Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1694
Gene name
LocationContig_1383:1198..2167
Strand-
Gene length (bp)969
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00639 Rotamase PPIC-type PPIASE domain 9.8E-22 80 182
PF13616 Rotamase_3 PPIC-type PPIASE domain 2.6E-15 73 181
PF00397 WW WW domain 1.2E-07 13 43

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60045|SSP1_NEUCR Peptidyl-prolyl cis-trans isomerase ssp-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ssp-1 PE=1 SV=3 10 184 7.0E-86
sp|O74448|PIN1_SCHPO Peptidyl-prolyl cis-trans isomerase pin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pin1 PE=3 SV=1 8 182 1.0E-60
sp|Q4R383|PIN1_MACFA Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Macaca fascicularis GN=PIN1 PE=2 SV=1 8 184 6.0E-49
sp|Q13526|PIN1_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens GN=PIN1 PE=1 SV=1 8 184 1.0E-48
sp|P0C1J8|PIN1_RHIO9 Peptidyl-prolyl cis-trans isomerase pin1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=pin1 PE=3 SV=1 13 182 7.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60045|SSP1_NEUCR Peptidyl-prolyl cis-trans isomerase ssp-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ssp-1 PE=1 SV=3 10 184 7.0E-86
sp|O74448|PIN1_SCHPO Peptidyl-prolyl cis-trans isomerase pin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pin1 PE=3 SV=1 8 182 1.0E-60
sp|Q4R383|PIN1_MACFA Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Macaca fascicularis GN=PIN1 PE=2 SV=1 8 184 6.0E-49
sp|Q13526|PIN1_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens GN=PIN1 PE=1 SV=1 8 184 1.0E-48
sp|P0C1J8|PIN1_RHIO9 Peptidyl-prolyl cis-trans isomerase pin1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=pin1 PE=3 SV=1 13 182 7.0E-48
sp|Q5BIN5|PIN1_BOVIN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Bos taurus GN=PIN1 PE=2 SV=1 8 184 2.0E-47
sp|Q9QUR7|PIN1_MOUSE Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Mus musculus GN=Pin1 PE=1 SV=1 8 184 1.0E-45
sp|P22696|ESS1_YEAST Peptidyl-prolyl cis-trans isomerase ESS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESS1 PE=1 SV=3 3 183 7.0E-43
sp|P54353|DOD_DROME Putative peptidyl-prolyl cis-trans isomerase dodo OS=Drosophila melanogaster GN=dod PE=2 SV=3 13 182 1.0E-39
sp|Q94G00|PIN1_MALDO Peptidyl-prolyl cis-trans isomerase Pin1 OS=Malus domestica GN=PIN1 PE=2 SV=1 75 182 4.0E-31
sp|Q9SL42|PIN1_ARATH Peptidyl-prolyl cis-trans isomerase Pin1 OS=Arabidopsis thaliana GN=PIN1 PE=1 SV=1 75 182 3.0E-30
sp|Q9LEK8|PIN1_DIGLA Peptidyl-prolyl cis-trans isomerase Pin1 OS=Digitalis lanata GN=PARV12.8 PE=1 SV=1 75 182 1.0E-29
sp|P0DMT5|PIN1B_THEAN Buparvaquone-resistant peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Theileria annulata GN=PIN1 PE=1 SV=1 75 183 2.0E-23
sp|Q4UG71|PIN1_THEAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Theileria annulata GN=PIN1 PE=1 SV=1 75 183 3.0E-23
sp|Q6GFL5|PRSA_STAAR Foldase protein PrsA OS=Staphylococcus aureus (strain MRSA252) GN=prsA PE=3 SV=1 35 181 1.0E-12
sp|Q2YTZ6|PRSA_STAAB Foldase protein PrsA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=prsA PE=3 SV=1 35 181 2.0E-12
sp|A7X3U8|PRSA_STAA1 Foldase protein PrsA OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=prsA PE=3 SV=1 35 181 9.0E-12
sp|A6U2U4|PRSA_STAA2 Foldase protein PrsA OS=Staphylococcus aureus (strain JH1) GN=prsA PE=3 SV=1 35 181 9.0E-12
sp|Q2FFQ5|PRSA_STAA3 Foldase protein PrsA OS=Staphylococcus aureus (strain USA300) GN=prsA PE=3 SV=1 35 181 9.0E-12
sp|Q2G2S6|PRSA_STAA8 Foldase protein PrsA OS=Staphylococcus aureus (strain NCTC 8325) GN=prsA PE=3 SV=1 35 181 9.0E-12
sp|Q5HET4|PRSA_STAAC Foldase protein PrsA OS=Staphylococcus aureus (strain COL) GN=prsA PE=3 SV=1 35 181 9.0E-12
sp|P60747|PRSA_STAAM Foldase protein PrsA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=prsA PE=1 SV=1 35 181 9.0E-12
sp|P60748|PRSA_STAAN Foldase protein PrsA OS=Staphylococcus aureus (strain N315) GN=prsA PE=1 SV=1 35 181 9.0E-12
sp|Q6G894|PRSA_STAAS Foldase protein PrsA OS=Staphylococcus aureus (strain MSSA476) GN=prsA PE=3 SV=1 35 181 9.0E-12
sp|A8YY10|PRSA_STAAT Foldase protein PrsA OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=prsA PE=3 SV=1 35 181 9.0E-12
sp|P60749|PRSA_STAAW Foldase protein PrsA OS=Staphylococcus aureus (strain MW2) GN=prsA PE=3 SV=1 35 181 9.0E-12
sp|A6QI23|PRSA_STAAE Foldase protein PrsA OS=Staphylococcus aureus (strain Newman) GN=prsA PE=3 SV=1 35 181 9.0E-12
sp|Q8CXK4|PRSA_OCEIH Foldase protein PrsA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=prsA PE=3 SV=1 114 180 1.0E-10
sp|P24327|PRSA_BACSU Foldase protein PrsA OS=Bacillus subtilis (strain 168) GN=prsA PE=1 SV=1 74 184 1.0E-10
sp|Q81TU1|PRSA2_BACAN Foldase protein PrsA 2 OS=Bacillus anthracis GN=prsA2 PE=1 SV=1 86 181 1.0E-10
sp|Q8CNR4|PRSA_STAES Foldase protein PrsA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=prsA PE=3 SV=1 71 181 2.0E-10
sp|Q5HN96|PRSA_STAEQ Foldase protein PrsA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=prsA PE=3 SV=1 124 181 6.0E-10
sp|Q81GN0|PRSA2_BACCR Foldase protein PrsA 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prsA2 PE=3 SV=1 86 181 2.0E-09
sp|Q5L289|PRSA_GEOKA Foldase protein PrsA OS=Geobacillus kaustophilus (strain HTA426) GN=prsA PE=3 SV=1 75 180 3.0E-09
sp|Q81U45|PRSA1_BACAN Foldase protein PrsA 1 OS=Bacillus anthracis GN=prsA1 PE=1 SV=1 76 180 4.0E-09
sp|A4IKU2|PRSA_GEOTN Foldase protein PrsA OS=Geobacillus thermodenitrificans (strain NG80-2) GN=prsA PE=3 SV=1 132 180 6.0E-09
sp|Q81GY5|PRSA1_BACCR Foldase protein PrsA 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prsA1 PE=3 SV=1 76 180 1.0E-08
sp|C5D6L9|PRSA_GEOSW Foldase protein PrsA OS=Geobacillus sp. (strain WCH70) GN=prsA PE=3 SV=1 75 180 2.0E-08
sp|Q3SGF9|SURA_THIDA Chaperone SurA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=surA PE=3 SV=1 78 184 5.0E-08
sp|Q9KDN4|PRSA_BACHD Foldase protein PrsA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prsA PE=3 SV=1 123 180 6.0E-08
sp|Q2KXA6|SURA_BORA1 Chaperone SurA OS=Bordetella avium (strain 197N) GN=surA PE=3 SV=1 78 184 7.0E-08
sp|Q2YBP3|SURA_NITMU Chaperone SurA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=surA PE=3 SV=1 126 184 5.0E-07
sp|Q5P7I9|SURA_AROAE Chaperone SurA OS=Aromatoleum aromaticum (strain EbN1) GN=surA PE=3 SV=2 64 181 1.0E-06
sp|Q7W4J5|SURA_BORPA Chaperone SurA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=surA PE=3 SV=1 72 184 2.0E-06
sp|Q7WG19|SURA_BORBR Chaperone SurA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=surA PE=3 SV=1 72 184 2.0E-06
sp|Q2T116|SURA_BURTA Chaperone SurA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=surA PE=3 SV=1 32 183 4.0E-06
sp|Q7VU12|SURA_BORPE Chaperone SurA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=surA PE=3 SV=1 72 184 6.0E-06
sp|Q82W17|SURA_NITEU Chaperone SurA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=surA PE=3 SV=1 102 184 8.0E-06
sp|Q479U4|SURA_DECAR Chaperone SurA OS=Dechloromonas aromatica (strain RCB) GN=surA PE=3 SV=1 102 184 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0005515 protein binding Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0016853 isomerase activity No
GO:0016859 cis-trans isomerase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1694
MLVPVTAMADTGLPPNWEVRHSNSKNLPYYFNSLDKVSRWEPPQGTDTDKLKHYMAANHSAGTRPGAVPGVPEGK
IRAAHLLVKHRDSRRPSSWRESTITRSKDEAMEIIKIHEHKIKSGAASLGELAPTESDCSSARKRGDLGYFGRGD
MQKEFEEAAFALKPGEMSDVVETASGLHLIERLE*
Coding >Hirsu2|1694
ATGCTGGTCCCCGTCACAGCCATGGCTGATACCGGTCTGCCGCCCAACTGGGAGGTCCGCCACTCCAACTCCAAG
AACCTGCCCTACTACTTCAACTCGCTCGACAAGGTCTCCCGCTGGGAGCCGCCCCAGGGCACCGACACCGACAAG
CTCAAGCACTACATGGCCGCCAACCACAGCGCCGGCACTCGCCCCGGCGCCGTCCCCGGCGTGCCCGAGGGCAAG
ATCCGCGCCGCCCACCTGCTCGTCAAGCATCGCGACAGCAGGCGGCCCAGCAGCTGGCGAGAGTCGACCATCACC
CGCTCCAAGGACGAGGCCATGGAGATCATCAAGATCCACGAGCACAAGATCAAGTCGGGCGCCGCCTCCCTCGGC
GAGCTCGCCCCGACCGAGTCCGACTGCTCCTCCGCCCGCAAGCGCGGCGACCTCGGCTACTTCGGCCGCGGAGAC
ATGCAGAAGGAGTTTGAGGAGGCCGCCTTTGCCCTCAAGCCCGGCGAGATGAGCGACGTTGTGGAGACGGCGAGC
GGCCTACATCTCATCGAGAGGTTAGAGTAG
Transcript >Hirsu2|1694
ATGCTGGTCCCCGTCACAGCCATGGCTGATACCGGTCTGCCGCCCAACTGGGAGGTCCGCCACTCCAACTCCAAG
AACCTGCCCTACTACTTCAACTCGCTCGACAAGGTCTCCCGCTGGGAGCCGCCCCAGGGCACCGACACCGACAAG
CTCAAGCACTACATGGCCGCCAACCACAGCGCCGGCACTCGCCCCGGCGCCGTCCCCGGCGTGCCCGAGGGCAAG
ATCCGCGCCGCCCACCTGCTCGTCAAGCATCGCGACAGCAGGCGGCCCAGCAGCTGGCGAGAGTCGACCATCACC
CGCTCCAAGGACGAGGCCATGGAGATCATCAAGATCCACGAGCACAAGATCAAGTCGGGCGCCGCCTCCCTCGGC
GAGCTCGCCCCGACCGAGTCCGACTGCTCCTCCGCCCGCAAGCGCGGCGACCTCGGCTACTTCGGCCGCGGAGAC
ATGCAGAAGGAGTTTGAGGAGGCCGCCTTTGCCCTCAAGCCCGGCGAGATGAGCGACGTTGTGGAGACGGCGAGC
GGCCTACATCTCATCGAGAGGTTAGAGTAG
Gene >Hirsu2|1694
ATGCTGGTCCCCGTCACAGCCATGGTGAGCGAACGCGCGCAGCTCCATCGCCACGGACAACCGGAGATCGCAGAG
TGGGGAGAGGACAAGTCAACCAAAAAATAAAATAGAAAAAAAACCGGCAAAATCGACGACAAATCGGCTACACAA
GCCGTCTCCTCCTCCGCTCCCCTCTCCGTCCCGCGATAGTCCATCCCCCTCGTGCGCCTTTAGCCGGGGCTCCGC
CGCCAGACGCTAACTCGTGCCCAAACGCTCCAGGCTGATACCGGTCTGCCGCCCAACTGGGAGGTCCGCCACTCC
AACTCCAAGAACCTGCCCTACTACTTCAACTCGCTCGACAAGGTCTCCCGCTGGGAGCCGCCCCAGGGCACCGAC
ACCGACAAGCTCAAGCACTACATGGCCGCCAACCACAGCGCCGGCACTCGCCCCGGCGCCGTCCCCGGCGTGCCC
GAGGGCAAGATCCGCGCCGCCCACCTGCTCGTCAAGCATCGCGACAGCAGGCGGCCCAGCAGCTGGCGAGAGGTA
CGGCGACCAAGTCGATCATCACCCCCCGCGCCGCGCCCAAGACGCAGGACGAGCCGTCGTCAAGGCGCGCCGAGC
CCGACGAGATGCTGACCCCTCTTTGCCTCGTCACCCCCCTTAGTCGACCATCACCCGCTCCAAGGACGAGGCCAT
GGAGATCATCAAGATCCACGAGCACAAGATCAAGTCGGGCGCCGCCTCCCTCGGCGAGCTCGCCCCGACCGAGTC
CGACTGCTCCTCCGCCCGCAAGCGCGGCGACCTCGGCTACTTCGGCCGCGGAGACATGCAGAAGGAGTTTGAGGA
GGCCGCCTTTGCCCTCAAGCCCGGCGAGATGAGCGACGTTGTGGAGACGGCGAGCGGCCTACATCTCATCGAGAG
GTACGTCCGTGGCCCCGAGCGGCTCACCAATCCCGGCCTGACATGCCCGTAATATGCAGGTTAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail