Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1696
Gene name
LocationContig_1383:6643..6886
Strand-
Gene length (bp)243
Transcript length (bp)243
Coding sequence length (bp)243
Protein length (aa) 81

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00238 Ribosomal_L14 Ribosomal protein L14p/L23e 8.6E-29 7 78

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94292|RM38_SCHPO 54S ribosomal protein L38, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl38 PE=3 SV=2 2 77 2.0E-24
sp|B8DNA6|RL14_DESVM 50S ribosomal protein L14 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rplN PE=3 SV=1 8 77 7.0E-22
sp|A5FZV5|RL14_ACICJ 50S ribosomal protein L14 OS=Acidiphilium cryptum (strain JF-5) GN=rplN PE=3 SV=1 9 77 1.0E-21
sp|Q5FTZ3|RL14_GLUOX 50S ribosomal protein L14 OS=Gluconobacter oxydans (strain 621H) GN=rplN PE=3 SV=1 9 77 2.0E-21
sp|Q30Z52|RL14_DESAG 50S ribosomal protein L14 OS=Desulfovibrio alaskensis (strain G20) GN=rplN PE=3 SV=1 8 77 6.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94292|RM38_SCHPO 54S ribosomal protein L38, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl38 PE=3 SV=2 2 77 2.0E-24
sp|B8DNA6|RL14_DESVM 50S ribosomal protein L14 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rplN PE=3 SV=1 8 77 7.0E-22
sp|A5FZV5|RL14_ACICJ 50S ribosomal protein L14 OS=Acidiphilium cryptum (strain JF-5) GN=rplN PE=3 SV=1 9 77 1.0E-21
sp|Q5FTZ3|RL14_GLUOX 50S ribosomal protein L14 OS=Gluconobacter oxydans (strain 621H) GN=rplN PE=3 SV=1 9 77 2.0E-21
sp|Q30Z52|RL14_DESAG 50S ribosomal protein L14 OS=Desulfovibrio alaskensis (strain G20) GN=rplN PE=3 SV=1 8 77 6.0E-21
sp|A9H3N4|RL14_GLUDA 50S ribosomal protein L14 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplN PE=3 SV=1 9 77 6.0E-21
sp|A0L5Y3|RL14_MAGMM 50S ribosomal protein L14 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rplN PE=3 SV=1 9 77 8.0E-21
sp|A1VEA6|RL14_DESVV 50S ribosomal protein L14 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rplN PE=3 SV=1 9 77 8.0E-21
sp|Q72CH0|RL14_DESVH 50S ribosomal protein L14 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rplN PE=3 SV=1 9 77 8.0E-21
sp|Q1MPQ4|RL14_LAWIP 50S ribosomal protein L14 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rplN PE=3 SV=1 8 77 2.0E-20
sp|Q0BUP0|RL14_GRABC 50S ribosomal protein L14 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplN PE=3 SV=1 9 77 3.0E-20
sp|B9KLA1|RL14_RHOSK 50S ribosomal protein L14 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplN PE=3 SV=1 9 77 4.0E-20
sp|A4WVJ8|RL14_RHOS5 50S ribosomal protein L14 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplN PE=3 SV=1 9 77 4.0E-20
sp|Q3J5R2|RL14_RHOS4 50S ribosomal protein L14 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplN PE=3 SV=1 9 77 4.0E-20
sp|A3PGM1|RL14_RHOS1 50S ribosomal protein L14 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplN PE=3 SV=1 9 77 4.0E-20
sp|A0LIK0|RL14_SYNFM 50S ribosomal protein L14 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rplN PE=3 SV=1 7 77 6.0E-20
sp|C0Q9W3|RL14_DESAH 50S ribosomal protein L14 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rplN PE=3 SV=1 7 77 6.0E-20
sp|A1B037|RL14_PARDP 50S ribosomal protein L14 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplN PE=3 SV=1 9 77 6.0E-20
sp|P56039|RL14_HELPY 50S ribosomal protein L14 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rplN PE=1 SV=1 7 77 1.0E-19
sp|B2UV72|RL14_HELPS 50S ribosomal protein L14 OS=Helicobacter pylori (strain Shi470) GN=rplN PE=3 SV=1 7 77 1.0E-19
sp|Q1CRV1|RL14_HELPH 50S ribosomal protein L14 OS=Helicobacter pylori (strain HPAG1) GN=rplN PE=3 SV=1 7 77 1.0E-19
sp|B5Z8V7|RL14_HELPG 50S ribosomal protein L14 OS=Helicobacter pylori (strain G27) GN=rplN PE=3 SV=1 7 77 1.0E-19
sp|Q17ZC8|RL14_HELAH 50S ribosomal protein L14 OS=Helicobacter acinonychis (strain Sheeba) GN=rplN PE=3 SV=1 7 77 1.0E-19
sp|B6JNE7|RL14_HELP2 50S ribosomal protein L14 OS=Helicobacter pylori (strain P12) GN=rplN PE=3 SV=1 7 77 1.0E-19
sp|Q6MJ24|RL14_BDEBA 50S ribosomal protein L14 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rplN PE=3 SV=1 7 77 1.0E-19
sp|B6IRR6|RL14_RHOCS 50S ribosomal protein L14 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplN PE=3 SV=1 9 77 1.0E-19
sp|A7HWS1|RL14_PARL1 50S ribosomal protein L14 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplN PE=3 SV=1 9 77 2.0E-19
sp|Q5QXW8|RL14_IDILO 50S ribosomal protein L14 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplN PE=3 SV=1 9 77 2.0E-19
sp|B0V6V5|RL14_ACIBY 50S ribosomal protein L14 OS=Acinetobacter baumannii (strain AYE) GN=rplN PE=3 SV=1 8 77 2.0E-19
sp|A3M974|RL14_ACIBT 50S ribosomal protein L14 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplN PE=3 SV=1 8 77 2.0E-19
sp|B2HZ98|RL14_ACIBC 50S ribosomal protein L14 OS=Acinetobacter baumannii (strain ACICU) GN=rplN PE=3 SV=1 8 77 2.0E-19
sp|B7IA29|RL14_ACIB5 50S ribosomal protein L14 OS=Acinetobacter baumannii (strain AB0057) GN=rplN PE=3 SV=1 8 77 2.0E-19
sp|B7GW12|RL14_ACIB3 50S ribosomal protein L14 OS=Acinetobacter baumannii (strain AB307-0294) GN=rplN PE=3 SV=1 8 77 2.0E-19
sp|Q493J8|RL14_BLOPB 50S ribosomal protein L14 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplN PE=3 SV=1 8 77 2.0E-19
sp|A6Q1I8|RL14_NITSB 50S ribosomal protein L14 OS=Nitratiruptor sp. (strain SB155-2) GN=rplN PE=3 SV=1 7 77 3.0E-19
sp|B4R8M7|RL14_PHEZH 50S ribosomal protein L14 OS=Phenylobacterium zucineum (strain HLK1) GN=rplN PE=3 SV=1 9 77 3.0E-19
sp|Q1GK19|RL14_RUEST 50S ribosomal protein L14 OS=Ruegeria sp. (strain TM1040) GN=rplN PE=3 SV=1 9 77 3.0E-19
sp|Q5LW48|RL14_RUEPO 50S ribosomal protein L14 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplN PE=3 SV=1 9 77 3.0E-19
sp|Q8D202|RL14_WIGBR 50S ribosomal protein L14 OS=Wigglesworthia glossinidia brevipalpis GN=rplN PE=3 SV=1 8 77 3.0E-19
sp|Q2W2K1|RL14_MAGSA 50S ribosomal protein L14 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplN PE=3 SV=1 9 77 3.0E-19
sp|B8D839|RL14_BUCAT 50S ribosomal protein L14 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplN PE=3 SV=1 9 77 3.0E-19
sp|P57581|RL14_BUCAI 50S ribosomal protein L14 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplN PE=3 SV=1 9 77 3.0E-19
sp|B8D9T7|RL14_BUCA5 50S ribosomal protein L14 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplN PE=3 SV=1 9 77 3.0E-19
sp|B5YDV3|RL14_DICT6 50S ribosomal protein L14 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rplN PE=3 SV=1 8 76 4.0E-19
sp|A8LC46|RL14_FRASN 50S ribosomal protein L14 OS=Frankia sp. (strain EAN1pec) GN=rplN PE=3 SV=1 7 77 4.0E-19
sp|Q8K960|RL14_BUCAP 50S ribosomal protein L14 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplN PE=3 SV=1 9 77 4.0E-19
sp|B0VQS8|RL14_ACIBS 50S ribosomal protein L14 OS=Acinetobacter baumannii (strain SDF) GN=rplN PE=3 SV=1 8 77 4.0E-19
sp|Q6AD05|RL14_LEIXX 50S ribosomal protein L14 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rplN PE=3 SV=1 10 77 4.0E-19
sp|Q16AD4|RL14_ROSDO 50S ribosomal protein L14 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplN PE=3 SV=1 9 77 4.0E-19
sp|A8LM67|RL14_DINSH 50S ribosomal protein L14 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplN PE=3 SV=1 9 77 4.0E-19
sp|Q6F7S2|RL14_ACIAD 50S ribosomal protein L14 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplN PE=3 SV=1 9 77 4.0E-19
sp|B8E1E3|RL14_DICTD 50S ribosomal protein L14 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rplN PE=3 SV=1 8 76 4.0E-19
sp|Q7VQD8|RL14_BLOFL 50S ribosomal protein L14 OS=Blochmannia floridanus GN=rplN PE=3 SV=1 8 77 5.0E-19
sp|B8FES5|RL14_DESAA 50S ribosomal protein L14 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplN PE=3 SV=1 7 77 5.0E-19
sp|Q6LVA6|RL14_PHOPR 50S ribosomal protein L14 OS=Photobacterium profundum GN=rplN PE=3 SV=1 9 77 5.0E-19
sp|A6GZ89|RL14_FLAPJ 50S ribosomal protein L14 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rplN PE=3 SV=1 5 77 5.0E-19
sp|Q1LTC8|RL14_BAUCH 50S ribosomal protein L14 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplN PE=3 SV=2 9 77 5.0E-19
sp|B7KHZ7|RL14_CYAP7 50S ribosomal protein L14 OS=Cyanothece sp. (strain PCC 7424) GN=rplN PE=3 SV=1 10 77 5.0E-19
sp|B4RT38|RL14_ALTMD 50S ribosomal protein L14 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rplN PE=3 SV=1 9 77 6.0E-19
sp|A4YSK2|RL14_BRASO 50S ribosomal protein L14 OS=Bradyrhizobium sp. (strain ORS278) GN=rplN PE=3 SV=2 9 77 6.0E-19
sp|A5ELL7|RL14_BRASB 50S ribosomal protein L14 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplN PE=3 SV=1 9 77 6.0E-19
sp|Q89J94|RL14_BRADU 50S ribosomal protein L14 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplN PE=3 SV=1 9 77 6.0E-19
sp|Q211F8|RL14_RHOPB 50S ribosomal protein L14 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplN PE=3 SV=1 9 77 7.0E-19
sp|B3QYD4|RL14_CHLT3 50S ribosomal protein L14 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rplN PE=3 SV=1 10 77 8.0E-19
sp|Q2JFG6|RL14_FRASC 50S ribosomal protein L14 OS=Frankia sp. (strain CcI3) GN=rplN PE=3 SV=1 7 77 8.0E-19
sp|Q0RRR1|RL14_FRAAA 50S ribosomal protein L14 OS=Frankia alni (strain ACN14a) GN=rplN PE=3 SV=1 7 77 8.0E-19
sp|Q134T9|RL14_RHOPS 50S ribosomal protein L14 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplN PE=3 SV=1 9 77 8.0E-19
sp|Q07KM8|RL14_RHOP5 50S ribosomal protein L14 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplN PE=3 SV=1 9 77 8.0E-19
sp|Q2IXQ0|RL14_RHOP2 50S ribosomal protein L14 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplN PE=3 SV=1 9 77 8.0E-19
sp|C5CC52|RL14_MICLC 50S ribosomal protein L14 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rplN PE=3 SV=1 10 77 8.0E-19
sp|Q28UU4|RL14_JANSC 50S ribosomal protein L14 OS=Jannaschia sp. (strain CCS1) GN=rplN PE=3 SV=1 9 77 8.0E-19
sp|A6W382|RL14_MARMS 50S ribosomal protein L14 OS=Marinomonas sp. (strain MWYL1) GN=rplN PE=3 SV=1 9 77 9.0E-19
sp|B3QBX0|RL14_RHOPT 50S ribosomal protein L14 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplN PE=3 SV=1 9 77 9.0E-19
sp|Q6N4U4|RL14_RHOPA 50S ribosomal protein L14 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplN PE=1 SV=1 9 77 9.0E-19
sp|B5ELY9|RL14_ACIF5 50S ribosomal protein L14 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rplN PE=3 SV=1 9 77 9.0E-19
sp|B7J477|RL14_ACIF2 50S ribosomal protein L14 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rplN PE=3 SV=1 9 77 9.0E-19
sp|B1ZND8|RL14_OPITP 50S ribosomal protein L14 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=rplN PE=3 SV=1 5 77 9.0E-19
sp|B1W3Z7|RL14_STRGG 50S ribosomal protein L14 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rplN PE=3 SV=1 10 77 1.0E-18
sp|B9KZX7|RL14_THERP 50S ribosomal protein L14 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rplN PE=3 SV=1 7 77 1.0E-18
sp|A8Z677|RL14_SULMW 50S ribosomal protein L14 OS=Sulcia muelleri (strain GWSS) GN=rplN PE=3 SV=1 6 77 1.0E-18
sp|Q2NQN2|RL14_SODGM 50S ribosomal protein L14 OS=Sodalis glossinidius (strain morsitans) GN=rplN PE=3 SV=1 8 77 1.0E-18
sp|B8IYI2|RL14_DESDA 50S ribosomal protein L14 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rplN PE=3 SV=1 8 77 1.0E-18
sp|Q9A8U3|RL14_CAUCR 50S ribosomal protein L14 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|B8H4E4|RL14_CAUCN 50S ribosomal protein L14 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|A7MPH4|RL14_CROS8 50S ribosomal protein L14 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplN PE=3 SV=1 8 77 1.0E-18
sp|A5V5Z2|RL14_SPHWW 50S ribosomal protein L14 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplN PE=3 SV=1 5 77 1.0E-18
sp|A4WFB8|RL14_ENT38 50S ribosomal protein L14 OS=Enterobacter sp. (strain 638) GN=rplN PE=3 SV=1 8 77 1.0E-18
sp|C5BGL5|RL14_EDWI9 50S ribosomal protein L14 OS=Edwardsiella ictaluri (strain 93-146) GN=rplN PE=3 SV=1 8 77 1.0E-18
sp|B0RB49|RL14_CLAMS 50S ribosomal protein L14 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rplN PE=3 SV=2 10 77 1.0E-18
sp|A5CUA4|RL14_CLAM3 50S ribosomal protein L14 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rplN PE=3 SV=1 10 77 1.0E-18
sp|B1JDX4|RL14_PSEPW 50S ribosomal protein L14 OS=Pseudomonas putida (strain W619) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|Q1IFV6|RL14_PSEE4 50S ribosomal protein L14 OS=Pseudomonas entomophila (strain L48) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|Q4K543|RL14_PSEF5 50S ribosomal protein L14 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|B0U0X9|RL14_FRAP2 50S ribosomal protein L14 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplN PE=3 SV=1 5 77 1.0E-18
sp|P11094|RK14_CHLRE 50S ribosomal protein L14, chloroplastic OS=Chlamydomonas reinhardtii GN=rpl14 PE=3 SV=1 10 77 1.0E-18
sp|B2VK54|RL14_ERWT9 50S ribosomal protein L14 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplN PE=3 SV=1 8 77 1.0E-18
sp|B2IK72|RL14_BEII9 50S ribosomal protein L14 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|Q4ZMQ4|RL14_PSEU2 50S ribosomal protein L14 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|Q889W1|RL14_PSESM 50S ribosomal protein L14 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|Q88QM5|RL14_PSEPK 50S ribosomal protein L14 OS=Pseudomonas putida (strain KT2440) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|B0KK77|RL14_PSEPG 50S ribosomal protein L14 OS=Pseudomonas putida (strain GB-1) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|Q3K5Z8|RL14_PSEPF 50S ribosomal protein L14 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|A5VXQ7|RL14_PSEP1 50S ribosomal protein L14 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|C3K2W6|RL14_PSEFS 50S ribosomal protein L14 OS=Pseudomonas fluorescens (strain SBW25) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|Q48D46|RL14_PSE14 50S ribosomal protein L14 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplN PE=3 SV=1 9 77 1.0E-18
sp|A4XZ80|RL14_PSEMY 50S ribosomal protein L14 OS=Pseudomonas mendocina (strain ymp) GN=rplN PE=3 SV=1 9 77 2.0E-18
sp|A5FMZ0|RL14_FLAJ1 50S ribosomal protein L14 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rplN PE=3 SV=1 10 77 2.0E-18
sp|Q3YWU9|RL14_SHISS 50S ribosomal protein L14 OS=Shigella sonnei (strain Ss046) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|P0ADY6|RL14_SHIFL 50S ribosomal protein L14 OS=Shigella flexneri GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|Q0SZZ2|RL14_SHIF8 50S ribosomal protein L14 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|Q32B41|RL14_SHIDS 50S ribosomal protein L14 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|Q31VW6|RL14_SHIBS 50S ribosomal protein L14 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B2U2S8|RL14_SHIB3 50S ribosomal protein L14 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B7LRS6|RL14_ESCF3 50S ribosomal protein L14 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|Q1R617|RL14_ECOUT 50S ribosomal protein L14 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B1LHC4|RL14_ECOSM 50S ribosomal protein L14 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B6I224|RL14_ECOSE 50S ribosomal protein L14 OS=Escherichia coli (strain SE11) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B7NDT1|RL14_ECOLU 50S ribosomal protein L14 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|P0ADY3|RL14_ECOLI 50S ribosomal protein L14 OS=Escherichia coli (strain K12) GN=rplN PE=1 SV=1 8 77 2.0E-18
sp|B1IPY9|RL14_ECOLC 50S ribosomal protein L14 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|P0ADY4|RL14_ECOL6 50S ribosomal protein L14 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|A1AGJ9|RL14_ECOK1 50S ribosomal protein L14 OS=Escherichia coli O1:K1 / APEC GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|A8A5B5|RL14_ECOHS 50S ribosomal protein L14 OS=Escherichia coli O9:H4 (strain HS) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B1X6G2|RL14_ECODH 50S ribosomal protein L14 OS=Escherichia coli (strain K12 / DH10B) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|C4ZUG5|RL14_ECOBW 50S ribosomal protein L14 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B7M1M4|RL14_ECO8A 50S ribosomal protein L14 OS=Escherichia coli O8 (strain IAI1) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B7N194|RL14_ECO81 50S ribosomal protein L14 OS=Escherichia coli O81 (strain ED1a) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B7NLM9|RL14_ECO7I 50S ribosomal protein L14 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B5YTN1|RL14_ECO5E 50S ribosomal protein L14 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|P0ADY5|RL14_ECO57 50S ribosomal protein L14 OS=Escherichia coli O157:H7 GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B7L4J9|RL14_ECO55 50S ribosomal protein L14 OS=Escherichia coli (strain 55989 / EAEC) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B7MCS5|RL14_ECO45 50S ribosomal protein L14 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B7UK34|RL14_ECO27 50S ribosomal protein L14 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|A7ZSJ9|RL14_ECO24 50S ribosomal protein L14 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|C4L7U0|RL14_TOLAT 50S ribosomal protein L14 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|B2GJ03|RL14_KOCRD 50S ribosomal protein L14 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rplN PE=3 SV=1 10 77 2.0E-18
sp|Q2N9C1|RL14_ERYLH 50S ribosomal protein L14 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|Q2G8X0|RL14_NOVAD 50S ribosomal protein L14 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|Q5NQ55|RL14_ZYMMO 50S ribosomal protein L14 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplN PE=3 SV=2 5 77 2.0E-18
sp|C4XLY3|RL14_DESMR 50S ribosomal protein L14 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rplN PE=3 SV=1 7 77 2.0E-18
sp|Q1GPA9|RL14_SPHAL 50S ribosomal protein L14 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplN PE=3 SV=1 9 77 2.0E-18
sp|Q7M8E3|RL14_WOLSU 50S ribosomal protein L14 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rplN PE=3 SV=1 7 77 2.0E-18
sp|A4VHP0|RL14_PSEU5 50S ribosomal protein L14 OS=Pseudomonas stutzeri (strain A1501) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|Q0VSJ3|RL14_ALCBS 50S ribosomal protein L14 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplN PE=3 SV=1 9 77 2.0E-18
sp|B5FG19|RL14_VIBFM 50S ribosomal protein L14 OS=Vibrio fischeri (strain MJ11) GN=rplN PE=3 SV=1 9 77 2.0E-18
sp|Q5E8A5|RL14_VIBF1 50S ribosomal protein L14 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplN PE=3 SV=2 9 77 2.0E-18
sp|Q89A76|RL14_BUCBP 50S ribosomal protein L14 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplN PE=3 SV=1 8 77 2.0E-18
sp|C3LRP8|RL14_VIBCM 50S ribosomal protein L14 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplN PE=3 SV=1 9 77 2.0E-18
sp|Q9KNZ4|RL14_VIBCH 50S ribosomal protein L14 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplN PE=3 SV=1 9 77 2.0E-18
sp|A5F556|RL14_VIBC3 50S ribosomal protein L14 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplN PE=3 SV=1 9 77 2.0E-18
sp|A1AVL0|RL14_RUTMC 50S ribosomal protein L14 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rplN PE=3 SV=1 5 77 2.0E-18
sp|A6W5U8|RL14_KINRD 50S ribosomal protein L14 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rplN PE=3 SV=1 10 77 2.0E-18
sp|B6EPT5|RL14_ALISL 50S ribosomal protein L14 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplN PE=3 SV=1 9 77 2.0E-18
sp|A5EX89|RL14_DICNV 50S ribosomal protein L14 OS=Dichelobacter nodosus (strain VCS1703A) GN=rplN PE=3 SV=1 9 77 2.0E-18
sp|A9WSU7|RL14_RENSM 50S ribosomal protein L14 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=rplN PE=3 SV=1 10 77 2.0E-18
sp|O67570|RL14_AQUAE 50S ribosomal protein L14 OS=Aquifex aeolicus (strain VF5) GN=rplN PE=3 SV=1 11 77 2.0E-18
sp|Q9ZI42|RL14_AQUPY 50S ribosomal protein L14 OS=Aquifex pyrophilus GN=rplN PE=3 SV=1 11 77 3.0E-18
sp|Q8YPI9|RL14_NOSS1 50S ribosomal protein L14 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplN PE=3 SV=1 10 77 3.0E-18
sp|Q3MFB1|RL14_ANAVT 50S ribosomal protein L14 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplN PE=3 SV=1 10 77 3.0E-18
sp|B0T2D2|RL14_CAUSK 50S ribosomal protein L14 OS=Caulobacter sp. (strain K31) GN=rplN PE=3 SV=1 9 77 3.0E-18
sp|B7K238|RL14_CYAP8 50S ribosomal protein L14 OS=Cyanothece sp. (strain PCC 8801) GN=rplN PE=3 SV=1 10 77 3.0E-18
sp|A6UZJ8|RL14_PSEA7 50S ribosomal protein L14 OS=Pseudomonas aeruginosa (strain PA7) GN=rplN PE=3 SV=1 9 77 3.0E-18
sp|Q9HWE5|RL14_PSEAE 50S ribosomal protein L14 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplN PE=3 SV=1 8 77 3.0E-18
sp|Q02T70|RL14_PSEAB 50S ribosomal protein L14 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplN PE=3 SV=1 8 77 3.0E-18
sp|B7V654|RL14_PSEA8 50S ribosomal protein L14 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplN PE=3 SV=1 8 77 3.0E-18
sp|A8GKI7|RL14_SERP5 50S ribosomal protein L14 OS=Serratia proteamaculans (strain 568) GN=rplN PE=3 SV=1 8 77 3.0E-18
sp|Q87T03|RL14_VIBPA 50S ribosomal protein L14 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplN PE=3 SV=1 9 77 3.0E-18
sp|Q9L0D0|RL14_STRCO 50S ribosomal protein L14 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rplN PE=3 SV=1 10 77 3.0E-18
sp|A4FPL5|RL14_SACEN 50S ribosomal protein L14 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rplN PE=3 SV=1 8 77 3.0E-18
sp|B8D0D4|RL14_HALOH 50S ribosomal protein L14 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rplN PE=3 SV=1 10 77 3.0E-18
sp|B8ELF3|RL14_METSB 50S ribosomal protein L14 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplN PE=3 SV=1 9 77 3.0E-18
sp|Q7CPL5|RL14_SALTY 50S ribosomal protein L14 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|Q8XG78|RL14_SALTI 50S ribosomal protein L14 OS=Salmonella typhi GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|B4TXD2|RL14_SALSV 50S ribosomal protein L14 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|B5BGX6|RL14_SALPK 50S ribosomal protein L14 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|A9MSY8|RL14_SALPB 50S ribosomal protein L14 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplN PE=3 SV=2 8 77 4.0E-18
sp|Q5PIU3|RL14_SALPA 50S ribosomal protein L14 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|B4SUT0|RL14_SALNS 50S ribosomal protein L14 OS=Salmonella newport (strain SL254) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|B4TKK5|RL14_SALHS 50S ribosomal protein L14 OS=Salmonella heidelberg (strain SL476) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|B5RH25|RL14_SALG2 50S ribosomal protein L14 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|B5R281|RL14_SALEP 50S ribosomal protein L14 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|B5FJK4|RL14_SALDC 50S ribosomal protein L14 OS=Salmonella dublin (strain CT_02021853) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|Q57J42|RL14_SALCH 50S ribosomal protein L14 OS=Salmonella choleraesuis (strain SC-B67) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|A9MN58|RL14_SALAR 50S ribosomal protein L14 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|B5F7T5|RL14_SALA4 50S ribosomal protein L14 OS=Salmonella agona (strain SL483) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|C6DG64|RL14_PECCP 50S ribosomal protein L14 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|Q6CZY0|RL14_PECAS 50S ribosomal protein L14 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|A6TEW2|RL14_KLEP7 50S ribosomal protein L14 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|A8AQK6|RL14_CITK8 50S ribosomal protein L14 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|P46176|RL14_BUCAK 50S ribosomal protein L14 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|B1JIX1|RL14_YERPY 50S ribosomal protein L14 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|Q664T1|RL14_YERPS 50S ribosomal protein L14 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|A4TH02|RL14_YERPP 50S ribosomal protein L14 OS=Yersinia pestis (strain Pestoides F) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|Q1CCV4|RL14_YERPN 50S ribosomal protein L14 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|A9R905|RL14_YERPG 50S ribosomal protein L14 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|Q7CFT7|RL14_YERPE 50S ribosomal protein L14 OS=Yersinia pestis GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|B2K5M0|RL14_YERPB 50S ribosomal protein L14 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|Q1C2V7|RL14_YERPA 50S ribosomal protein L14 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|A7FNM4|RL14_YERP3 50S ribosomal protein L14 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|A1JS23|RL14_YERE8 50S ribosomal protein L14 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplN PE=3 SV=1 8 77 4.0E-18
sp|B1XJS9|RL14_SYNP2 50S ribosomal protein L14 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplN PE=3 SV=1 10 77 4.0E-18
sp|A0JZ74|RL14_ARTS2 50S ribosomal protein L14 OS=Arthrobacter sp. (strain FB24) GN=rplN PE=3 SV=1 10 77 4.0E-18
sp|B8HCZ6|RL14_ARTCA 50S ribosomal protein L14 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=rplN PE=3 SV=1 10 77 4.0E-18
sp|A1R8T5|RL14_ARTAT 50S ribosomal protein L14 OS=Arthrobacter aurescens (strain TC1) GN=rplN PE=3 SV=1 10 77 4.0E-18
sp|A0RM21|RL14_CAMFF 50S ribosomal protein L14 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rplN PE=3 SV=1 7 77 4.0E-18
sp|P66068|RL14_PASMU 50S ribosomal protein L14 OS=Pasteurella multocida (strain Pm70) GN=rplN PE=3 SV=1 9 77 4.0E-18
sp|P66067|RL14_HAEIN 50S ribosomal protein L14 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplN PE=3 SV=1 9 77 4.0E-18
sp|A5UHU1|RL14_HAEIG 50S ribosomal protein L14 OS=Haemophilus influenzae (strain PittGG) GN=rplN PE=3 SV=1 9 77 4.0E-18
sp|A5UDT7|RL14_HAEIE 50S ribosomal protein L14 OS=Haemophilus influenzae (strain PittEE) GN=rplN PE=3 SV=1 9 77 4.0E-18
sp|Q4QMB1|RL14_HAEI8 50S ribosomal protein L14 OS=Haemophilus influenzae (strain 86-028NP) GN=rplN PE=3 SV=1 9 77 4.0E-18
sp|A6VLJ8|RL14_ACTSZ 50S ribosomal protein L14 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplN PE=3 SV=1 9 77 4.0E-18
sp|Q82DN5|RL14_STRAW 50S ribosomal protein L14 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rplN PE=3 SV=1 10 77 4.0E-18
sp|Q7VKE3|RL14_HAEDU 50S ribosomal protein L14 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplN PE=3 SV=1 9 77 5.0E-18
sp|B0BSU1|RL14_ACTPJ 50S ribosomal protein L14 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplN PE=3 SV=1 9 77 5.0E-18
sp|B3GZ21|RL14_ACTP7 50S ribosomal protein L14 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplN PE=3 SV=1 9 77 5.0E-18
sp|A1T0D2|RL14_PSYIN 50S ribosomal protein L14 OS=Psychromonas ingrahamii (strain 37) GN=rplN PE=3 SV=1 9 77 5.0E-18
sp|A1REC4|RL14_SHESW 50S ribosomal protein L14 OS=Shewanella sp. (strain W3-18-1) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|Q0I095|RL14_SHESR 50S ribosomal protein L14 OS=Shewanella sp. (strain MR-7) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|Q0HNS7|RL14_SHESM 50S ribosomal protein L14 OS=Shewanella sp. (strain MR-4) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|A4YBX3|RL14_SHEPC 50S ribosomal protein L14 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|Q8EK59|RL14_SHEON 50S ribosomal protein L14 OS=Shewanella oneidensis (strain MR-1) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|A9KWB2|RL14_SHEB9 50S ribosomal protein L14 OS=Shewanella baltica (strain OS195) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|A6WHT8|RL14_SHEB8 50S ribosomal protein L14 OS=Shewanella baltica (strain OS185) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|A3DA62|RL14_SHEB5 50S ribosomal protein L14 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|B8EBJ5|RL14_SHEB2 50S ribosomal protein L14 OS=Shewanella baltica (strain OS223) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|A9FGI0|RL14_SORC5 50S ribosomal protein L14 OS=Sorangium cellulosum (strain So ce56) GN=rplN PE=3 SV=1 9 77 5.0E-18
sp|Q3SSV6|RL14_NITWN 50S ribosomal protein L14 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplN PE=3 SV=1 9 77 5.0E-18
sp|Q3J8S4|RL14_NITOC 50S ribosomal protein L14 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplN PE=3 SV=1 9 77 5.0E-18
sp|A1S228|RL14_SHEAM 50S ribosomal protein L14 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|Q7MYG1|RL14_PHOLL 50S ribosomal protein L14 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|B2FQJ4|RL14_STRMK 50S ribosomal protein L14 OS=Stenotrophomonas maltophilia (strain K279a) GN=rplN PE=3 SV=1 9 77 5.0E-18
sp|B4SKX3|RL14_STRM5 50S ribosomal protein L14 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rplN PE=3 SV=1 9 77 5.0E-18
sp|A0KRN4|RL14_SHESA 50S ribosomal protein L14 OS=Shewanella sp. (strain ANA-3) GN=rplN PE=3 SV=1 8 77 5.0E-18
sp|A4XBN6|RL14_SALTO 50S ribosomal protein L14 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rplN PE=3 SV=1 8 77 6.0E-18
sp|Q2S3Q4|RL14_SALRD 50S ribosomal protein L14 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rplN PE=3 SV=1 7 77 6.0E-18
sp|A8M519|RL14_SALAI 50S ribosomal protein L14 OS=Salinispora arenicola (strain CNS-205) GN=rplN PE=3 SV=1 8 77 6.0E-18
sp|A7ZG02|RL14_CAMC1 50S ribosomal protein L14 OS=Campylobacter concisus (strain 13826) GN=rplN PE=3 SV=1 7 77 6.0E-18
sp|B2A4E9|RL14_NATTJ 50S ribosomal protein L14 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplN PE=3 SV=1 10 77 6.0E-18
sp|Q5GWU4|RL14_XANOR 50S ribosomal protein L14 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rplN PE=3 SV=1 9 77 6.0E-18
sp|B2SQS0|RL14_XANOP 50S ribosomal protein L14 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rplN PE=3 SV=2 9 77 6.0E-18
sp|Q2NZZ5|RL14_XANOM 50S ribosomal protein L14 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rplN PE=3 SV=1 9 77 6.0E-18
sp|B1Z783|RL14_METPB 50S ribosomal protein L14 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplN PE=3 SV=2 9 77 6.0E-18
sp|A9W4T0|RL14_METEP 50S ribosomal protein L14 OS=Methylobacterium extorquens (strain PA1) GN=rplN PE=3 SV=1 9 77 6.0E-18
sp|Q7MPH8|RL14_VIBVY 50S ribosomal protein L14 OS=Vibrio vulnificus (strain YJ016) GN=rplN PE=3 SV=1 9 77 6.0E-18
sp|Q8DE49|RL14_VIBVU 50S ribosomal protein L14 OS=Vibrio vulnificus (strain CMCP6) GN=rplN PE=3 SV=1 9 77 6.0E-18
sp|Q1AU39|RL14_RUBXD 50S ribosomal protein L14 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplN PE=3 SV=1 10 77 7.0E-18
sp|Q1QN20|RL14_NITHX 50S ribosomal protein L14 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplN PE=3 SV=1 9 77 7.0E-18
sp|C4K7A8|RL14_HAMD5 50S ribosomal protein L14 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplN PE=3 SV=1 9 77 7.0E-18
sp|A8IAQ6|RL14_AZOC5 50S ribosomal protein L14 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rplN PE=3 SV=2 9 77 7.0E-18
sp|Q489A3|RL14_COLP3 50S ribosomal protein L14 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplN PE=3 SV=1 9 77 7.0E-18
sp|A0LRN0|RL14_ACIC1 50S ribosomal protein L14 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rplN PE=3 SV=1 8 77 7.0E-18
sp|A7N0I7|RL14_VIBCB 50S ribosomal protein L14 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplN PE=3 SV=1 9 77 8.0E-18
sp|Q7CLU5|RL14_XANCP 50S ribosomal protein L14 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rplN PE=3 SV=1 9 77 9.0E-18
sp|B0RU72|RL14_XANCB 50S ribosomal protein L14 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rplN PE=3 SV=1 9 77 9.0E-18
sp|Q4URE9|RL14_XANC8 50S ribosomal protein L14 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rplN PE=3 SV=1 9 77 9.0E-18
sp|Q3BWX3|RL14_XANC5 50S ribosomal protein L14 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rplN PE=3 SV=1 9 77 9.0E-18
sp|Q8NL02|RL14_XANAC 50S ribosomal protein L14 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rplN PE=3 SV=1 9 77 9.0E-18
sp|B0RZR9|RL14_FINM2 50S ribosomal protein L14 OS=Finegoldia magna (strain ATCC 29328) GN=rplN PE=3 SV=1 10 77 9.0E-18
sp|B1LWR6|RL14_METRJ 50S ribosomal protein L14 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplN PE=3 SV=1 9 77 9.0E-18
sp|B1WQS0|RL14_CYAA5 50S ribosomal protein L14 OS=Cyanothece sp. (strain ATCC 51142) GN=rplN PE=3 SV=1 10 77 9.0E-18
sp|C5C0I1|RL14_BEUC1 50S ribosomal protein L14 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=rplN PE=3 SV=1 10 77 9.0E-18
sp|Q21M48|RL14_SACD2 50S ribosomal protein L14 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rplN PE=3 SV=1 9 77 1.0E-17
sp|B6JEU3|RL14_OLICO 50S ribosomal protein L14 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplN PE=3 SV=1 9 77 1.0E-17
sp|Q1ISB2|RL14_KORVE 50S ribosomal protein L14 OS=Koribacter versatilis (strain Ellin345) GN=rplN PE=3 SV=1 11 77 1.0E-17
sp|Q12SU9|RL14_SHEDO 50S ribosomal protein L14 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplN PE=3 SV=1 8 77 1.0E-17
sp|Q3IJL9|RL14_PSEHT 50S ribosomal protein L14 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplN PE=3 SV=1 9 77 1.0E-17
sp|Q2S922|RL14_HAHCH 50S ribosomal protein L14 OS=Hahella chejuensis (strain KCTC 2396) GN=rplN PE=3 SV=1 8 77 1.0E-17
sp|Q47LK3|RL14_THEFY 50S ribosomal protein L14 OS=Thermobifida fusca (strain YX) GN=rplN PE=3 SV=1 8 77 1.0E-17
sp|Q8DMM2|RL14_THEEB 50S ribosomal protein L14 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplN PE=3 SV=1 10 77 1.0E-17
sp|C5BQ71|RL14_TERTT 50S ribosomal protein L14 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplN PE=3 SV=1 9 77 1.0E-17
sp|B0UX24|RL14_HISS2 50S ribosomal protein L14 OS=Histophilus somni (strain 2336) GN=rplN PE=3 SV=1 9 77 1.0E-17
sp|Q0I152|RL14_HAES1 50S ribosomal protein L14 OS=Haemophilus somnus (strain 129Pt) GN=rplN PE=3 SV=1 9 77 1.0E-17
sp|Q8UE28|RL14_AGRFC 50S ribosomal protein L14 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplN PE=3 SV=1 9 77 1.0E-17
sp|B0TC66|RL14_HELMI 50S ribosomal protein L14 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplN PE=3 SV=1 10 77 1.0E-17
sp|B8HMR4|RL14_CYAP4 50S ribosomal protein L14 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rplN PE=3 SV=1 10 77 1.0E-17
sp|Q6AP61|RL14_DESPS 50S ribosomal protein L14 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplN PE=3 SV=1 8 77 1.0E-17
sp|Q605C2|RL14_METCA 50S ribosomal protein L14 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rplN PE=3 SV=1 9 77 1.0E-17
sp|B3PK47|RL14_CELJU 50S ribosomal protein L14 OS=Cellvibrio japonicus (strain Ueda107) GN=rplN PE=3 SV=1 9 77 1.0E-17
sp|A7HBM8|RL14_ANADF 50S ribosomal protein L14 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplN PE=3 SV=1 7 77 1.0E-17
sp|A7H102|RL14_CAMC5 50S ribosomal protein L14 OS=Campylobacter curvus (strain 525.92) GN=rplN PE=3 SV=1 7 77 1.0E-17
sp|B9MKH1|RL14_CALBD 50S ribosomal protein L14 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rplN PE=3 SV=1 10 77 1.0E-17
sp|B4F1J4|RL14_PROMH 50S ribosomal protein L14 OS=Proteus mirabilis (strain HI4320) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|Q06SH0|RK14_STIHE 50S ribosomal protein L14, chloroplastic OS=Stigeoclonium helveticum GN=rpl14 PE=3 SV=1 10 77 2.0E-17
sp|B4UBA9|RL14_ANASK 50S ribosomal protein L14 OS=Anaeromyxobacter sp. (strain K) GN=rplN PE=3 SV=1 7 77 2.0E-17
sp|Q2IJ77|RL14_ANADE 50S ribosomal protein L14 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplN PE=3 SV=1 7 77 2.0E-17
sp|B8J870|RL14_ANAD2 50S ribosomal protein L14 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplN PE=3 SV=1 7 77 2.0E-17
sp|A6X0C8|RL14_OCHA4 50S ribosomal protein L14 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|Q8G083|RL14_BRUSU 50S ribosomal protein L14 OS=Brucella suis biovar 1 (strain 1330) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|B0CH22|RL14_BRUSI 50S ribosomal protein L14 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|A5VQZ6|RL14_BRUO2 50S ribosomal protein L14 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|Q8YHN0|RL14_BRUME 50S ribosomal protein L14 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|C0RJJ1|RL14_BRUMB 50S ribosomal protein L14 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|A9M5P0|RL14_BRUC2 50S ribosomal protein L14 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|P73310|RL14_SYNY3 50S ribosomal protein L14 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplN PE=1 SV=1 10 77 2.0E-17
sp|A5WCK0|RL14_PSYWF 50S ribosomal protein L14 OS=Psychrobacter sp. (strain PRwf-1) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|Q1QDH6|RL14_PSYCK 50S ribosomal protein L14 OS=Psychrobacter cryohalolentis (strain K5) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|Q4FUE6|RL14_PSYA2 50S ribosomal protein L14 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|Q2LQB0|RL14_SYNAS 50S ribosomal protein L14 OS=Syntrophus aciditrophicus (strain SB) GN=rplN PE=3 SV=2 7 77 2.0E-17
sp|B2ITP5|RL14_NOSP7 50S ribosomal protein L14 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rplN PE=3 SV=1 10 77 2.0E-17
sp|Q7TU29|RL14_PROMP 50S ribosomal protein L14 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rplN PE=3 SV=1 10 77 2.0E-17
sp|A2BYS6|RL14_PROM5 50S ribosomal protein L14 OS=Prochlorococcus marinus (strain MIT 9515) GN=rplN PE=3 SV=1 10 77 2.0E-17
sp|Q0TCF1|RL14_ECOL5 50S ribosomal protein L14 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplN PE=3 SV=1 8 77 2.0E-17
sp|A0T0I9|RK14_PHATC 50S ribosomal protein L14, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpl14 PE=3 SV=1 10 77 2.0E-17
sp|A8F4S1|RL14_PSELT 50S ribosomal protein L14 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rplN PE=3 SV=1 10 77 2.0E-17
sp|A1ALV1|RL14_PELPD 50S ribosomal protein L14 OS=Pelobacter propionicus (strain DSM 2379) GN=rplN PE=3 SV=1 7 77 2.0E-17
sp|A9NEE3|RL14_ACHLI 50S ribosomal protein L14 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplN PE=3 SV=1 7 77 2.0E-17
sp|B2UMS9|RL14_AKKM8 50S ribosomal protein L14 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rplN PE=3 SV=1 7 77 2.0E-17
sp|A6U869|RL14_SINMW 50S ribosomal protein L14 OS=Sinorhizobium medicae (strain WSM419) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|Q92QG0|RL14_RHIME 50S ribosomal protein L14 OS=Rhizobium meliloti (strain 1021) GN=rplN PE=3 SV=1 9 77 2.0E-17
sp|A8ZV67|RL14_DESOH 50S ribosomal protein L14 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rplN PE=3 SV=1 7 77 2.0E-17
sp|B3CT15|RL14_ORITI 50S ribosomal protein L14 OS=Orientia tsutsugamushi (strain Ikeda) GN=rplN PE=3 SV=1 8 76 3.0E-17
sp|Q1MID1|RL14_RHIL3 50S ribosomal protein L14 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|B0UHV9|RL14_METS4 50S ribosomal protein L14 OS=Methylobacterium sp. (strain 4-46) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|Q7VGD4|RL14_HELHP 50S ribosomal protein L14 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rplN PE=3 SV=1 7 77 3.0E-17
sp|Q3SLN9|RL14_THIDA 50S ribosomal protein L14 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplN PE=3 SV=1 5 77 3.0E-17
sp|C3MAZ0|RL14_RHISN 50S ribosomal protein L14 OS=Rhizobium sp. (strain NGR234) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|A4IZS4|RL14_FRATW 50S ribosomal protein L14 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|Q5NHV8|RL14_FRATT 50S ribosomal protein L14 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|Q0BNR7|RL14_FRATO 50S ribosomal protein L14 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|A0Q4J3|RL14_FRATN 50S ribosomal protein L14 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|B2SDX5|RL14_FRATM 50S ribosomal protein L14 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|Q2A5G0|RL14_FRATH 50S ribosomal protein L14 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|A7N9T5|RL14_FRATF 50S ribosomal protein L14 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|Q14JB0|RL14_FRAT1 50S ribosomal protein L14 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|Q1D765|RL14_MYXXD 50S ribosomal protein L14 OS=Myxococcus xanthus (strain DK 1622) GN=rplN PE=3 SV=1 7 77 3.0E-17
sp|A1TYK7|RL14_MARHV 50S ribosomal protein L14 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|B1KMX3|RL14_SHEWM 50S ribosomal protein L14 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|Q11QC2|RL14_CYTH3 50S ribosomal protein L14 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rplN PE=3 SV=1 6 77 3.0E-17
sp|A8G1D8|RL14_SHESH 50S ribosomal protein L14 OS=Shewanella sediminis (strain HAW-EB3) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|B5ZYU5|RL14_RHILW 50S ribosomal protein L14 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|Q2K9K6|RL14_RHIEC 50S ribosomal protein L14 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|B3PWT1|RL14_RHIE6 50S ribosomal protein L14 OS=Rhizobium etli (strain CIAT 652) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|B9JDT8|RL14_AGRRK 50S ribosomal protein L14 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|Q87E72|RL14_XYLFT 50S ribosomal protein L14 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|B2I8H9|RL14_XYLF2 50S ribosomal protein L14 OS=Xylella fastidiosa (strain M23) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|Q089P4|RL14_SHEFN 50S ribosomal protein L14 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplN PE=3 SV=1 8 77 3.0E-17
sp|Q47J93|RL14_DECAR 50S ribosomal protein L14 OS=Dechloromonas aromatica (strain RCB) GN=rplN PE=3 SV=1 5 77 3.0E-17
sp|A4G9S8|RL14_HERAR 50S ribosomal protein L14 OS=Herminiimonas arsenicoxydans GN=rplN PE=3 SV=1 5 77 3.0E-17
sp|Q2RQX0|RL14_RHORT 50S ribosomal protein L14 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|B0U5K9|RL14_XYLFM 50S ribosomal protein L14 OS=Xylella fastidiosa (strain M12) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|Q9PE66|RL14_XYLFA 50S ribosomal protein L14 OS=Xylella fastidiosa (strain 9a5c) GN=rplN PE=3 SV=1 9 77 3.0E-17
sp|C1A6R5|RL14_GEMAT 50S ribosomal protein L14 OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=rplN PE=3 SV=1 10 77 3.0E-17
sp|Q1ACG1|RK14_CHAVU 50S ribosomal protein L14, chloroplastic OS=Chara vulgaris GN=rpl14 PE=3 SV=1 10 77 3.0E-17
sp|A0M588|RL14_GRAFK 50S ribosomal protein L14 OS=Gramella forsetii (strain KT0803) GN=rplN PE=3 SV=1 10 77 4.0E-17
sp|A1KB17|RL14_AZOSB 50S ribosomal protein L14 OS=Azoarcus sp. (strain BH72) GN=rplN PE=3 SV=1 5 77 4.0E-17
sp|B8CNE3|RL14_SHEPW 50S ribosomal protein L14 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplN PE=3 SV=1 9 77 4.0E-17
sp|A8GYY6|RL14_SHEPA 50S ribosomal protein L14 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplN PE=3 SV=1 9 77 4.0E-17
sp|A3Q992|RL14_SHELP 50S ribosomal protein L14 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplN PE=3 SV=1 9 77 4.0E-17
sp|A5CXL4|RL14_VESOH 50S ribosomal protein L14 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rplN PE=3 SV=1 9 77 4.0E-17
sp|A4TEC7|RL14_MYCGI 50S ribosomal protein L14 OS=Mycobacterium gilvum (strain PYR-GCK) GN=rplN PE=3 SV=1 10 77 4.0E-17
sp|Q46WF4|RL14_CUPPJ 50S ribosomal protein L14 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rplN PE=3 SV=1 5 77 4.0E-17
sp|Q1LI47|RL14_CUPMC 50S ribosomal protein L14 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rplN PE=3 SV=1 5 77 4.0E-17
sp|P60558|RL14_THETH 50S ribosomal protein L14 OS=Thermus thermophilus GN=rplN PE=3 SV=1 10 77 4.0E-17
sp|Q72I14|RL14_THET2 50S ribosomal protein L14 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rplN PE=1 SV=1 10 77 4.0E-17
sp|P60557|RL14_THEAQ 50S ribosomal protein L14 OS=Thermus aquaticus GN=rplN PE=3 SV=1 10 77 4.0E-17
sp|B1XSR1|RL14_POLNS 50S ribosomal protein L14 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rplN PE=3 SV=1 5 77 5.0E-17
sp|A1T4R6|RL14_MYCVP 50S ribosomal protein L14 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rplN PE=3 SV=1 10 77 5.0E-17
sp|B9JVP7|RL14_AGRVS 50S ribosomal protein L14 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplN PE=3 SV=1 9 77 5.0E-17
sp|Q98N47|RL14_RHILO 50S ribosomal protein L14 OS=Rhizobium loti (strain MAFF303099) GN=rplN PE=3 SV=1 9 77 5.0E-17
sp|Q50308|RL14_MYCPN 50S ribosomal protein L14 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rplN PE=3 SV=1 7 76 5.0E-17
sp|Q1WSA0|RL14_LACS1 50S ribosomal protein L14 OS=Lactobacillus salivarius (strain UCC118) GN=rplN PE=3 SV=1 10 77 5.0E-17
sp|Q2RFQ7|RL14_MOOTA 50S ribosomal protein L14 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplN PE=3 SV=1 10 77 5.0E-17
sp|A6T3J4|RL14_JANMA 50S ribosomal protein L14 OS=Janthinobacterium sp. (strain Marseille) GN=rplN PE=3 SV=1 5 77 5.0E-17
sp|Q3A6N7|RL14_PELCD 50S ribosomal protein L14 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rplN PE=3 SV=1 7 77 5.0E-17
sp|Q5SHP8|RL14_THET8 50S ribosomal protein L14 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rplN PE=1 SV=1 10 77 5.0E-17
sp|A6MW11|RK14_RHDSA 50S ribosomal protein L14, chloroplastic OS=Rhodomonas salina GN=rpl14 PE=3 SV=1 10 77 5.0E-17
sp|C6C195|RL14_DESAD 50S ribosomal protein L14 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rplN PE=3 SV=1 8 77 5.0E-17
sp|Q39XZ6|RL14_GEOMG 50S ribosomal protein L14 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplN PE=3 SV=1 7 77 5.0E-17
sp|A4SUX1|RL14_POLSQ 50S ribosomal protein L14 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rplN PE=3 SV=1 5 77 6.0E-17
sp|O32993|RL14_MYCLE 50S ribosomal protein L14 OS=Mycobacterium leprae (strain TN) GN=rplN PE=3 SV=1 10 77 6.0E-17
sp|B3R7R3|RL14_CUPTR 50S ribosomal protein L14 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rplN PE=3 SV=1 5 77 6.0E-17
sp|Q0K629|RL14_CUPNH 50S ribosomal protein L14 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplN PE=3 SV=1 5 77 6.0E-17
sp|Q01WA2|RL14_SOLUE 50S ribosomal protein L14 OS=Solibacter usitatus (strain Ellin6076) GN=rplN PE=3 SV=1 5 77 6.0E-17
sp|B2GDV9|RL14_LACF3 50S ribosomal protein L14 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rplN PE=3 SV=1 10 77 6.0E-17
sp|Q2JIL7|RL14_SYNJB 50S ribosomal protein L14 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rplN PE=3 SV=1 10 77 6.0E-17
sp|B0TM02|RL14_SHEHH 50S ribosomal protein L14 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplN PE=3 SV=1 9 77 6.0E-17
sp|B0JHZ3|RL14_MICAN 50S ribosomal protein L14 OS=Microcystis aeruginosa (strain NIES-843) GN=rplN PE=3 SV=1 10 77 6.0E-17
sp|Q57CR8|RL14_BRUAB 50S ribosomal protein L14 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplN PE=3 SV=1 9 77 6.0E-17
sp|Q2YRA5|RL14_BRUA2 50S ribosomal protein L14 OS=Brucella abortus (strain 2308) GN=rplN PE=3 SV=1 9 77 6.0E-17
sp|B2S669|RL14_BRUA1 50S ribosomal protein L14 OS=Brucella abortus (strain S19) GN=rplN PE=3 SV=1 9 77 6.0E-17
sp|Q8XV22|RL14_RALSO 50S ribosomal protein L14 OS=Ralstonia solanacearum (strain GMI1000) GN=rplN PE=3 SV=1 5 77 6.0E-17
sp|B2UEK9|RL14_RALPJ 50S ribosomal protein L14 OS=Ralstonia pickettii (strain 12J) GN=rplN PE=3 SV=1 5 77 6.0E-17
sp|B8GV48|RL14_THISH 50S ribosomal protein L14 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplN PE=3 SV=1 9 77 7.0E-17
sp|Q7NQG2|RL14_CHRVO 50S ribosomal protein L14 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rplN PE=3 SV=1 5 77 7.0E-17
sp|Q11HR2|RL14_CHESB 50S ribosomal protein L14 OS=Chelativorans sp. (strain BNC1) GN=rplN PE=3 SV=1 9 77 7.0E-17
sp|B2X1Y5|RK14_OEDCA 50S ribosomal protein L14, chloroplastic OS=Oedogonium cardiacum GN=rpl14 PE=3 SV=1 11 77 7.0E-17
sp|A8ESV3|RL14_ARCB4 50S ribosomal protein L14 OS=Arcobacter butzleri (strain RM4018) GN=rplN PE=3 SV=1 7 77 7.0E-17
sp|Q4G356|RK14_EMIHU 50S ribosomal protein L14, chloroplastic OS=Emiliania huxleyi GN=rpl14 PE=3 SV=1 10 77 7.0E-17
sp|Q2JV91|RL14_SYNJA 50S ribosomal protein L14 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rplN PE=3 SV=1 10 77 7.0E-17
sp|O24699|RL14_SYNP6 50S ribosomal protein L14 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplN PE=3 SV=1 10 77 7.0E-17
sp|Q31L17|RL14_SYNE7 50S ribosomal protein L14 OS=Synechococcus elongatus (strain PCC 7942) GN=rplN PE=3 SV=1 10 77 7.0E-17
sp|O46904|RK14_GUITH 50S ribosomal protein L14, chloroplastic OS=Guillardia theta GN=rpl14 PE=3 SV=1 10 77 8.0E-17
sp|Q5P322|RL14_AROAE 50S ribosomal protein L14 OS=Aromatoleum aromaticum (strain EbN1) GN=rplN PE=3 SV=1 5 77 8.0E-17
sp|B3QR72|RL14_CHLP8 50S ribosomal protein L14 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rplN PE=3 SV=1 10 77 8.0E-17
sp|B0BCF7|RL14_CHLTB 50S ribosomal protein L14 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rplN PE=3 SV=1 4 77 9.0E-17
sp|B0B892|RL14_CHLT2 50S ribosomal protein L14 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rplN PE=3 SV=1 4 77 9.0E-17
sp|Q3API3|RL14_CHLCH 50S ribosomal protein L14 OS=Chlorobium chlorochromatii (strain CaD3) GN=rplN PE=3 SV=1 10 77 9.0E-17
sp|Q83ER6|RL14_COXBU 50S ribosomal protein L14 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplN PE=3 SV=1 9 76 9.0E-17
sp|A9NAY0|RL14_COXBR 50S ribosomal protein L14 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplN PE=3 SV=1 9 76 9.0E-17
sp|A9KD21|RL14_COXBN 50S ribosomal protein L14 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplN PE=3 SV=1 9 76 9.0E-17
sp|B6J253|RL14_COXB2 50S ribosomal protein L14 OS=Coxiella burnetii (strain CbuG_Q212) GN=rplN PE=3 SV=1 9 76 9.0E-17
sp|B6J5E2|RL14_COXB1 50S ribosomal protein L14 OS=Coxiella burnetii (strain CbuK_Q154) GN=rplN PE=3 SV=1 9 76 9.0E-17
sp|Q8KAI2|RL14_CHLTE 50S ribosomal protein L14 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rplN PE=3 SV=1 10 77 9.0E-17
sp|Q3Z971|RL14_DEHM1 50S ribosomal protein L14 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rplN PE=3 SV=1 8 77 9.0E-17
sp|B2JI55|RL14_BURP8 50S ribosomal protein L14 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rplN PE=3 SV=1 9 77 9.0E-17
sp|Q3ZZL4|RL14_DEHMC 50S ribosomal protein L14 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rplN PE=3 SV=1 8 77 9.0E-17
sp|A5FRY5|RL14_DEHMB 50S ribosomal protein L14 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rplN PE=3 SV=1 8 77 9.0E-17
sp|Q2SU37|RL14_BURTA 50S ribosomal protein L14 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rplN PE=3 SV=2 9 77 1.0E-16
sp|Q63Q21|RL14_BURPS 50S ribosomal protein L14 OS=Burkholderia pseudomallei (strain K96243) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|A3NEG9|RL14_BURP6 50S ribosomal protein L14 OS=Burkholderia pseudomallei (strain 668) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|Q3JMS3|RL14_BURP1 50S ribosomal protein L14 OS=Burkholderia pseudomallei (strain 1710b) GN=rplN PE=3 SV=2 9 77 1.0E-16
sp|A3P0A3|RL14_BURP0 50S ribosomal protein L14 OS=Burkholderia pseudomallei (strain 1106a) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|A1V893|RL14_BURMS 50S ribosomal protein L14 OS=Burkholderia mallei (strain SAVP1) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|Q62GL5|RL14_BURMA 50S ribosomal protein L14 OS=Burkholderia mallei (strain ATCC 23344) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|A2S7I6|RL14_BURM9 50S ribosomal protein L14 OS=Burkholderia mallei (strain NCTC 10229) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|A3MRW4|RL14_BURM7 50S ribosomal protein L14 OS=Burkholderia mallei (strain NCTC 10247) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|A9ADK3|RL14_BURM1 50S ribosomal protein L14 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rplN PE=3 SV=2 9 77 1.0E-16
sp|Q13TI0|RL14_BURXL 50S ribosomal protein L14 OS=Burkholderia xenovorans (strain LB400) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|A4JAQ0|RL14_BURVG 50S ribosomal protein L14 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|B2T741|RL14_BURPP 50S ribosomal protein L14 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|Q0BJ36|RL14_BURCM 50S ribosomal protein L14 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|B1YRN9|RL14_BURA4 50S ribosomal protein L14 OS=Burkholderia ambifaria (strain MC40-6) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|A7HM42|RL14_FERNB 50S ribosomal protein L14 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|Q8RIG5|RL14_FUSNN 50S ribosomal protein L14 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rplN PE=3 SV=1 10 76 1.0E-16
sp|P38508|RL14_THEMA 50S ribosomal protein L14 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplN PE=3 SV=2 7 77 1.0E-16
sp|Q39KF7|RL14_BURL3 50S ribosomal protein L14 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|B4E5D0|RL14_BURCJ 50S ribosomal protein L14 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|A0K3N5|RL14_BURCH 50S ribosomal protein L14 OS=Burkholderia cenocepacia (strain HI2424) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|B1JU32|RL14_BURCC 50S ribosomal protein L14 OS=Burkholderia cenocepacia (strain MC0-3) GN=rplN PE=3 SV=1 9 77 1.0E-16
sp|Q1BRV8|RL14_BURCA 50S ribosomal protein L14 OS=Burkholderia cenocepacia (strain AU 1054) GN=rplN PE=3 SV=2 9 77 1.0E-16
sp|Q46IR9|RL14_PROMT 50S ribosomal protein L14 OS=Prochlorococcus marinus (strain NATL2A) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|A2C4Y9|RL14_PROM1 50S ribosomal protein L14 OS=Prochlorococcus marinus (strain NATL1A) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|C1DAS7|RL14_LARHH 50S ribosomal protein L14 OS=Laribacter hongkongensis (strain HLHK9) GN=rplN PE=3 SV=1 5 77 1.0E-16
sp|A6LLM3|RL14_THEM4 50S ribosomal protein L14 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|C6E4P7|RL14_GEOSM 50S ribosomal protein L14 OS=Geobacter sp. (strain M21) GN=rplN PE=3 SV=1 7 77 1.0E-16
sp|B3E7U5|RL14_GEOLS 50S ribosomal protein L14 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rplN PE=3 SV=1 7 77 1.0E-16
sp|B5EFR0|RL14_GEOBB 50S ribosomal protein L14 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rplN PE=3 SV=1 7 77 1.0E-16
sp|B1Y8C7|RL14_LEPCP 50S ribosomal protein L14 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rplN PE=3 SV=1 5 77 1.0E-16
sp|A6YGC8|RK14_LEPTE 50S ribosomal protein L14, chloroplastic OS=Leptosira terrestris GN=rpl14 PE=3 SV=1 10 77 1.0E-16
sp|B9K896|RL14_THENN 50S ribosomal protein L14 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rplN PE=3 SV=1 7 77 1.0E-16
sp|P06381|RK14_MARPO 50S ribosomal protein L14, chloroplastic OS=Marchantia polymorpha GN=rpl14 PE=3 SV=1 10 77 1.0E-16
sp|B1LBN0|RL14_THESQ 50S ribosomal protein L14 OS=Thermotoga sp. (strain RQ2) GN=rplN PE=3 SV=1 7 77 1.0E-16
sp|A5IM93|RL14_THEP1 50S ribosomal protein L14 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rplN PE=3 SV=1 7 77 1.0E-16
sp|B3EP51|RL14_CHLPB 50S ribosomal protein L14 OS=Chlorobium phaeobacteroides (strain BS1) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|A9B421|RL14_HERA2 50S ribosomal protein L14 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rplN PE=3 SV=1 11 77 1.0E-16
sp|Q20F08|RK14_OLTVI 50S ribosomal protein L14, chloroplastic OS=Oltmannsiellopsis viridis GN=rpl14 PE=3 SV=1 10 77 1.0E-16
sp|Q21QN3|RL14_RHOFT 50S ribosomal protein L14 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rplN PE=3 SV=1 5 77 1.0E-16
sp|A0ALV8|RL14_LISW6 50S ribosomal protein L14 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|Q927L7|RL14_LISMO 50S ribosomal protein L14 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|B8DB18|RL14_LISMH 50S ribosomal protein L14 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|Q71WF6|RL14_LISMF 50S ribosomal protein L14 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|C1KZH0|RL14_LISMC 50S ribosomal protein L14 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|Q7ANU6|RL14_LISIN 50S ribosomal protein L14 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|B9L6M3|RL14_NAUPA 50S ribosomal protein L14 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rplN PE=3 SV=1 7 77 1.0E-16
sp|Q7V9X2|RL14_PROMA 50S ribosomal protein L14 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|A2SLE6|RL14_METPP 50S ribosomal protein L14 OS=Methylibium petroleiphilum (strain PM1) GN=rplN PE=3 SV=1 5 77 1.0E-16
sp|C4KZN6|RL14_EXISA 50S ribosomal protein L14 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rplN PE=3 SV=1 10 77 1.0E-16
sp|B4S5B8|RL14_PROA2 50S ribosomal protein L14 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rplN PE=3 SV=1 10 77 2.0E-16
sp|Q68W88|RL14_RICTY 50S ribosomal protein L14 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplN PE=3 SV=1 9 76 2.0E-16
sp|Q9ZCR5|RL14_RICPR 50S ribosomal protein L14 OS=Rickettsia prowazekii (strain Madrid E) GN=rplN PE=3 SV=1 9 76 2.0E-16
sp|Q15X63|RL14_PSEA6 50S ribosomal protein L14 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplN PE=3 SV=1 9 77 2.0E-16
sp|Q7MTM3|RL14_PORGI 50S ribosomal protein L14 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rplN PE=3 SV=1 7 77 2.0E-16
sp|B2RLY2|RL14_PORG3 50S ribosomal protein L14 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rplN PE=3 SV=1 7 77 2.0E-16
sp|Q83FZ6|RL14_TROWT 50S ribosomal protein L14 OS=Tropheryma whipplei (strain Twist) GN=rplN PE=3 SV=1 7 77 2.0E-16
sp|Q83I68|RL14_TROW8 50S ribosomal protein L14 OS=Tropheryma whipplei (strain TW08/27) GN=rplN PE=3 SV=1 7 77 2.0E-16
sp|C5CQ90|RL14_VARPS 50S ribosomal protein L14 OS=Variovorax paradoxus (strain S110) GN=rplN PE=3 SV=1 5 77 2.0E-16
sp|Q2L284|RL14_BORA1 50S ribosomal protein L14 OS=Bordetella avium (strain 197N) GN=rplN PE=3 SV=1 5 77 2.0E-16
sp|Q6YXL0|RK14_PHYPA 50S ribosomal protein L14, chloroplastic OS=Physcomitrella patens subsp. patens GN=rpl14 PE=3 SV=1 10 77 2.0E-16
sp|A9BCN7|RL14_PROM4 50S ribosomal protein L14 OS=Prochlorococcus marinus (strain MIT 9211) GN=rplN PE=3 SV=1 10 77 2.0E-16
sp|Q4FLM8|RL14_PELUB 50S ribosomal protein L14 OS=Pelagibacter ubique (strain HTCC1062) GN=rplN PE=3 SV=1 9 77 2.0E-16
sp|Q9PJM4|RL14_CHLMU 50S ribosomal protein L14 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rplN PE=3 SV=1 4 77 2.0E-16
sp|Q6G2X5|RL14_BARHE 50S ribosomal protein L14 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplN PE=3 SV=1 9 77 2.0E-16
sp|P0CD81|RL14_CHLTR 50S ribosomal protein L14 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rplN PE=3 SV=1 4 77 2.0E-16
sp|Q3KLH9|RL14_CHLTA 50S ribosomal protein L14 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rplN PE=3 SV=1 4 77 2.0E-16
sp|A9IW13|RL14_BART1 50S ribosomal protein L14 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rplN PE=3 SV=1 9 77 2.0E-16
sp|Q6FZD2|RL14_BARQU 50S ribosomal protein L14 OS=Bartonella quintana (strain Toulouse) GN=rplN PE=3 SV=1 9 77 2.0E-16
sp|B2G8W8|RL14_LACRJ 50S ribosomal protein L14 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplN PE=3 SV=1 10 77 2.0E-16
sp|A5VLJ5|RL14_LACRD 50S ribosomal protein L14 OS=Lactobacillus reuteri (strain DSM 20016) GN=rplN PE=3 SV=1 10 77 2.0E-16
sp|A1USM4|RL14_BARBK 50S ribosomal protein L14 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rplN1 PE=3 SV=1 9 77 2.0E-16
sp|Q6B8W3|RK14_GRATL 50S ribosomal protein L14, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rpl14 PE=3 SV=1 10 76 2.0E-16
sp|A5GAX4|RL14_GEOUR 50S ribosomal protein L14 OS=Geobacter uraniireducens (strain Rf4) GN=rplN PE=3 SV=1 7 77 2.0E-16
sp|B9M6G8|RL14_GEODF 50S ribosomal protein L14 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplN PE=3 SV=1 7 77 2.0E-16
sp|A4XLS0|RL14_CALS8 50S ribosomal protein L14 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rplN PE=3 SV=1 10 77 2.0E-16
sp|P56363|RK14_CHLVU 50S ribosomal protein L14, chloroplastic OS=Chlorella vulgaris GN=rpl14 PE=3 SV=1 10 77 2.0E-16
sp|Q1RHN1|RL14_RICBR 50S ribosomal protein L14 OS=Rickettsia bellii (strain RML369-C) GN=rplN PE=3 SV=1 9 76 2.0E-16
sp|A8GVC4|RL14_RICB8 50S ribosomal protein L14 OS=Rickettsia bellii (strain OSU 85-389) GN=rplN PE=3 SV=1 9 76 2.0E-16
sp|B7IHV6|RL14_THEAB 50S ribosomal protein L14 OS=Thermosipho africanus (strain TCF52B) GN=rplN PE=3 SV=1 10 77 2.0E-16
sp|Q03EC6|RL14_PEDPA 50S ribosomal protein L14 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rplN PE=3 SV=1 10 77 2.0E-16
sp|B3EGY0|RL14_CHLL2 50S ribosomal protein L14 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rplN PE=3 SV=1 10 77 2.0E-16
sp|Q7VTC1|RL14_BORPE 50S ribosomal protein L14 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplN PE=3 SV=1 5 77 2.0E-16
sp|A9IHU2|RL14_BORPD 50S ribosomal protein L14 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rplN PE=3 SV=1 5 77 2.0E-16
sp|Q7W2E5|RL14_BORPA 50S ribosomal protein L14 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rplN PE=3 SV=1 5 77 2.0E-16
sp|Q7WRB3|RL14_BORBR 50S ribosomal protein L14 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rplN PE=3 SV=1 5 77 2.0E-16
sp|Q9TL22|RK14_NEPOL 50S ribosomal protein L14, chloroplastic OS=Nephroselmis olivacea GN=rpl14 PE=3 SV=1 10 77 2.0E-16
sp|A1WKA6|RL14_VEREI 50S ribosomal protein L14 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rplN PE=3 SV=1 5 77 2.0E-16
sp|A8GPE0|RL14_RICAH 50S ribosomal protein L14 OS=Rickettsia akari (strain Hartford) GN=rplN PE=3 SV=1 8 76 2.0E-16
sp|C4K2G9|RL14_RICPU 50S ribosomal protein L14 OS=Rickettsia peacockii (strain Rustic) GN=rplN PE=3 SV=1 8 76 3.0E-16
sp|Q92GX6|RL14_RICCN 50S ribosomal protein L14 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplN PE=3 SV=1 8 76 3.0E-16
sp|C3PP97|RL14_RICAE 50S ribosomal protein L14 OS=Rickettsia africae (strain ESF-5) GN=rplN PE=3 SV=1 8 76 3.0E-16
sp|Q8CRG9|RL14_STAES 50S ribosomal protein L14 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplN PE=3 SV=1 10 77 3.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044267 cellular protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043229 intracellular organelle No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1696
MAGLAASAKVKRGDIRHAVVVRTRYPSQRRDGSVVRFDDNACVLLNKSGDPVGTRINGVVGAELKRKNWSKILSM
APMQA*
Coding >Hirsu2|1696
ATGGCCGGCCTCGCCGCCTCGGCCAAGGTCAAGCGCGGCGACATCCGCCACGCCGTCGTCGTCCGCACCCGCTAC
CCCAGCCAGCGCCGCGACGGCTCCGTCGTCCGCTTCGACGACAACGCCTGCGTCCTCCTCAACAAGTCGGGCGAC
CCCGTCGGCACCCGCATCAACGGCGTCGTCGGCGCCGAGCTCAAGCGCAAGAACTGGTCCAAGATCCTCTCCATG
GCCCCCATGCAGGCCTGA
Transcript >Hirsu2|1696
ATGGCCGGCCTCGCCGCCTCGGCCAAGGTCAAGCGCGGCGACATCCGCCACGCCGTCGTCGTCCGCACCCGCTAC
CCCAGCCAGCGCCGCGACGGCTCCGTCGTCCGCTTCGACGACAACGCCTGCGTCCTCCTCAACAAGTCGGGCGAC
CCCGTCGGCACCCGCATCAACGGCGTCGTCGGCGCCGAGCTCAAGCGCAAGAACTGGTCCAAGATCCTCTCCATG
GCCCCCATGCAGGCCTGA
Gene >Hirsu2|1696
ATGGCCGGCCTCGCCGCCTCGGCCAAGGTCAAGCGCGGCGACATCCGCCACGCCGTCGTCGTCCGCACCCGCTAC
CCCAGCCAGCGCCGCGACGGCTCCGTCGTCCGCTTCGACGACAACGCCTGCGTCCTCCTCAACAAGTCGGGCGAC
CCCGTCGGCACCCGCATCAACGGCGTCGTCGGCGCCGAGCTCAAGCGCAAGAACTGGTCCAAGATCCTCTCCATG
GCCCCCATGCAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail