ_BORPA Glutamine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glnS PE=3 SV=1 95 600 1.0E-81
sp|Q7VU94|SYQ_BORPE Glutamine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glnS PE=3 SV=1 95 600 1.0E-81
sp|Q3SRI8|SYQ_NITWN Glutamine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=glnS PE=3 SV=1 112 601 2.0E-81
sp|Q0K808|SYQ_CUPNH Glutamine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=glnS PE=3 SV=1 114 601 2.0E-81
sp|Q7WGA6|SYQ_BORBR Glutamine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glnS PE=3 SV=1 95 600 2.0E-81
sp|Q9I2U8|SYQ_PSEAE Glutamine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glnS PE=1 SV=1 114 600 4.0E-81
sp|Q02KT5|SYQ_PSEAB Glutamine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=glnS PE=3 SV=1 114 600 7.0E-81
sp|B7VB85|SYQ_PSEA8 Glutamine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=glnS PE=3 SV=1 114 600 7.0E-81
sp|B3R5N3|SYQ_CUPTR Glutamine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=glnS PE=3 SV=1 114 601 9.0E-81
sp|A4SZM1|SYQ_POLSQ Glutamine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=glnS PE=3 SV=1 113 602 1.0E-80
sp|A1SS83|SYQ_PSYIN Glutamine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=glnS PE=3 SV=1 107 600 2.0E-80
sp|Q3BX52|SYQ_XANC5 Glutamine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=glnS PE=3 SV=1 86 601 3.0E-80
sp|C4L887|SYQ_TOLAT Glutamine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=glnS PE=3 SV=1 113 603 8.0E-80
sp|Q8PCB3|SYQ_XANCP Glutamine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glnS PE=3 SV=1 113 601 2.0E-79
sp|Q4UR70|SYQ_XANC8 Glutamine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glnS PE=3 SV=1 113 601 2.0E-79
sp|A4VL72|SYQ_PSEU5 Glutamine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=glnS PE=3 SV=1 114 609 3.0E-79
sp|C1DHE5|SYQ_AZOVD Glutamine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=glnS PE=3 SV=1 99 600 3.0E-79
sp|Q8PNZ5|SYQ_XANAC Glutamine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glnS PE=3 SV=1 86 601 4.0E-79
sp|Q88IU5|SYQ_PSEPK Glutamine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=glnS PE=3 SV=1 114 600 4.0E-79
sp|Q8K9E1|SYQ_BUCAP Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=glnS PE=3 SV=2 116 600 1.0E-78
sp|Q8EG26|SYQ_SHEON Glutamine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=glnS PE=3 SV=1 113 600 1.0E-78
sp|P56926|SYQ_DEIRA Glutamine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glnS PE=1 SV=1 114 597 6.0E-78
sp|Q81ZS7|SYQ_NITEU Glutamine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=glnS1 PE=3 SV=1 104 600 8.0E-78
sp|Q5QXQ2|SYQ_IDILO Glutamine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=glnS PE=3 SV=1 114 601 1.0E-77
sp|B4RYH7|SYQ_ALTMD Glutamine--tRNA ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=glnS PE=3 SV=1 113 607 2.0E-77
sp|Q2KVX0|SYQ_BORA1 Glutamine--tRNA ligase OS=Bordetella avium (strain 197N) GN=glnS PE=3 SV=1 114 600 3.0E-77
sp|Q5GWF4|SYQ_XANOR Glutamine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=glnS PE=3 SV=1 114 600 1.0E-76
sp|Q2NZL7|SYQ_XANOM Glutamine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=glnS PE=3 SV=1 114 600 1.0E-76
sp|Q89AD4|SYQ_BUCBP Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=glnS PE=3 SV=1 114 603 5.0E-76
sp|P57490|SYQ_BUCAI Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=glnS PE=3 SV=1 96 600 7.0E-76
sp|Q3IGW8|SYQ_PSEHT Glutamine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=glnS PE=3 SV=1 116 600 1.0E-75
sp|B8D7U5|SYQ_BUCAT Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=glnS PE=3 SV=1 96 600 2.0E-75
sp|B8D9J3|SYQ_BUCA5 Glutamine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=glnS PE=3 SV=1 96 600 2.0E-75
sp|P14325|SYQ_DICDI Probable glutamine--tRNA ligase OS=Dictyostelium discoideum GN=glnS PE=2 SV=2 107 601 1.0E-71
sp|Q47Z40|SYQ_COLP3 Glutamine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=glnS PE=3 SV=1 113 483 2.0E-69
sp|Q9Y105|SYQ_DROME Probable glutamine--tRNA ligase OS=Drosophila melanogaster GN=Aats-gln PE=2 SV=1 107 600 3.0E-69
sp|P52780|SYQ_LUPLU Glutamine--tRNA ligase OS=Lupinus luteus PE=2 SV=2 107 601 4.0E-69
sp|Q8W4F3|SYQ_ARATH Glutamine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=OVA9 PE=2 SV=1 107 601 2.0E-67
sp|Q9Y7Y8|SYQ_SCHPO Probable glutamine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qrs1 PE=3 SV=1 107 486 2.0E-67
sp|P13188|SYQ_YEAST Glutamine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN4 PE=1 SV=2 80 478 3.0E-66
sp|B1L5U2|SYE_KORCO Glutamate--tRNA ligase OS=Korarchaeum cryptofilum (strain OPF8) GN=gltX PE=3 SV=1 107 601 7.0E-65
sp|O59314|SYE_PYRHO Glutamate--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gltX PE=3 SV=1 107 601 8.0E-65
sp|Q9V1E3|SYE_PYRAB Glutamate--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gltX PE=3 SV=1 107 601 1.0E-63
sp|Q5JH16|SYE_THEKO Glutamate--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gltX PE=3 SV=1 107 600 2.0E-62
sp|Q58772|SYE_METJA Glutamate--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=gltX PE=3 SV=1 105 605 6.0E-62
sp|P47897|SYQ_HUMAN Glutamine--tRNA ligase OS=Homo sapiens GN=QARS PE=1 SV=1 107 600 8.0E-62
sp|B6YSY7|SYE_THEON Glutamate--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=gltX PE=3 SV=1 107 600 1.0E-61
sp|A9A423|SYE_NITMS Glutamate--tRNA ligase OS=Nitrosopumilus maritimus (strain SCM1) GN=gltX PE=3 SV=1 107 600 3.0E-60
sp|C4V819|SYQ_NOSCE Probable glutamine--tRNA ligase OS=Nosema ceranae (strain BRL01) GN=NCER_100619 PE=3 SV=1 107 600 5.0E-60
sp|Q3MHH4|SYQ_BOVIN Glutamine--tRNA ligase OS=Bos taurus GN=QARS PE=2 SV=1 114 600 9.0E-60
sp|A9CSU5|SYQ_ENTBH Probable glutamine--tRNA ligase OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22570 PE=3 SV=1 107 600 1.0E-59
sp|O62431|SYQ_CAEEL Probable glutamine--tRNA ligase OS=Caenorhabditis elegans GN=ers-1 PE=3 SV=1 114 601 3.0E-59
sp|Q8U064|SYE_PYRFU Glutamate--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gltX PE=3 SV=2 107 605 4.0E-59
sp|Q8SR10|SYQ_ENCCU Probable glutamine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU10_1460 PE=3 SV=1 107 601 1.0E-58
sp|A9AAT7|SYE_METM6 Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=gltX PE=3 SV=1 105 605 5.0E-56
sp|Q6LYI0|SYE_METMP Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=gltX PE=3 SV=1 105 605 3.0E-55
sp|A0RY20|SYE_CENSY Glutamate--tRNA ligase OS=Cenarchaeum symbiosum (strain A) GN=gltX PE=3 SV=1 107 501 8.0E-55
sp|A6VFU7|SYE_METM7 Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=gltX PE=3 SV=1 105 605 1.0E-54
sp|A5UN79|SYE_METS3 Glutamate--tRNA ligase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=gltX PE=3 SV=1 107 605 4.0E-54
sp|A6UW15|SYE_META3 Glutamate--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=gltX PE=3 SV=1 105 605 1.0E-53
sp|A4FXG8|SYE_METM5 Glutamate--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=gltX PE=3 SV=1 105 605 4.0E-53
sp|Q50543|SYE_METTM Glutamate--tRNA ligase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=gltX PE=3 SV=1 107 622 5.0E-53
sp|Q979Q0|SYE_THEVO Glutamate--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=gltX PE=3 SV=1 76 490 3.0E-52
sp|A2BK91|SYE_HYPBU Glutamate--tRNA ligase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=gltX PE=3 SV=1 107 622 1.0E-51
sp|A0B966|SYE_METTP Glutamate--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=gltX PE=3 SV=1 73 600 4.0E-51
sp|A3CWJ3|SYE_METMJ Glutamate--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=gltX PE=3 SV=1 76 602 3.0E-50
sp|A6UP25|SYE_METVS Glutamate--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gltX PE=3 SV=1 105 605 4.0E-50
sp|Q2NFU2|SYE_METST Glutamate--tRNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=gltX PE=3 SV=1 107 605 5.0E-50
sp|O26157|SYE_METTH Glutamate--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=gltX PE=1 SV=1 114 622 1.0E-49
sp|A7IAG1|SYE_METB6 Glutamate--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=gltX PE=3 SV=1 63 478 8.0E-49
sp|Q8TT52|SYE_METAC Glutamate--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gltX PE=3 SV=2 53 600 1.0E-48
sp|Q2FTH6|SYE_METHJ Glutamate--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=gltX PE=3 SV=1 107 600 7.0E-48
sp|Q971D0|SYE_SULTO Glutamate--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gltX PE=3 SV=1 110 605 8.0E-48
sp|Q8TXB7|SYE_METKA Glutamate--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=gltX PE=3 SV=1 114 601 4.0E-47
sp|Q74MU5|SYE_NANEQ Glutamate--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=gltX PE=3 SV=1 68 482 2.0E-46
sp|Q46CG5|SYE_METBF Glutamate--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gltX PE=3 SV=1 53 605 2.0E-46
sp|A2SRG2|SYE_METLZ Glutamate--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=gltX PE=3 SV=1 107 478 7.0E-46
sp|Q9HJM5|SYE_THEAC Glutamate--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=gltX PE=3 SV=2 107 490 2.0E-45
sp|A1RYD7|SYE_THEPD Glutamate--tRNA ligase OS=Thermofilum pendens (strain Hrk 5) GN=gltX PE=3 SV=1 114 500 4.0E-44
sp|Q4J8P2|SYE_SULAC Glutamate--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gltX PE=3 SV=1 114 480 6.0E-43
sp|A4YIL8|SYE_METS5 Glutamate--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=gltX PE=3 SV=1 107 600 2.0E-42
sp|P95968|SYE_SULSO Glutamate--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gltX PE=3 SV=1 107 424 4.0E-41
sp|A3MV95|SYE_PYRCJ Glutamate--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=gltX PE=3 SV=1 77 496 5.0E-41
sp|Q9HQI1|SYE_HALSA Glutamate--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gltX PE=3 SV=1 83 604 7.0E-41
sp|B0R4Z6|SYE_HALS3 Glutamate--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=gltX PE=3 SV=1 83 604 7.0E-41
sp|A4WKI4|SYE_PYRAR Glutamate--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=gltX PE=3 SV=1 75 530 7.0E-41
sp|O29979|SYE_ARCFU Glutamate--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gltX PE=3 SV=1 71 425 3.0E-40
sp|Q8PW52|SYE_METMA Glutamate--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gltX PE=3 SV=1 70 600 3.0E-40
sp|Q0W8L2|SYE_METAR Glutamate--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=gltX PE=3 SV=1 83 600 5.0E-40
sp|Q8ZU33|SYE_PYRAE Glutamate--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=gltX PE=3 SV=1 64 496 9.0E-40
sp|A8ABI5|SYE_IGNH4 Glutamate--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=gltX PE=3 SV=1 77 495 2.0E-38
sp|A3DMR5|SYE_STAMF Glutamate--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=gltX PE=3 SV=1 66 600 1.0E-37
sp|Q18GA5|SYE_HALWD Glutamate--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=gltX PE=3 SV=1 76 600 2.0E-37
sp|Q5V5N9|SYE_HALMA Glutamate--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gltX PE=3 SV=1 114 605 3.0E-37
sp|A1RRG7|SYE_PYRIL Glutamate--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=gltX PE=3 SV=1 70 496 8.0E-37
sp|B1YAX4|SYE_PYRNV Glutamate--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=gltX PE=3 SV=1 75 531 1.0E-36
sp|Q9Y9H1|SYE_AERPE Glutamate--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gltX PE=3 SV=2 77 498 5.0E-35
sp|A8M9D7|SYE_CALMQ Glutamate--tRNA ligase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=gltX PE=3 SV=1 117 599 9.0E-35
sp|Q6L0N9|SYE_PICTO Glutamate--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=gltX PE=3 SV=1 107 419 1.0E-33
sp|Q12TN7|SYE_METBU Glutamate--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gltX PE=3 SV=1 74 563 4.0E-33
sp|Q3IPL2|SYE_NATPD Glutamate--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gltX PE=3 SV=1 105 605 3.0E-32
sp|B4U896|SYE_HYDS0 Glutamate--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=gltX PE=3 SV=1 114 354 1.0E-18
sp|O67271|SYE_AQUAE Glutamate--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=gltX PE=3 SV=1 114 397 5.0E-17
sp|Q30Y02|SYE_DESAG Glutamate--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=gltX PE=3 SV=1 114 360 2.0E-16
sp|A6Q6F9|SYE1_SULNB Glutamate--tRNA ligase 1 OS=Sulfurovum sp. (strain NBC37-1) GN=gltX1 PE=3 SV=1 115 345 2.0E-16
sp|Q30UA5|SYE1_SULDN Glutamate--tRNA ligase 1 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=gltX1 PE=3 SV=1 114 397 1.0E-15
sp|Q5F5J8|SYE_NEIG1 Glutamate--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gltX PE=3 SV=1 114 332 4.0E-15
sp|A7ZFB9|SYE2_CAMC1 Glutamate--tRNA ligase 2 OS=Campylobacter concisus (strain 13826) GN=gltX2 PE=3 SV=1 114 414 5.0E-15
sp|B4RPQ3|SYE_NEIG2 Glutamate--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gltX PE=3 SV=1 114 332 5.0E-15
sp|Q9JWT4|SYE_NEIMA Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gltX PE=3 SV=1 114 332 6.0E-15
sp|A1KWM9|SYE_NEIMF Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gltX PE=3 SV=1 114 332 6.0E-15
sp|Q47SA6|SYE_THEFY Glutamate--tRNA ligase OS=Thermobifida fusca (strain YX) GN=gltX PE=3 SV=1 110 332 6.0E-15
sp|A7H0G1|SYE2_CAMC5 Glutamate--tRNA ligase 2 OS=Campylobacter curvus (strain 525.92) GN=gltX2 PE=3 SV=1 114 397 7.0E-15
sp|Q6FZN9|SYE2_BARQU Glutamate--tRNA ligase 2 OS=Bartonella quintana (strain Toulouse) GN=gltX2 PE=3 SV=1 114 411 1.0E-14
sp|Q8G0E8|SYE2_BRUSU Glutamate--tRNA ligase 2 OS=Brucella suis biovar 1 (strain 1330) GN=gltX2 PE=3 SV=1 112 397 2.0E-14
sp|B5Y7R0|SYE_COPPD Glutamate--tRNA ligase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gltX PE=3 SV=1 114 422 2.0E-14
sp|Q9ZLZ7|SYE1_HELPJ Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gltX1 PE=3 SV=1 114 323 2.0E-14
sp|Q7MMW8|SYE_VIBVY Glutamate--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=gltX PE=3 SV=1 114 332 2.0E-14
sp|Q8DFH5|SYE_VIBVU Glutamate--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=gltX PE=3 SV=1 114 332 2.0E-14
sp|Q728Q1|SYE_DESVH Glutamate--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gltX PE=3 SV=1 114 367 2.0E-14
sp|B5YIG1|SYE_THEYD Glutamate--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=gltX PE=3 SV=1 114 368 2.0E-14
sp|A1VBA3|SYE_DESVV Glutamate--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gltX PE=3 SV=1 114 367 2.0E-14
sp|B0CGU5|SYE2_BRUSI Glutamate--tRNA ligase 2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gltX2 PE=3 SV=1 112 397 2.0E-14
sp|A5VQR9|SYE2_BRUO2 Glutamate--tRNA ligase 2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gltX2 PE=3 SV=1 112 397 2.0E-14
sp|A9M5G0|SYE2_BRUC2 Glutamate--tRNA ligase 2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gltX2 PE=3 SV=1 112 397 2.0E-14
sp|Q896M5|SYE_CLOTE Glutamate--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=gltX PE=3 SV=2 114 332 3.0E-14
sp|P96551|SYE1_HELPY Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gltX1 PE=3 SV=2 114 323 3.0E-14
sp|Q57CZ2|SYE2_BRUAB Glutamate--tRNA ligase 2 OS=Brucella abortus biovar 1 (strain 9-941) GN=gltX2 PE=3 SV=1 112 397 3.0E-14
sp|Q2YRQ9|SYE2_BRUA2 Glutamate--tRNA ligase 2 OS=Brucella abortus (strain 2308) GN=gltX2 PE=3 SV=1 112 397 3.0E-14
sp|B2S5Z7|SYE2_BRUA1 Glutamate--tRNA ligase 2 OS=Brucella abortus (strain S19) GN=gltX2 PE=3 SV=1 112 397 3.0E-14
sp|Q8YHG4|SYE1_BRUME Glutamate--tRNA ligase 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gltX1 PE=3 SV=2 112 397 3.0E-14
sp|Q2W7Y6|SYE1_MAGSA Glutamate--tRNA ligase 1 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gltX1 PE=3 SV=1 115 327 3.0E-14
sp|A9LZH6|SYE_NEIM0 Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gltX PE=3 SV=1 114 332 4.0E-14
sp|Q3SRI7|SYE_NITWN Glutamate--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gltX PE=3 SV=2 114 397 5.0E-14
sp|Q9K1R6|SYE_NEIMB Glutamate--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gltX PE=3 SV=1 114 323 7.0E-14
sp|B6JL62|SYE1_HELP2 Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain P12) GN=gltX1 PE=3 SV=1 114 323 8.0E-14
sp|Q17WW9|SYE2_HELAH Glutamate--tRNA ligase 2 OS=Helicobacter acinonychis (strain Sheeba) GN=gltX2 PE=3 SV=1 114 323 8.0E-14
sp|B5Z6J9|SYE1_HELPG Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain G27) GN=gltX1 PE=3 SV=1 114 323 1.0E-13
sp|Q1CU52|SYE1_HELPH Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain HPAG1) GN=gltX1 PE=3 SV=1 114 323 1.0E-13
sp|Q8RB93|SYE1_CALS4 Glutamate--tRNA ligase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gltX1 PE=3 SV=1 114 368 2.0E-13
sp|Q7VHN8|SYE1_HELHP Glutamate--tRNA ligase 1 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=gltX1 PE=3 SV=1 114 333 2.0E-13
sp|A8I819|SYE_AZOC5 Glutamate--tRNA ligase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gltX PE=3 SV=2 114 397 2.0E-13
sp|Q1RJC6|SYE2_RICBR Glutamate--tRNA ligase 2 OS=Rickettsia bellii (strain RML369-C) GN=gltX2 PE=3 SV=1 113 317 2.0E-13
sp|A8GX08|SYE2_RICB8 Glutamate--tRNA ligase 2 OS=Rickettsia bellii (strain OSU 85-389) GN=gltX2 PE=3 SV=2 113 317 2.0E-13
sp|Q98MD0|SYE1_RHILO Glutamate--tRNA ligase 1 OS=Rhizobium loti (strain MAFF303099) GN=gltX1 PE=3 SV=1 114 368 2.0E-13
sp|A6X0K5|SYE1_OCHA4 Glutamate--tRNA ligase 1 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gltX1 PE=3 SV=1 112 397 2.0E-13
sp|Q0BS88|SYE2_GRABC Glutamate--tRNA ligase 2 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=gltX2 PE=3 SV=1 114 401 2.0E-13
sp|O52914|SYE2_CAMJE Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gltX2 PE=3 SV=2 114 397 2.0E-13
sp|Q2LQN4|SYE1_SYNAS Glutamate--tRNA ligase 1 OS=Syntrophus aciditrophicus (strain SB) GN=gltX1 PE=3 SV=1 112 368 2.0E-13
sp|A1W0S2|SYE2_CAMJJ Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=gltX2 PE=3 SV=1 114 397 2.0E-13
sp|A8FMZ3|SYE2_CAMJ8 Glutamate--tRNA ligase 2 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=gltX2 PE=3 SV=1 114 397 2.0E-13
sp|B2UST7|SYE1_HELPS Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain Shi470) GN=gltX1 PE=3 SV=1 114 323 2.0E-13
sp|Q5HTB9|SYE2_CAMJR Glutamate--tRNA ligase 2 OS=Campylobacter jejuni (strain RM1221) GN=gltX2 PE=3 SV=1 114 397 2.0E-13
sp|A7HZN3|SYE1_CAMHC Glutamate--tRNA ligase 1 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=gltX1 PE=3 SV=1 114 397 3.0E-13
sp|B0U106|SYE_FRAP2 Glutamate--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gltX PE=3 SV=1 114 323 3.0E-13
sp|Q28L59|SYE2_JANSC Glutamate--tRNA ligase 2 OS=Jannaschia sp. (strain CCS1) GN=gltX2 PE=3 SV=1 114 402 3.0E-13
sp|B5FGU2|SYE_VIBFM Glutamate--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=gltX PE=3 SV=1 114 332 5.0E-13
sp|Q5E3L4|SYE_VIBF1 Glutamate--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gltX PE=3 SV=1 114 332 5.0E-13
sp|B0UL61|SYE2_METS4 Glutamate--tRNA ligase 2 OS=Methylobacterium sp. (strain 4-46) GN=gltX2 PE=3 SV=1 115 207 5.0E-13
sp|A7H295|SYE1_CAMJD Glutamate--tRNA ligase 1 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=gltX1 PE=3 SV=1 114 334 5.0E-13
sp|Q0A936|SYE1_ALKEH Glutamate--tRNA ligase 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gltX1 PE=3 SV=1 114 333 7.0E-13
sp|B5EEE6|SYE_GEOBB Glutamate--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gltX PE=3 SV=1 114 360 7.0E-13
sp|B0KAA6|SYE2_THEP3 Glutamate--tRNA ligase 2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gltX2 PE=3 SV=1 114 368 7.0E-13
sp|Q87RL6|SYE_VIBPA Glutamate--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gltX PE=3 SV=1 114 332 8.0E-13
sp|A7MY61|SYE_VIBCB Glutamate--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gltX PE=3 SV=1 114 332 8.0E-13
sp|B6EJQ3|SYE_ALISL Glutamate--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=gltX PE=3 SV=1 114 332 8.0E-13
sp|A5G3W1|SYE_GEOUR Glutamate--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=gltX PE=3 SV=1 114 338 8.0E-13
sp|B0K403|SYE2_THEPX Glutamate--tRNA ligase 2 OS=Thermoanaerobacter sp. (strain X514) GN=gltX2 PE=3 SV=1 114 368 9.0E-13
sp|P0C6Q1|SYE_VIBCH Glutamate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gltX PE=3 SV=1 114 323 9.0E-13
sp|A5F649|SYE_VIBC3 Glutamate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gltX PE=3 SV=2 114 323 9.0E-13
sp|A1S7Q6|SYE_SHEAM Glutamate--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gltX PE=3 SV=1 114 332 9.0E-13
sp|A5IZ19|SYE_MYCAP Glutamate--tRNA ligase OS=Mycoplasma agalactiae (strain PG2) GN=gltX PE=3 SV=1 114 369 1.0E-12
sp|Q3A413|SYE_PELCD Glutamate--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gltX PE=3 SV=1 116 368 1.0E-12
sp|Q0AUF7|SYE2_SYNWW Glutamate--tRNA ligase 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gltX2 PE=3 SV=1 114 354 1.0E-12
sp|B3PN19|SYE_MYCA5 Glutamate--tRNA ligase OS=Mycoplasma arthritidis (strain 158L3-1) GN=gltX PE=3 SV=1 112 358 1.0E-12
sp|Q39UV7|SYE_GEOMG Glutamate--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gltX PE=3 SV=1 114 332 2.0E-12
sp|B0BQK7|SYE_ACTPJ Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=gltX PE=3 SV=1 109 332 2.0E-12
sp|B3H248|SYE_ACTP7 Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=gltX PE=3 SV=1 109 332 2.0E-12
sp|A0PZ93|SYE_CLONN Glutamate--tRNA ligase OS=Clostridium novyi (strain NT) GN=gltX PE=3 SV=1 112 332 2.0E-12
sp|B2FHI7|SYE_STRMK Glutamate--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=gltX PE=3 SV=1 116 502 2.0E-12
sp|Q1QMM2|SYE_NITHX Glutamate--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gltX PE=3 SV=2 114 397 2.0E-12
sp|A3N1S5|SYE_ACTP2 Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=gltX PE=3 SV=1 109 332 2.0E-12
sp|A9ISQ6|SYE1_BART1 Glutamate--tRNA ligase 1 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gltX1 PE=3 SV=1 114 397 2.0E-12
sp|B3CST4|SYE2_ORITI Glutamate--tRNA ligase 2 OS=Orientia tsutsugamushi (strain Ikeda) GN=gltX2 PE=3 SV=2 113 368 2.0E-12
sp|B5EMF9|SYE1_ACIF5 Glutamate--tRNA ligase 1 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=gltX1 PE=3 SV=1 114 334 2.0E-12
sp|Q1GEA9|SYE2_RUEST Glutamate--tRNA ligase 2 OS=Ruegeria sp. (strain TM1040) GN=gltX2 PE=3 SV=1 114 332 2.0E-12
sp|Q2NA91|SYE1_ERYLH Glutamate--tRNA ligase 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=gltX1 PE=3 SV=2 114 319 2.0E-12
sp|Q5NL22|SYE2_ZYMMO Glutamate--tRNA ligase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gltX2 PE=3 SV=1 114 347 2.0E-12
sp|B1IIG7|SYE_CLOBK Glutamate--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=gltX PE=3 SV=1 114 332 3.0E-12
sp|A7GCD9|SYE_CLOBL Glutamate--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gltX PE=3 SV=1 114 332 3.0E-12
sp|A5I0T6|SYE_CLOBH Glutamate--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=gltX PE=3 SV=1 114 332 3.0E-12
sp|A7FSY9|SYE_CLOB1 Glutamate--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gltX PE=3 SV=1 114 332 3.0E-12
sp|A4XLI3|SYE2_CALS8 Glutamate--tRNA ligase 2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gltX2 PE=3 SV=1 114 333 3.0E-12
sp|A1USF5|SYE1_BARBK Glutamate--tRNA ligase 1 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gltX1 PE=3 SV=1 114 397 3.0E-12
sp|A7INJ6|SYE1_XANP2 Glutamate--tRNA ligase 1 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gltX1 PE=3 SV=1 114 397 3.0E-12
sp|B1KYV1|SYE_CLOBM Glutamate--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gltX PE=3 SV=1 114 332 4.0E-12
sp|A7ZCB6|SYE1_CAMC1 Glutamate--tRNA ligase 1 OS=Campylobacter concisus (strain 13826) GN=gltX1 PE=3 SV=1 117 476 4.0E-12
sp|Q74DU6|SYE_GEOSL Glutamate--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gltX PE=3 SV=1 114 332 4.0E-12
sp|B3Q6P5|SYE_RHOPT Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=gltX PE=3 SV=1 114 397 4.0E-12
sp|A0Q4G6|SYE_FRATN Glutamate--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=gltX PE=3 SV=1 114 323 4.0E-12
sp|A4YVF1|SYE_BRASO Glutamate--tRNA ligase OS=Bradyrhizobium sp. (strain ORS278) GN=gltX PE=3 SV=1 114 397 5.0E-12
sp|A8EY39|SYE1_RICCK Glutamate--tRNA ligase 1 OS=Rickettsia canadensis (strain McKiel) GN=gltX1 PE=3 SV=1 113 228 5.0E-12
sp|Q15RR1|SYE_PSEA6 Glutamate--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gltX PE=3 SV=1 115 332 5.0E-12
sp|Q3BR75|SYE_XANC5 Glutamate--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gltX PE=3 SV=1 116 338 5.0E-12
sp|B4S404|SYE_PROA2 Glutamate--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gltX PE=3 SV=1 114 530 5.0E-12
sp|B4SPM7|SYE_STRM5 Glutamate--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gltX PE=3 SV=1 116 502 6.0E-12
sp|A5N867|SYE_CLOK5 Glutamate--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=gltX PE=3 SV=1 114 332 6.0E-12
sp|A4IZU9|SYE_FRATW Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gltX PE=3 SV=1 114 323 6.0E-12
sp|B2SE01|SYE_FRATM Glutamate--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gltX PE=3 SV=1 114 323 6.0E-12
sp|Q5NHY6|SYE_FRATT Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gltX PE=3 SV=1 114 323 6.0E-12
sp|Q14JD8|SYE_FRAT1 Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gltX PE=3 SV=1 114 323 6.0E-12
sp|Q6KIT3|SYE_MYCMO Glutamate--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=gltX PE=3 SV=1 114 332 7.0E-12
sp|Q6G3V8|SYE1_BARHE Glutamate--tRNA ligase 1 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gltX1 PE=3 SV=1 114 397 7.0E-12
sp|Q0BNU3|SYE_FRATO Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gltX PE=3 SV=1 114 323 7.0E-12
sp|Q2A5I8|SYE_FRATH Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gltX PE=3 SV=1 114 323 7.0E-12
sp|A7N9Q8|SYE_FRATF Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gltX PE=3 SV=1 114 323 7.0E-12
sp|B5YEP5|SYE_DICT6 Glutamate--tRNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=gltX PE=3 SV=1 113 332 7.0E-12
sp|A6Q5I8|SYE2_NITSB Glutamate--tRNA ligase 2 OS=Nitratiruptor sp. (strain SB155-2) GN=gltX2 PE=3 SV=1 114 333 8.0E-12
sp|Q8PIP8|SYE_XANAC Glutamate--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gltX PE=3 SV=1 116 323 8.0E-12
sp|Q6N5R5|SYE_RHOPA Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gltX PE=3 SV=1 114 397 8.0E-12
sp|A9W982|SYE2_METEP Glutamate--tRNA ligase 2 OS=Methylobacterium extorquens (strain PA1) GN=gltX2 PE=3 SV=1 115 402 9.0E-12
sp|Q5FQ35|SYE2_GLUOX Glutamate--tRNA ligase 2 OS=Gluconobacter oxydans (strain 621H) GN=gltX2 PE=3 SV=1 117 405 9.0E-12
sp|Q8EYM3|SYE_LEPIN Glutamate--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gltX PE=3 SV=1 109 332 1.0E-11
sp|Q72M46|SYE_LEPIC Glutamate--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gltX PE=3 SV=1 109 332 1.0E-11
sp|Q5WVE0|SYE_LEGPL Glutamate--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=gltX PE=3 SV=1 114 323 1.0E-11
sp|Q5LWB2|SYE1_RUEPO Glutamate--tRNA ligase 1 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gltX1 PE=3 SV=1 114 402 1.0E-11
sp|B1ZAR5|SYE2_METPB Glutamate--tRNA ligase 2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gltX2 PE=3 SV=1 115 402 1.0E-11
sp|Q5ZU96|SYE_LEGPH Glutamate--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gltX PE=3 SV=2 114 323 1.0E-11
sp|Q97KC9|SYE_CLOAB Glutamate--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gltX PE=3 SV=1 116 332 1.0E-11
sp|Q5QX98|SYE_IDILO Glutamate--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gltX PE=3 SV=1 114 332 1.0E-11
sp|A5CD02|SYE1_ORITB Glutamate--tRNA ligase 1 OS=Orientia tsutsugamushi (strain Boryong) GN=gltX1 PE=3 SV=2 114 332 1.0E-11
sp|B6JLN1|SYE2_HELP2 Glutamate--tRNA ligase 2 OS=Helicobacter pylori (strain P12) GN=gltX2 PE=3 SV=1 115 378 1.0E-11
sp|Q57DB3|SYE1_BRUAB Glutamate--tRNA ligase 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=gltX1 PE=3 SV=1 114 208 1.0E-11
sp|Q2YQ56|SYE1_BRUA2 Glutamate--tRNA ligase 1 OS=Brucella abortus (strain 2308) GN=gltX1 PE=3 SV=1 114 208 1.0E-11
sp|B2S5M8|SYE1_BRUA1 Glutamate--tRNA ligase 1 OS=Brucella abortus (strain S19) GN=gltX1 PE=3 SV=1 114 208 1.0E-11
sp|Q8YH36|SYE2_BRUME Glutamate--tRNA ligase 2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gltX2 PE=3 SV=2 114 208 2.0E-11
sp|B0CGG7|SYE1_BRUSI Glutamate--tRNA ligase 1 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gltX1 PE=3 SV=1 114 208 2.0E-11
sp|A5VQF9|SYE1_BRUO2 Glutamate--tRNA ligase 1 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gltX1 PE=3 SV=2 114 208 2.0E-11
sp|Q8G0S1|SYE1_BRUSU Glutamate--tRNA ligase 1 OS=Brucella suis biovar 1 (strain 1330) GN=gltX1 PE=3 SV=1 114 208 2.0E-11
sp|A9MB31|SYE1_BRUC2 Glutamate--tRNA ligase 1 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gltX1 PE=3 SV=1 114 208 2.0E-11
sp|Q16AX5|SYE1_ROSDO Glutamate--tRNA ligase 1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gltX1 PE=3 SV=1 114 450 2.0E-11
sp|Q055X5|SYE_LEPBL Glutamate--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gltX PE=3 SV=1 114 331 2.0E-11
sp|Q04PF0|SYE_LEPBJ Glutamate--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gltX PE=3 SV=1 114 331 2.0E-11
sp|A4J0Y7|SYE_DESRM Glutamate--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=gltX PE=3 SV=1 114 368 2.0E-11
sp|A5ID69|SYE_LEGPC Glutamate--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=gltX PE=3 SV=1 114 323 2.0E-11
sp|Q9ZLJ1|SYE2_HELPJ GlutamylGlutaminyl-tRNA synthetase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gltX2 PE=3 SV=1 115 332 2.0E-11
sp|P57906|SYE_PASMU Glutamate--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=gltX PE=3 SV=1 106 332 2.0E-11
sp|A0RR62|SYE2_CAMFF Glutamate--tRNA ligase 2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=gltX2 PE=3 SV=1 114 345 2.0E-11
sp|Q5X3Z5|SYE_LEGPA Glutamate--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=gltX PE=3 SV=1 114 323 2.0E-11
sp|A0RM82|SYE1_CAMFF Glutamate--tRNA ligase 1 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=gltX1 PE=3 SV=1 117 332 2.0E-11
sp|B5Z716|SYE2_HELPG Glutamate--tRNA ligase 2 OS=Helicobacter pylori (strain G27) GN=gltX2 PE=3 SV=1 115 332 2.0E-11
sp|A1B0F1|SYE1_PARDP Glutamate--tRNA ligase 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=gltX1 PE=3 SV=1 114 402 2.0E-11
sp|A6LM79|SYE2_THEM4 Glutamate--tRNA ligase 2 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gltX2 PE=3 SV=1 117 332 3.0E-11
sp|Q1MR60|SYE_LAWIP Glutamate--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gltX PE=3 SV=1 112 358 3.0E-11
sp|A8EQW9|SYE1_ARCB4 Glutamate--tRNA ligase 1 OS=Arcobacter butzleri (strain RM4018) GN=gltX1 PE=3 SV=1 115 397 3.0E-11
sp|A9W910|SYE1_METEP Glutamate--tRNA ligase 1 OS=Methylobacterium extorquens (strain PA1) GN=gltX1 PE=3 SV=1 114 397 3.0E-11
sp|B3CLF5|SYE2_WOLPP Glutamate--tRNA ligase 2 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=gltX2 PE=3 SV=1 113 317 3.0E-11
sp|B1MWU1|SYE_LEUCK Glutamate--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=gltX PE=3 SV=1 114 358 3.0E-11
sp|Q3A9N9|SYE_CARHZ Glutamate--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gltX PE=3 SV=1 114 368 3.0E-11
sp|B0UQ09|SYE1_METS4 Glutamate--tRNA ligase 1 OS=Methylobacterium sp. (strain 4-46) GN=gltX1 PE=3 SV=1 114 397 3.0E-11
sp|A4XHE0|SYE1_CALS8 Glutamate--tRNA ligase 1 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gltX1 PE=3 SV=1 114 368 3.0E-11
sp|Q4A6V0|SYE_MYCS5 Glutamate--tRNA ligase OS=Mycoplasma synoviae (strain 53) GN=gltX PE=3 SV=1 114 332 3.0E-11
sp|B3E399|SYE_GEOLS Glutamate--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gltX PE=3 SV=1 116 332 4.0E-11
sp|Q04GX5|SYE_OENOB Glutamate--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=gltX PE=3 SV=1 110 393 4.0E-11
sp|B2IKL1|SYE1_BEII9 Glutamate--tRNA ligase 1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gltX1 PE=3 SV=1 114 401 4.0E-11
sp|A8F597|SYE1_PSELT Glutamate--tRNA ligase 1 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gltX1 PE=3 SV=1 114 313 4.0E-11
sp|B3CRX8|SYE1_ORITI Glutamate--tRNA ligase 1 OS=Orientia tsutsugamushi (strain Ikeda) GN=gltX1 PE=3 SV=1 114 234 4.0E-11
sp|A3D6C6|SYE_SHEB5 Glutamate--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gltX PE=3 SV=1 116 332 4.0E-11
sp|Q0HKH4|SYE_SHESM Glutamate--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=gltX PE=3 SV=1 116 332 4.0E-11
sp|A9KUU5|SYE_SHEB9 Glutamate--tRNA ligase OS=Shewanella baltica (strain OS195) GN=gltX PE=3 SV=1 116 332 4.0E-11
sp|A6WQ67|SYE_SHEB8 Glutamate--tRNA ligase OS=Shewanella baltica (strain OS185) GN=gltX PE=3 SV=1 116 332 4.0E-11
sp|A7HY03|SYE2_PARL1 Glutamate--tRNA ligase 2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gltX2 PE=3 SV=1 111 332 4.0E-11
sp|B1LUJ9|SYE1_METRJ Glutamate--tRNA ligase 1 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gltX1 PE=3 SV=1 112 397 4.0E-11
sp|Q0AIP6|SYE_NITEC Glutamate--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=gltX PE=3 SV=1 114 332 5.0E-11
sp|Q0HWS6|SYE_SHESR Glutamate--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=gltX PE=3 SV=1 116 332 5.0E-11
sp|A0KV33|SYE_SHESA Glutamate--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=gltX PE=3 SV=1 116 332 5.0E-11
sp|Q4UME8|SYE2_RICFE Glutamate--tRNA ligase 2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gltX2 PE=3 SV=1 113 228 5.0E-11
sp|Q3JEF2|SYE1_NITOC Glutamate--tRNA ligase 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gltX1 PE=3 SV=1 114 332 6.0E-11
sp|B5ZCB4|SYE_UREU1 Glutamate--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=gltX PE=3 SV=1 116 346 6.0E-11
sp|P43818|SYE_HAEIN Glutamate--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gltX PE=3 SV=1 98 332 6.0E-11
sp|Q5PAG8|SYE2_ANAMM Glutamate--tRNA ligase 2 OS=Anaplasma marginale (strain St. Maries) GN=gltX2 PE=3 SV=2 114 397 6.0E-11
sp|Q4QNR5|SYE_HAEI8 Glutamate--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=gltX PE=3 SV=1 98 332 6.0E-11
sp|A6VLT3|SYE_ACTSZ Glutamate--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=gltX PE=3 SV=1 109 332 6.0E-11
sp|A5UAL5|SYE_HAEIE Glutamate--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=gltX PE=3 SV=1 98 332 7.0E-11
sp|Q5H2R3|SYE_XANOR Glutamate--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=gltX PE=3 SV=1 116 354 7.0E-11
sp|B2SSC6|SYE_XANOP Glutamate--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=gltX PE=3 SV=1 116 354 7.0E-11
sp|Q2P5M8|SYE_XANOM Glutamate--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gltX PE=3 SV=1 116 354 7.0E-11
sp|Q5NY25|SYE_AROAE Glutamate--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=gltX PE=3 SV=1 114 332 7.0E-11
sp|A1RI52|SYE_SHESW Glutamate--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=gltX PE=3 SV=1 116 332 7.0E-11
sp|O25360|SYE2_HELPY GlutamylGlutaminyl-tRNA synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gltX2 PE=3 SV=1 115 332 7.0E-11
sp|A4Y8D7|SYE_SHEPC Glutamate--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gltX PE=3 SV=1 116 332 7.0E-11
sp|Q1CTM7|SYE2_HELPH Glutamate--tRNA ligase 2 OS=Helicobacter pylori (strain HPAG1) GN=gltX2 PE=3 SV=1 115 332 8.0E-11
sp|Q7VNZ3|SYE_HAEDU Glutamate--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gltX PE=3 SV=1 109 332 8.0E-11
sp|Q73HV5|SYE1_WOLPM Glutamate--tRNA ligase 1 OS=Wolbachia pipientis wMel GN=gltX1 PE=3 SV=1 113 317 8.0E-11
sp|B0RQU0|SYE_XANCB Glutamate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=gltX PE=3 SV=1 116 332 8.0E-11
sp|A5CFB7|SYE2_ORITB Glutamate--tRNA ligase 2 OS=Orientia tsutsugamushi (strain Boryong) GN=gltX2 PE=3 SV=2 114 220 8.0E-11
sp|Q43768|SYE_HORVU Glutamate--tRNA ligase, chloroplastic/mitochondrial OS=Hordeum vulgare PE=2 SV=1 114 368 8.0E-11
sp|A6SX06|SYE_JANMA Glutamate--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=gltX PE=3 SV=1 114 337 8.0E-11
sp|A1SVA7|SYE_PSYIN Glutamate--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=gltX PE=3 SV=1 114 332 8.0E-11
sp|Q5FRG7|SYE1_GLUOX Glutamate--tRNA ligase 1 OS=Gluconobacter oxydans (strain 621H) GN=gltX1 PE=3 SV=1 114 258 9.0E-11
sp|Q12L63|SYE_SHEDO Glutamate--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gltX PE=3 SV=1 116 332 1.0E-10
sp|B1Z9T1|SYE1_METPB Glutamate--tRNA ligase 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gltX1 PE=3 SV=1 114 397 1.0E-10
sp|A8F2B0|SYE2_RICM5 Glutamate--tRNA ligase 2 OS=Rickettsia massiliae (strain Mtu5) GN=gltX2 PE=3 SV=1 113 228 1.0E-10
sp|A8FXE0|SYE_SHESH Glutamate--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=gltX PE=3 SV=1 116 332 1.0E-10
sp|A8GPB2|SYE2_RICAH Glutamate--tRNA ligase 2 OS=Rickettsia akari (strain Hartford) GN=gltX2 PE=3 SV=1 113 228 1.0E-10
sp|Q8P7C5|SYE_XANCP Glutamate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gltX PE=3 SV=1 116 332 1.0E-10
sp|Q4UWS6|SYE_XANC8 Glutamate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gltX PE=3 SV=1 116 332 1.0E-10
sp|Q82U77|SYE_NITEU Glutamate--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gltX PE=3 SV=1 114 332 1.0E-10
sp|A8GT27|SYE2_RICRS Glutamate--tRNA ligase 2 OS=Rickettsia rickettsii (strain Sheila Smith) GN=gltX2 PE=3 SV=1 113 228 1.0E-10
sp|B0BUL7|SYE2_RICRO Glutamate--tRNA ligase 2 OS=Rickettsia rickettsii (strain Iowa) GN=gltX2 PE=3 SV=1 113 228 1.0E-10
sp|Q07ZL0|SYE_SHEFN Glutamate--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=gltX PE=3 SV=1 116 332 1.0E-10
sp|Q92H06|SYE2_RICCN Glutamate--tRNA ligase 2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gltX2 PE=3 SV=1 113 228 1.0E-10
sp|B1I4Z1|SYE_DESAP Glutamate--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=gltX PE=3 SV=1 114 368 1.0E-10
sp|Q03U68|SYE1_LACBA Glutamate--tRNA ligase 1 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=gltX1 PE=3 SV=1 110 397 1.0E-10
sp|Q43794|SYE_TOBAC Glutamate--tRNA ligase, chloroplastic/mitochondrial OS=Nicotiana tabacum PE=2 SV=1 114 360 2.0E-10
sp|Q9ZCT8|SYE2_RICPR Glutamate--tRNA ligase 2 OS=Rickettsia prowazekii (strain Madrid E) GN=gltX2 PE=3 SV=1 113 228 2.0E-10
sp|B2V5J1|SYE_SULSY Glutamate--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=gltX PE=3 SV=1 116 354 2.0E-10
sp|A9HLD9|SYE2_GLUDA Glutamate--tRNA ligase 2 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=gltX2 PE=3 SV=1 117 399 2.0E-10
sp|A0L669|SYE_MAGMM Glutamate--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=gltX PE=3 SV=1 116 397 2.0E-10
sp|B2UTI4|SYE2_HELPS Glutamate--tRNA ligase 2 OS=Helicobacter pylori (strain Shi470) GN=gltX2 PE=3 SV=1 115 332 2.0E-10
sp|A9ISS8|SYE2_BART1 Glutamate--tRNA ligase 2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gltX2 PE=3 SV=1 114 221 2.0E-10
sp|Q03E40|SYE_PEDPA Glutamate--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=gltX PE=3 SV=1 110 397 2.0E-10
sp|A5UG92|SYE_HAEIG Glutamate--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=gltX PE=3 SV=1 98 332 2.0E-10
sp|Q68WB4|SYE2_RICTY Glutamate--tRNA ligase 2 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gltX2 PE=3 SV=1 113 228 2.0E-10
sp|P59423|SYE_BUCBP Glutamate--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gltX PE=3 SV=1 114 323 2.0E-10
sp|Q2N5Q3|SYE2_ERYLH Glutamate--tRNA ligase 2 OS=Erythrobacter litoralis (strain HTCC2594) GN=gltX2 PE=3 SV=2 114 402 2.0E-10
sp|A8LIP0|SYE2_DINSH Glutamate--tRNA ligase 2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=gltX2 PE=3 SV=1 114 404 2.0E-10
sp|Q2JRD6|SYE_SYNJA Glutamate--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=gltX PE=3 SV=1 114 332 2.0E-10
sp|A6Q354|SYE1_NITSB Glutamate--tRNA ligase 1 OS=Nitratiruptor sp. (strain SB155-2) GN=gltX1 PE=3 SV=1 115 335 2.0E-10
sp|Q163X3|SYE2_ROSDO Glutamate--tRNA ligase 2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gltX2 PE=3 SV=1 114 332 2.0E-10
sp|Q4AAJ3|SYE_MYCHJ Glutamate--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=gltX PE=3 SV=2 114 323 2.0E-10
sp|A6X0R0|SYE2_OCHA4 Glutamate--tRNA ligase 2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gltX2 PE=3 SV=1 114 208 2.0E-10
sp|A4WX62|SYE2_RHOS5 Glutamate--tRNA ligase 2 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gltX2 PE=3 SV=1 110 339 2.0E-10
sp|B6JH82|SYE_OLICO Glutamate--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gltX PE=3 SV=1 114 397 2.0E-10
sp|Q92IH2|SYE1_RICCN Glutamate--tRNA ligase 1 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gltX1 PE=3 SV=1 114 327 2.0E-10
sp|B0TBU3|SYE_HELMI Glutamate--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=gltX PE=3 SV=1 112 333 2.0E-10
sp|B6IST4|SYE2_RHOCS Glutamate--tRNA ligase 2 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gltX2 PE=3 SV=1 114 317 2.0E-10
sp|B1I9D7|SYE_STRPI Glutamate--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gltX PE=3 SV=1 112 397 2.0E-10
sp|Q47GG0|SYE_DECAR Glutamate--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=gltX PE=3 SV=1 112 332 3.0E-10
sp|Q2J816|SYE_FRASC Glutamate--tRNA ligase OS=Frankia sp. (strain CcI3) GN=gltX PE=3 SV=1 114 355 3.0E-10
sp|A3PMJ1|SYE2_RHOS1 Glutamate--tRNA ligase 2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gltX2 PE=3 SV=1 114 402 3.0E-10
sp|B2IGY0|SYE2_BEII9 Glutamate--tRNA ligase 2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gltX2 PE=3 SV=1 115 225 3.0E-10
sp|A4XA62|SYE_SALTO Glutamate--tRNA ligase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=gltX PE=3 SV=1 117 355 3.0E-10
sp|Q7M7L9|SYE1_WOLSU Glutamate--tRNA ligase 1 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=gltX1 PE=3 SV=1 114 333 3.0E-10
sp|A6LJ42|SYE1_THEM4 Glutamate--tRNA ligase 1 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gltX1 PE=3 SV=1 114 317 3.0E-10
sp|B3QQC6|SYE_CHLP8 Glutamate--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=gltX PE=3 SV=2 114 332 4.0E-10
sp|P53662|SYE_MYCPU Glutamate--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=gltX PE=3 SV=1 112 332 4.0E-10
sp|Q4A8M4|SYE_MYCH7 Glutamate--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=gltX PE=3 SV=2 114 323 4.0E-10
sp|Q73R87|SYE_TREDE Glutamate--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gltX PE=3 SV=1 114 332 4.0E-10
sp|B6J5A0|SYE1_COXB1 Glutamate--tRNA ligase 1 OS=Coxiella burnetii (strain CbuK_Q154) GN=gltX1 PE=3 SV=2 112 337 4.0E-10
sp|A9KD63|SYE2_COXBN Glutamate--tRNA ligase 2 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gltX2 PE=3 SV=3 112 337 4.0E-10
sp|B6J2J3|SYE2_COXB2 Glutamate--tRNA ligase 2 OS=Coxiella burnetii (strain CbuG_Q212) GN=gltX2 PE=3 SV=2 112 337 4.0E-10
sp|Q83EV3|SYE1_COXBU Glutamate--tRNA ligase 1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gltX1 PE=3 SV=1 112 337 4.0E-10
sp|A9NAJ6|SYE1_COXBR Glutamate--tRNA ligase 1 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gltX1 PE=3 SV=1 112 337 4.0E-10
sp|Q601G1|SYE_MYCH2 Glutamate--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=gltX PE=3 SV=1 114 339 4.0E-10
sp|A8LZ53|SYE_SALAI Glutamate--tRNA ligase OS=Salinispora arenicola (strain CNS-205) GN=gltX PE=3 SV=1 114 355 4.0E-10
sp|Q6LTT8|SYE_PHOPR Glutamate--tRNA ligase OS=Photobacterium profundum GN=gltX PE=3 SV=1 114 323 4.0E-10
sp|A5EK39|SYE_BRASB Glutamate--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gltX PE=3 SV=1 114 397 5.0E-10
sp|A4G3S7|SYE_HERAR Glutamate--tRNA ligase OS=Herminiimonas arsenicoxydans GN=gltX PE=3 SV=1 114 337 5.0E-10
sp|A7GXI1|SYE1_CAMC5 Glutamate--tRNA ligase 1 OS=Campylobacter curvus (strain 525.92) GN=gltX1 PE=3 SV=1 117 332 5.0E-10
sp|A8GRM9|SYE1_RICRS Glutamate--tRNA ligase 1 OS=Rickettsia rickettsii (strain Sheila Smith) GN=gltX1 PE=3 SV=1 114 327 5.0E-10
sp|B0BX35|SYE1_RICRO Glutamate--tRNA ligase 1 OS=Rickettsia rickettsii (strain Iowa) GN=gltX1 PE=3 SV=1 114 327 5.0E-10
sp|Q2Y8L6|SYE_NITMU Glutamate--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gltX PE=3 SV=1 114 332 5.0E-10
sp|Q5GSJ1|SYE1_WOLTR Glutamate--tRNA ligase 1 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=gltX1 PE=3 SV=1 114 220 6.0E-10
sp|Q89KR5|SYE_BRADU Glutamate--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gltX PE=3 SV=1 114 397 6.0E-10
sp|Q215D4|SYE_RHOPB Glutamate--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB18) GN=gltX PE=3 SV=1 114 397 6.0E-10
sp|A8F197|SYE1_RICM5 Glutamate--tRNA ligase 1 OS=Rickettsia massiliae (strain Mtu5) GN=gltX1 PE=3 SV=1 114 181 6.0E-10
sp|A5W968|GLUQ_PSEP1 Glutamyl-Q tRNA(Asp) synthetase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gluQ PE=3 SV=1 106 224 7.0E-10
sp|Q9PPP0|SYE_UREPA Glutamate--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=gltX PE=3 SV=1 116 346 7.0E-10
sp|B1AJP0|SYE_UREP2 Glutamate--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=gltX PE=3 SV=1 116 346 7.0E-10
sp|Q6G3V1|SYE2_BARHE Glutamate--tRNA ligase 2 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gltX2 PE=3 SV=1 114 207 7.0E-10
sp|A4TMF9|SYE_YERPP Glutamate--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=gltX PE=3 SV=1 114 332 7.0E-10
sp|Q1CJV2|SYE_YERPN Glutamate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gltX PE=3 SV=1 114 332 7.0E-10
sp|A9QZG6|SYE_YERPG Glutamate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gltX PE=3 SV=1 114 332 7.0E-10
sp|Q8ZCK0|SYE_YERPE Glutamate--tRNA ligase OS=Yersinia pestis GN=gltX PE=3 SV=1 114 332 7.0E-10
sp|Q1C5Y4|SYE_YERPA Glutamate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gltX PE=3 SV=1 114 332 7.0E-10
sp|Q11HT5|SYE2_CHESB Glutamate--tRNA ligase 2 OS=Chelativorans sp. (strain BNC1) GN=gltX2 PE=3 SV=1 114 368 7.0E-10
sp|A0K8I0|SYE_BURCH Glutamate--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=gltX PE=3 SV=1 112 332 7.0E-10
sp|B1JUI6|SYE_BURCC Glutamate--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=gltX PE=3 SV=1 112 332 7.0E-10
sp|Q2RWK3|SYE1_RHORT Glutamate--tRNA ligase 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gltX1 PE=3 SV=1 114 225 7.0E-10
sp|Q9A721|SYE_CAUCR Glutamate--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gltX PE=3 SV=1 110 319 8.0E-10
sp|Q1BHL9|SYE_BURCA Glutamate--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=gltX PE=3 SV=1 112 332 8.0E-10
sp|Q2G6Q3|SYE2_NOVAD Glutamate--tRNA ligase 2 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=gltX2 PE=3 SV=1 114 319 8.0E-10
sp|A1K5J1|SYE_AZOSB Glutamate--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=gltX PE=3 SV=1 114 332 8.0E-10
sp|Q98LZ1|SYE2_RHILO Glutamate--tRNA ligase 2 OS=Rhizobium loti (strain MAFF303099) GN=gltX2 PE=3 SV=1 114 225 8.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0005737 cytoplasm Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0000166 nucleotide binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0043039 tRNA aminoacylation Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008152 metabolic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0090304 nucleic acid metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043167 ion binding No
GO:0044424 intracellular part No
GO:0043168 anion binding No
GO:0006399 tRNA metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0043038 amino acid activation No
GO:0044464 cell part No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1699
MKHEELEVLSTKLSGDFRSIEPHLRDLDKHLTLRSHLEGYSLGDLEKTVWQTLRANKVAIGFIRRNGLPNLTRWF
SFIEQSHPEILEETKSGDGAAKKAGANYNLALQDTEKGVVTRFLPEPSGYLHIGHAKAALLSDYFGHVAYNGQMR
LRLDDTNPAKESEEFQDAIVEDLALMGIRADSLTYTSDYFDYLYDMCKKLISMGKAYADDTDQETMRAQRMDGIP
SKRRDRSVEENLRIFDEMKKGSPEGLTHCMRAKLSADDPNKAMRDPVIYRCNVNDSHHRTGRKWNMYPMYDFACP
VVDSHEGVTHALRSTEYTDRNPQYQWFLDTLGLRKVHMWDFSRMNFIRTFLSKRKLAKLVDSGKVWGWDDPRMPT
IRGVRRRGMTVAALRDFIIRQGPSRNVVVMDWTSFWNANKKEIDPVVPRHTALLRKDMVKAKLTGGEAPSGVVVE
QRQKHPKNPSVGMKDVVFSPEIYVDQADAKSFAAGEEVTLMGWGNAFVRDLPAEDPVRGMTLELNLKGDFKATDK
KITWLSAQGLDLVPAELWDFDYLITKDKLEEDDNVEDFLNPDTSSVEEAWCDGGVGKLKADDIIQLERRGFYRVD
KGMDDWKAGEAGAKGPRVVLFYIPTGKTGK*
Coding >Hirsu2|1699
ATGAAACACGAGGAACTCGAGGTCCTCTCGACCAAGCTCTCTGGCGACTTCCGCTCCATTGAGCCTCACCTGCGA
GACCTCGACAAGCACCTGACTCTGCGCTCTCACCTCGAGGGATACAGTCTCGGCGATCTCGAGAAGACTGTCTGG
CAGACGCTCCGGGCGAACAAGGTGGCTATCGGCTTCATCCGGAGAAATGGGCTGCCCAACTTGACCCGCTGGTTC
AGCTTCATTGAGCAGTCGCATCCCGAGATCCTCGAAGAGACCAAGTCGGGAGATGGCGCGGCAAAGAAGGCCGGC
GCCAACTATAACCTCGCCCTCCAGGACACCGAAAAGGGGGTTGTCACTCGCTTCCTGCCGGAGCCCTCCGGCTAC
CTGCACATTGGCCACGCCAAGGCCGCCCTCCTCAGCGACTACTTCGGCCACGTGGCCTACAATGGCCAGATGCGC
CTCCGCCTCGACGACACCAACCCGGCAAAGGAGAGCGAGGAGTTCCAGGATGCCATCGTCGAGGACCTGGCCCTC
ATGGGTATCCGCGCCGACAGCCTGACGTACACGTCCGACTATTTCGACTACCTGTACGACATGTGCAAGAAGCTC
ATCTCCATGGGCAAGGCGTACGCGGACGACACGGACCAGGAGACGATGCGCGCCCAGCGCATGGACGGCATCCCG
TCCAAGAGGCGCGACCGCTCGGTGGAAGAGAACCTGCGCATCTTTGACGAGATGAAGAAGGGGTCGCCCGAGGGC
TTGACGCACTGCATGCGCGCCAAGCTGTCGGCCGACGACCCCAACAAGGCCATGCGCGATCCCGTCATCTACCGA
TGCAACGTCAACGACTCGCACCACCGGACCGGGCGCAAGTGGAACATGTATCCCATGTACGACTTCGCCTGCCCC
GTCGTCGACAGCCACGAGGGCGTGACGCACGCCTTGCGATCGACCGAGTACACGGACCGCAACCCGCAGTACCAG
TGGTTCCTCGACACGCTGGGGCTCCGCAAGGTGCACATGTGGGATTTCTCGCGCATGAACTTCATCAGGACCTTT
TTGTCGAAGCGCAAGCTGGCCAAGCTGGTCGACTCGGGCAAGGTCTGGGGCTGGGACGACCCGAGGATGCCGACG
ATCCGGGGCGTGCGCCGGCGCGGCATGACGGTGGCGGCGCTGCGCGACTTCATCATCCGACAGGGGCCCAGCCGC
AACGTCGTCGTCATGGACTGGACCAGCTTCTGGAACGCCAACAAGAAGGAGATCGACCCGGTCGTGCCGCGGCAC
ACGGCCCTCCTGCGCAAGGACATGGTCAAGGCCAAGCTGACGGGCGGCGAGGCGCCGTCGGGCGTCGTGGTCGAG
CAGCGGCAGAAGCACCCCAAGAACCCGAGCGTCGGCATGAAGGACGTCGTCTTCTCGCCCGAGATCTACGTCGAC
CAGGCCGACGCCAAGAGCTTCGCGGCCGGCGAGGAGGTGACGCTGATGGGCTGGGGCAACGCCTTCGTGCGCGAC
CTCCCCGCCGAGGACCCGGTCCGCGGCATGACGCTCGAGCTCAACCTCAAGGGCGACTTCAAGGCGACTGATAAG
AAGATCACGTGGCTGTCGGCGCAGGGCCTGGATCTGGTGCCGGCCGAGCTGTGGGACTTTGACTACCTCATCACC
AAGGACAAGCTGGAGGAGGACGACAACGTGGAGGACTTTTTGAACCCGGACACGTCGAGCGTCGAGGAGGCGTGG
TGCGACGGCGGCGTGGGCAAGCTCAAGGCGGACGACATCATCCAGCTCGAGCGCCGGGGCTTTTACCGCGTGGAC
AAGGGCATGGACGACTGGAAGGCTGGCGAGGCCGGAGCCAAGGGCCCGCGGGTGGTGCTGTTCTACATCCCCACG
GGGAAGACGGGCAAATAA
Transcript >Hirsu2|1699
ATGAAACACGAGGAACTCGAGGTCCTCTCGACCAAGCTCTCTGGCGACTTCCGCTCCATTGAGCCTCACCTGCGA
GACCTCGACAAGCACCTGACTCTGCGCTCTCACCTCGAGGGATACAGTCTCGGCGATCTCGAGAAGACTGTCTGG
CAGACGCTCCGGGCGAACAAGGTGGCTATCGGCTTCATCCGGAGAAATGGGCTGCCCAACTTGACCCGCTGGTTC
AGCTTCATTGAGCAGTCGCATCCCGAGATCCTCGAAGAGACCAAGTCGGGAGATGGCGCGGCAAAGAAGGCCGGC
GCCAACTATAACCTCGCCCTCCAGGACACCGAAAAGGGGGTTGTCACTCGCTTCCTGCCGGAGCCCTCCGGCTAC
CTGCACATTGGCCACGCCAAGGCCGCCCTCCTCAGCGACTACTTCGGCCACGTGGCCTACAATGGCCAGATGCGC
CTCCGCCTCGACGACACCAACCCGGCAAAGGAGAGCGAGGAGTTCCAGGATGCCATCGTCGAGGACCTGGCCCTC
ATGGGTATCCGCGCCGACAGCCTGACGTACACGTCCGACTATTTCGACTACCTGTACGACATGTGCAAGAAGCTC
ATCTCCATGGGCAAGGCGTACGCGGACGACACGGACCAGGAGACGATGCGCGCCCAGCGCATGGACGGCATCCCG
TCCAAGAGGCGCGACCGCTCGGTGGAAGAGAACCTGCGCATCTTTGACGAGATGAAGAAGGGGTCGCCCGAGGGC
TTGACGCACTGCATGCGCGCCAAGCTGTCGGCCGACGACCCCAACAAGGCCATGCGCGATCCCGTCATCTACCGA
TGCAACGTCAACGACTCGCACCACCGGACCGGGCGCAAGTGGAACATGTATCCCATGTACGACTTCGCCTGCCCC
GTCGTCGACAGCCACGAGGGCGTGACGCACGCCTTGCGATCGACCGAGTACACGGACCGCAACCCGCAGTACCAG
TGGTTCCTCGACACGCTGGGGCTCCGCAAGGTGCACATGTGGGATTTCTCGCGCATGAACTTCATCAGGACCTTT
TTGTCGAAGCGCAAGCTGGCCAAGCTGGTCGACTCGGGCAAGGTCTGGGGCTGGGACGACCCGAGGATGCCGACG
ATCCGGGGCGTGCGCCGGCGCGGCATGACGGTGGCGGCGCTGCGCGACTTCATCATCCGACAGGGGCCCAGCCGC
AACGTCGTCGTCATGGACTGGACCAGCTTCTGGAACGCCAACAAGAAGGAGATCGACCCGGTCGTGCCGCGGCAC
ACGGCCCTCCTGCGCAAGGACATGGTCAAGGCCAAGCTGACGGGCGGCGAGGCGCCGTCGGGCGTCGTGGTCGAG
CAGCGGCAGAAGCACCCCAAGAACCCGAGCGTCGGCATGAAGGACGTCGTCTTCTCGCCCGAGATCTACGTCGAC
CAGGCCGACGCCAAGAGCTTCGCGGCCGGCGAGGAGGTGACGCTGATGGGCTGGGGCAACGCCTTCGTGCGCGAC
CTCCCCGCCGAGGACCCGGTCCGCGGCATGACGCTCGAGCTCAACCTCAAGGGCGACTTCAAGGCGACTGATAAG
AAGATCACGTGGCTGTCGGCGCAGGGCCTGGATCTGGTGCCGGCCGAGCTGTGGGACTTTGACTACCTCATCACC
AAGGACAAGCTGGAGGAGGACGACAACGTGGAGGACTTTTTGAACCCGGACACGTCGAGCGTCGAGGAGGCGTGG
TGCGACGGCGGCGTGGGCAAGCTCAAGGCGGACGACATCATCCAGCTCGAGCGCCGGGGCTTTTACCGCGTGGAC
AAGGGCATGGACGACTGGAAGGCTGGCGAGGCCGGAGCCAAGGGCCCGCGGGTGGTGCTGTTCTACATCCCCACG
GGGAAGACGGGCAAATAA
Gene >Hirsu2|1699
ATGAAACACGAGGAACTCGAGGTCCTCTCGACCAAGCTCTCTGGCGACTTCCGCTCCATTGAGCCTCACCTGCGA
GACCTCGACAAGCACCTGACTCTGCGCTCTCACCTCGAGGGATACAGTCTCGGCGATCTCGAGAAGACTGTCTGG
CAGACGCTCCGGGCGAACAAGGTGGCTATCGGCTTCATCCGGAGAAATGGGCTGCCCAACTTGACCCGCTGGTTC
AGCTTCATTGAGCAGTCGCATCCCGAGATCCTCGAAGAGACCAAGTCGGGAGATGGCGCGGCAAAGAAGGCCGGC
GCCAACTATAACCTCGCCCTCCAGGACACCGAAAAGGGGGTTGTCACTCGCTTCCTGCCGGAGCCCTCGTGAGTG
CCGCATCTGGCTGTCCGTCCACGGCATGGCCCTTGCTGACGAGCATTGATCTCTCTCTCGCAGCGGCTACCTGCA
CATTGGCCACGCCAAGGCCGCCCTCCTCAGCGACTACTTCGGCCACGTGGCCTACAATGGCCAGATGCGCCTCCG
CCTCGACGACACCAACCCGGCAAAGGAGAGCGAGGAGTTCCAGGATGCCATCGTCGAGGACCTGGCCCTCATGGG
TATCCGCGCCGACAGCCTGACGTACACGTCCGACTATTTCGACTACCTGTACGACATGTGCAAGAAGCTCATCTC
CATGGGCAAGGCGTACGCGGACGACACGGACCAGGAGACGATGCGCGCCCAGCGCATGGACGGCATCCCGTCCAA
GAGGCGCGACCGCTCGGTGGAAGAGAACCTGCGCATCTTTGACGAGATGAAGAAGGGGTCGCCCGAGGGCTTGAC
GCACTGCATGCGCGCCAAGCTGTCGGCCGACGACCCCAACAAGGCCATGCGCGATCCCGTCATCTACCGATGCAA
CGTCAACGACTCGCACCACCGGACCGGGCGCAAGTGGAACATGTATCCCATGTACGACTTCGCCTGCCCCGTCGT
CGACAGCCACGAGGGCGTGACGCACGCCTTGCGATCGACCGAGTACACGGACCGCAACCCGCAGTACCAGTGGTT
CCTCGACACGCTGGGGCTCCGCAAGGTGCACATGTGGGATTTCTCGCGCATGAACTTCATCAGGACCTTTTTGTC
GAAGCGCAAGCTGGCCAAGCTGGTCGACTCGGGCAAGGTCTGGGGCTGGGACGACCCGAGGATGCCGACGATCCG
GGGCGTGCGCCGGCGCGGCATGACGGTGGCGGCGCTGCGCGACTTCATCATCCGACAGGGGCCCAGCCGCAACGT
CGTCGTCATGGACTGGACCAGCTTCTGGAACGCCAACAAGAAGGAGATCGACCCGGTCGTGCCGCGGCACACGGC
CCTCCTGCGCAAGGACATGGTCAAGGCCAAGCTGACGGGCGGCGAGGCGCCGTCGGGCGTCGTGGTCGAGCAGCG
GCAGAAGCACCCCAAGAACCCGAGCGTCGGCATGAAGGACGTCGTCTTCTCGCCCGAGATCTACGTCGACCAGGC
CGACGCCAAGAGCTTCGCGGCCGGCGAGGAGGTGACGCTGATGGGCTGGGGCAACGCCTTCGTGCGCGACCTCCC
CGCCGAGGACCCGGTCCGCGGCATGACGCTCGAGCTCAACCTCAAGGGCGACTTCAAGGCGACTGATAAGAAGAT
CACGTGGCTGTCGGCGCAGGGCCTGGATCTGGTGCCGGCCGAGCTGTGGGACTTTGACTACCTCATCACCAAGGA
CAAGCTGGAGGAGGACGACAACGTGGAGGACTTTTTGAACCCGGACACGTCGAGCGTCGAGGAGGCGTGGTGCGA
CGGCGGCGTGGGCAAGCTCAAGGCGGACGACATCATCCAGCTCGAGCGCCGGGGCTTTTACCGCGTGGACAAGGG
CATGGACGACTGGAAGGCTGGCGAGGCCGGAGCCAAGGGCCCGCGGGTGGTGCTGTTCTACATCCCCACGGGGAA
GACGGGCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail