Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1693
Gene name
LocationContig_1383:47..560
Strand+
Gene length (bp)513
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04172 LrgB LrgB-like family 1.4E-08 1 61
PF04172 LrgB LrgB-like family 1.3E-06 110 156

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 108 130 22
2 135 157 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1693
LGLPPPEALAFAARSTTLALARPAVRGVGGNLAVQAILVVSNGVLAQLLCPLLLDKLGVESAGDGDGSPARPPAD
DAASPPPPPGRPGDKTGEPAPQGAQSARGESGSVTVAAGVAVGANGAAMGVSYLYEVRSHAAPYAALSMTVFGVM
TVVFMTLDPFRSQVEGLARG*
Coding >Hirsu2|1693
CTGGGCCTTCCCCCGCCCGAGGCGCTTGCCTTCGCCGCCCGCAGCACCACCCTGGCCCTGGCCCGGCCGGCCGTC
CGGGGCGTGGGGGGCAACCTCGCGGTCCAGGCCATCCTCGTCGTCAGCAACGGCGTCCTGGCGCAGCTGCTCTGC
CCGCTCCTCCTCGACAAGCTGGGCGTCGAGAGCGCGGGAGACGGCGATGGGTCGCCCGCCCGTCCGCCCGCCGAC
GACGCCGCCTCTCCTCCTCCTCCTCCCGGCCGGCCCGGAGACAAGACGGGAGAGCCGGCGCCGCAGGGCGCGCAG
AGCGCGCGGGGTGAGAGCGGCTCGGTCACGGTGGCGGCGGGCGTCGCCGTCGGCGCCAACGGAGCCGCCATGGGC
GTCTCATATCTTTACGAGGTCCGGAGCCACGCGGCCCCATACGCAGCCCTATCCATGACCGTCTTCGGAGTCATG
ACCGTCGTCTTCATGACGCTTGACCCCTTCAGGAGCCAAGTCGAGGGCTTGGCAAGGGGCTAG
Transcript >Hirsu2|1693
CTGGGCCTTCCCCCGCCCGAGGCGCTTGCCTTCGCCGCCCGCAGCACCACCCTGGCCCTGGCCCGGCCGGCCGTC
CGGGGCGTGGGGGGCAACCTCGCGGTCCAGGCCATCCTCGTCGTCAGCAACGGCGTCCTGGCGCAGCTGCTCTGC
CCGCTCCTCCTCGACAAGCTGGGCGTCGAGAGCGCGGGAGACGGCGATGGGTCGCCCGCCCGTCCGCCCGCCGAC
GACGCCGCCTCTCCTCCTCCTCCTCCCGGCCGGCCCGGAGACAAGACGGGAGAGCCGGCGCCGCAGGGCGCGCAG
AGCGCGCGGGGTGAGAGCGGCTCGGTCACGGTGGCGGCGGGCGTCGCCGTCGGCGCCAACGGAGCCGCCATGGGC
GTCTCATATCTTTACGAGGTCCGGAGCCACGCGGCCCCATACGCAGCCCTATCCATGACCGTCTTCGGAGTCATG
ACCGTCGTCTTCATGACGCTTGACCCCTTCAGGAGCCAAGTCGAGGGCTTGGCAAGGGGCTAG
Gene >Hirsu2|1693
CTGGGCCTTCCCCCGCCCGAGGCGCTTGCCTTCGCCGCCCGCAGCACCACCCTGGCCCTGGCCCGGCCGGCCGTC
CGGGGCGTGGGGGGCAACCTCGCGGTCCAGGCCATCCTCGTCGTCAGCAACGGCGTCCTGGCGCAGCTGCTCTGC
CCGCTCCTCCTCGACAAGCTGGGCGTCGAGAGCGCGGGAGACGGCGATGGGTCGCCCGCCCGTCCGCCCGCCGAC
GACGCCGCCTCTCCTCCTCCTCCTCCCGGCCGGCCCGGAGACAAGACGGGAGAGCCGGCGCCGCAGGGCGCGCAG
AGCGCGCGGGGTGAGAGCGGCTCGGTCACGGTGGCGGCGGGCGTCGCCGTCGGCGCCAACGGAGCCGCCATGGGC
GTCTCATATCTTTACGAGGTCCGGAGCCACGCGGCCCCATACGCAGCCCTATCCATGACCGTCTTCGGAGTCATG
ACCGTCGTCTTCATGACGCTTGACCCCTTCAGGAGCCAAGTCGAGGGCTTGGCAAGGGGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail